KEGG   Rattus norvegicus (rat): 64193
Entry
64193             CDS       T01003                                 

Gene name
Pttg1
Definition
(RefSeq) securin
  KO
K06635  securin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    64193 (Pttg1)
   04114 Oocyte meiosis
    64193 (Pttg1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64193 (Pttg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    64193 (Pttg1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    64193 (Pttg1)
Motif
Pfam: Securin RRN3
Other DBs
NCBI-GeneID: 64193
NCBI-ProteinID: NP_071786
RGD: 68359
Ensembl: ENSRNOG00000003802
UniProt: P97613 B0BMT1
Position
10
AA seq 199 aa
MATLIFVDKDNEEPGSRLASKDGLKLGSGVKALDGKLQVSTPRVGKVFGAPGLPKASRKA
LGTVNRVTEKPVKSSKPLQSKQPTLSVKKITEKSTKTQGSAPAPDDAYPEIEKFFPFDPL
DFESFDLPEEHQISLLPLNGVPLMILNEERGLEKLLHLDPPSPLQKPFLPWESDPLPSPP
SALSALDVELPPVCYDADI
NT seq 600 nt   +upstreamnt  +downstreamnt
atggctactctgatctttgttgataaggataacgaagagccaggcagccgtttggcatct
aaggatggattgaagctgggctctggtgtcaaagccttagatgggaaattgcaggtttca
acgccacgagtcggcaaagtgttcggtgccccaggcttgcctaaagccagcaggaaggct
ctgggaactgtcaacagagttactgaaaagccagtgaagagtagtaaacccctgcaatcg
aaacagccgactctgagtgtgaaaaagatcaccgagaagtctactaagacacaaggctct
gctcctgctcctgatgatgcctacccagaaatagaaaagttcttccccttcgatcctcta
gattttgagagttttgacctgcctgaagagcaccagatctcacttctccccttgaatgga
gtgcctctcatgatcctgaatgaagagagggggcttgagaagctgctgcacctggacccc
ccttcccctctgcagaagcccttcctaccgtgggaatctgatccgttgccgtctcctccc
agcgccctctccgctctggatgttgaattgccgcctgtttgttacgatgcagatatttaa

DBGET integrated database retrieval system