KEGG   Rattus norvegicus (rat): 64515
Entry
64515             CDS       T01003                                 

Gene name
Cdc20
Definition
(RefSeq) cell division cycle protein 20 homolog
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04120  Ubiquitin mediated proteolysis
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    64515 (Cdc20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    64515 (Cdc20)
   04114 Oocyte meiosis
    64515 (Cdc20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    64515 (Cdc20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64515 (Cdc20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    64515 (Cdc20)
   03036 Chromosome and associated proteins [BR:rno03036]
    64515 (Cdc20)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     64515 (Cdc20)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    64515 (Cdc20)
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb nos_propeller Hira
Other DBs
NCBI-GeneID: 64515
NCBI-ProteinID: NP_741990
RGD: 620477
Ensembl: ENSRNOG00000028415
Vega: OTTRNOG00000002344
UniProt: Q62623
Position
5
AA seq 499 aa
MAQFVFESDLHSLLQLDAPIPNAPIARWQRKAKEATGPAPSPMRAANRSHSAGRTPGRTP
GKSNSKVQTTPSKPGGDRYIPQRSASQMEVASFLLSKENQPEDGGTPTKKEHQKAWARNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKACRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDYISSVAWIKEGNY
LAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWVPLQTFTQHQGAVKA
VAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPALR
REREKASTSKSSLIHQGIR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgcagttcgtgttcgagagcgatttgcattcactgcttcaactggacgcgcccatc
cccaatgcaccgattgctcgctggcagcgcaaagcaaaagaagccacaggcccagccccc
tcgcctatgcgggccgccaacagatcacacagcgccggtcggaccccgggccgaactcct
ggcaaatctaattctaaggttcagaccacccctagcaaacctggaggtgaccgctatatc
ccccaacgtagtgcttcccaaatggaggtggccagcttcctcttgagcaaggagaaccag
ccggaagacgggggtacgcccaccaagaaggagcatcagaaagcctgggctcggaacctg
aacggttttgatgtggaggaagccaagatcctcaggctcagtggaaaacctcagaatgcc
ccagaaggctaccagaacagattgaaagtactctacagccagaaagccacgcctggctcc
agtcggaaggcttgcagatacattccttccctgccagacaggattcttgatgcccctgaa
atccggaatgactactacctgaatcttgtcgattggagctctggaaatgtattagctgtg
gcactggacaacagtgtgtacttatggaacgctggttccggtgacatcctgcagctgttg
caaatggagcagcctggggactacatatcatccgtggcctggatcaaagagggcaactac
ctggctgtgggcaccagtaatgctgaggtgcagctatgggatgtgcagcagcagaaacgg
cttcgaaacatgaccagccactctgctcgagtaagctccctgagttggaacagctatatc
ctgtcaagtggttcacgatctggccacatccaccaccacgatgttcgagtagcagaacac
catgtggccacactgagtggccatagccaggaagtatgtgggctgcgctgggccccagat
ggacgacatctggcaagcggtggcaatgataacattgtcaacgtgtggcctagtggtcct
ggagaaagtggctgggttcccctgcagacattcactcaacatcaaggtgctgtcaaggct
gttgcatggtgtccctggcagtccaatatcctggcaacaggaggaggtaccagtgaccga
cacattcgcatttggaacgtctgctctggagcctgtctgagtgctgtggatgtgcattcc
caggtgtgctccatcctctggtctccccactataaggagctcatctcaggccatggcttt
gcccagaaccagctggttatttggaagtacccaaccatggccaaggtggcagagctcaaa
ggtcacacagcccgggtcctgagtctcaccatgagtccagacggggccacagtggcatct
gcagcagccgatgagactctgcggctctggcgctgctttgagctggaccctgcccttcgg
cgggagcgggaaaaagccagcacatctaaaagtagcctcatccaccaaggcatccggtga

DBGET integrated database retrieval system