KEGG   Rattus norvegicus (rat): 64537
Entry
64537             CDS       T01003                                 

Gene name
Hpse
Definition
(RefSeq) heparanase precursor
  KO
K07964  heparanase [EC:3.2.1.166]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00531  Glycosaminoglycan degradation
rno01100  Metabolic pathways
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    64537 (Hpse)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    64537 (Hpse)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    64537 (Hpse)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.166  heparanase
     64537 (Hpse)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Enzymes
   64537 (Hpse)
SSDB
Motif
Pfam: Glyco_hydro_79n
Other DBs
NCBI-GeneID: 64537
NCBI-ProteinID: NP_072127
RGD: 61969
Ensembl: ENSRNOG00000002188
UniProt: Q71RP1
Position
14
AA seq 536 aa
MLRPLLLLWLWGRLRALTQGTPAGTAPTKDVVDLEFYTKRLFQSVSPSFLSITIDASLAT
DPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKEPTSEERSYWQSQDNNDIC
GSERVSADVLRKLQMEWPFQELLLLREQYQREFKNSTYSRSSVDMLYSFAKCSRLDLIFG
LNALLRTPDLRWNSSNAQLLLNYCSSKGYNISWELGNEPNSFWKKAQISIDGLQLGEDFV
ELHKLLQKSAFQNAKLYGPDIGQPRGKTVKLLRSFLKAGGEVIDSLTWHHYYLNGRVATK
EDFLSSDVLDTFILSVQKILKVTKEMTPGKKVWLGETSSAYGGGAPLLSNTFAAGFMWLD
KLGLSAQLGIEVVMRQVFFGAGNYHLVDENFEPLPDYWLSLLFKKLVGPKVLMSRVKGPD
RSKLRVYLHCTNVYHPRYREGDLTLYVLNLHNVTKHLKLPPPMFSRPVDKYLLKPFGSDG
LLSKSVQLNGQTLKMVDEQTLPALTEKPLPAGSSLSVPAFSYGFFVIRNAKIAACI
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgctgcggccgctgctgctgctgtggctctgggggcggctccgtgccctgacccaaggc
actccggcggggaccgcgccgaccaaggacgtggtggacttggagttttacaccaagagg
ctattccaaagcgtgagtccctcgttcctgtccatcaccatcgacgccagcctggccacc
gaccctcggttcctcaccttcctgggctctccacggcttcgagccctggctagaggctta
tctcctgcgtacttgagatttggcggcaccaagactgacttccttatttttgatcccaac
aaggaacccacctctgaagaaagaagttactggcaatctcaagacaacaatgatatttgc
gggtctgagcgggtctctgctgacgtgttgaggaaactccagatggagtggcccttccag
gagctgctgctgctccgagaacagtaccaaagagaattcaagaacagcacctactcacga
agctcggtggacatgctctacagttttgctaagtgctcgaggttagacctgatctttggt
ctaaatgcgttactaagaaccccagacttgcggtggaacagctccaacgcccagcttctc
ctcaactactgctcttccaagggttataacatctcctgggaactgggcaacgagcccaac
agtttctggaagaaagctcagatttccatcgatgggttgcagctaggagaagactttgtg
gagttgcataaacttctacaaaagtcagctttccaaaacgcaaaactctatggtcctgac
attggtcagcctcgagggaagacagttaagctgctgagaagcttcctgaaggctggtgga
gaagtgattgactctctcacctggcatcactactacttgaatggacgagttgcgaccaaa
gaagattttctgagctctgatgtcctggacacttttatcctatctgtgcaaaaaattctg
aaggtgactaaggagatgacacctggcaagaaggtctggttgggagagacgagctctgcc
tacggcggcggagcgcccttgctgtccaatacctttgcagctggctttatgtggctggat
aaattgggcctgtcagcccagctggggatagaagtcgtgatgaggcaggtgtttttcgga
gcaggcaactaccacttagtggacgaaaacttcgagcccttgcccgattactggctctct
ctcctgttcaagaaactggtaggtcccaaggtgttaatgtcaagagtgaaaggcccagac
agaagcaaactccgagtgtacctccactgcacgaacgtctatcacccaaggtatcgggaa
ggagatttaactctgtacgtcctgaacctccataatgtcaccaagcacttgaagctgccg
cctccgatgttcagcagaccggtggataagtacctgctgaagcctttcggttctgacgga
ctgctttccaaatccgtccaactgaacggtcaaaccctgaagatggtcgatgagcagacc
ctgccagctctaacagaaaaacctctccccgcaggaagctcactaagcgtgcccgccttt
tcctatgggttttttgtcataagaaatgccaaaatcgcagcttgtatatga

DBGET integrated database retrieval system