KEGG   Rattus norvegicus (rat): 64639
Entry
64639             CDS       T01003                                 

Gene name
Bad
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01521  EGFR tyrosine kinase inhibitor resistance
rno01522  Endocrine resistance
rno01524  Platinum drug resistance
rno04012  ErbB signaling pathway
rno04014  Ras signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04024  cAMP signaling pathway
rno04062  Chemokine signaling pathway
rno04140  Autophagy - animal
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04370  VEGF signaling pathway
rno04510  Focal adhesion
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno04919  Thyroid hormone signaling pathway
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05207  Chemical carcinogenesis - receptor activation
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05213  Endometrial cancer
rno05215  Prostate cancer
rno05218  Melanoma
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
rno05223  Non-small cell lung cancer
rno05225  Hepatocellular carcinoma
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    64639 (Bad)
   04014 Ras signaling pathway
    64639 (Bad)
   04370 VEGF signaling pathway
    64639 (Bad)
   04024 cAMP signaling pathway
    64639 (Bad)
   04022 cGMP-PKG signaling pathway
    64639 (Bad)
   04151 PI3K-Akt signaling pathway
    64639 (Bad)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    64639 (Bad)
  09143 Cell growth and death
   04210 Apoptosis
    64639 (Bad)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    64639 (Bad)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    64639 (Bad)
  09152 Endocrine system
   04910 Insulin signaling pathway
    64639 (Bad)
   04919 Thyroid hormone signaling pathway
    64639 (Bad)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    64639 (Bad)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64639 (Bad)
   05207 Chemical carcinogenesis - receptor activation
    64639 (Bad)
   05203 Viral carcinogenesis
    64639 (Bad)
  09162 Cancer: specific types
   05210 Colorectal cancer
    64639 (Bad)
   05212 Pancreatic cancer
    64639 (Bad)
   05225 Hepatocellular carcinoma
    64639 (Bad)
   05221 Acute myeloid leukemia
    64639 (Bad)
   05220 Chronic myeloid leukemia
    64639 (Bad)
   05218 Melanoma
    64639 (Bad)
   05211 Renal cell carcinoma
    64639 (Bad)
   05215 Prostate cancer
    64639 (Bad)
   05213 Endometrial cancer
    64639 (Bad)
   05223 Non-small cell lung cancer
    64639 (Bad)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    64639 (Bad)
   05161 Hepatitis B
    64639 (Bad)
   05160 Hepatitis C
    64639 (Bad)
   05162 Measles
    64639 (Bad)
   05168 Herpes simplex virus 1 infection
    64639 (Bad)
   05165 Human papillomavirus infection
    64639 (Bad)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    64639 (Bad)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    64639 (Bad)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64639 (Bad)
   05014 Amyotrophic lateral sclerosis
    64639 (Bad)
   05020 Prion disease
    64639 (Bad)
   05022 Pathways of neurodegeneration - multiple diseases
    64639 (Bad)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    64639 (Bad)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    64639 (Bad)
   01524 Platinum drug resistance
    64639 (Bad)
   01522 Endocrine resistance
    64639 (Bad)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 64639
NCBI-ProteinID: NP_073189
RGD: 620103
Ensembl: ENSRNOG00000021147
UniProt: O35147
Position
1
AA seq 205 aa
MGTPKQPSLAPAHALGLRKSDPGIRSLGSDAGGRRWRPAAQSMFQIPEFEPSEQEDASTT
DRGLGPSLTEDQPGPYLAPGLLGSIVQQQPGQAANNSHHGGAGTMETRSRHSSYPAGTEE
DEGMEEELSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQ
SASWTRIIQSWWDRNLGKGGSTPSQ
NT seq 618 nt   +upstreamnt  +downstreamnt
atgggaaccccaaagcagccctcgctggctcctgcacacgccctaggcttgaggaagtcc
gatcccggaatccggagcctggggagcgacgcgggaggaaggcggtggagaccagcagcc
cagagtatgttccagatcccagagtttgagccgagtgagcaggaagacgctagtactaca
gataggggcctgggccctagcctcactgaggaccagccaggtccctacctggccccaggt
ctcctggggagcatcgttcagcagcagccgggacaggcagccaataacagtcatcatgga
ggcgctgggactatggagacccggagtcgccacagttcgtacccagcggggactgaggaa
gatgaagggatggaggaggagcttagcccttttcgaggacgctcgcgctcggctcccccc
aatctctgggcagcgcagcgctatggccgtgagctccgaagaatgagcgatgaatttgag
ggttccttcaagggacttcctcgcccaaagagcgcaggcactgcaacacagatgcgacaa
agcgccagttggacgcgcattatccagtcctggtgggatcgaaatttggggaaaggaggc
tccactccctcccagtga

DBGET integrated database retrieval system