KEGG   Rattus norvegicus (rat): 64455
Entry
64455             CDS       T01003                                 

Gene name
Rasd1
Definition
(RefSeq) dexamethasone-induced Ras-related protein 1
  KO
K07843  RAS, dexamethasone-induced Ras-related protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
rno04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04713 Circadian entrainment
    64455 (Rasd1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    64455 (Rasd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:rno04031]
    64455 (Rasd1)
GTP-binding proteins [BR:rno04031]
 Small (monomeric) G-proteins
  Ras Family
   RasD
    64455 (Rasd1)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB TniB MMR_HSR1
Other DBs
NCBI-GeneID: 64455
NCBI-ProteinID: NP_001257883
RGD: 619727
Ensembl: ENSRNOG00000003348
UniProt: Q9JKF8
Position
10
AA seq 280 aa
MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDF
HRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQ
ILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKK
NSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGD
AFGILAPFARRPSVHSDLMYIREKTSVSSQAKDKERCVIS
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaaactggccgcgatgatcaagaagatgtgcccaagcgactctgaactgagtatcccg
gccaagaactgctacaggatggtcatcctcggctcatccaaagtgggcaagacggccatc
gtgtcgcgcttcctcacgggccgcttcgaggacgcttacacccctaccattgaagacttc
caccgaaagttttactcgatccgcggcgaagtctaccagttggacatactggacacatct
ggcaatcatccgtttcccgccatgcggcgcctctctatcctcacaggagacgttttcatt
ctggtgttcagcttagacaaccgcgactccttcgaggaggtgcaaaggctcaaacagcag
atcctagacaccaagtcctgtctcaagaacaaaaccaaagagaatgtggacgtgccgctg
gtcatttgcggtaacaaaggggaccgggacttctaccgcgaagtggagcagcgggagatt
gagcagctggtgggcgatgaccctcagcgttgtgcctacttcgagatctcggccaagaag
aatagcagcctggaccagatgttccgtgcgctctttgccatggccaagctgcctagcgag
atgagccctgacttgcaccgcaaggtgtctgtgcagtactgtgacgtgctgcacaaaaag
gctctgaggaacaagaagcttctgcgtgcgggcagcggaggtgggggcgaccacggagat
gcctttggcatcttggcgccctttgctcgcagacctagcgtgcatagcgacctcatgtac
attcgtgagaaaaccagtgtcagcagccaggctaaggacaaggagcgctgtgtcatcagt
tag

DBGET integrated database retrieval system