KEGG   Rattus norvegicus (rat): 680111
Entry
680111            CDS       T01003                                 

Symbol
Rbl1
Name
(RefSeq) retinoblastoma-like protein 1
  KO
K04681  retinoblastoma-like protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    680111 (Rbl1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    680111 (Rbl1)
   04218 Cellular senescence
    680111 (Rbl1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    680111 (Rbl1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    680111 (Rbl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    680111 (Rbl1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    680111 (Rbl1)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB Rb_C
Other DBs
NCBI-GeneID: 680111
NCBI-ProteinID: NP_001177995
RGD: 1595511
Ensembl: ENSRNOG00000006921
UniProt: D3ZS28
Position
3
AA seq 1049 aa
MFEDEPHAEGAAAVAAAREALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVIHWLA
CSLYVACRKSIIPTVGKGVMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
RIERLERNFEVSTVIFKKFEPIFLDIFQNPYEELPKLPRSRKQRRIPCSVKDLFNFCWTL
FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRRDLLNPSFKGLPSDFHAVNFK
AAEEPPCIIAVLCDLHDGLLVEAKGIKEHYFKPYISKLFDKKILKGECLLDLSSFTDNSK
AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFAADTQFGKLTSQASVDCNLQQHFE
KKRSFAPSTPLTGRRYLQEKEAVTTPVASATQSVSRLQSIVAGLKSAPSEQLLTIFESCM
RNPMGNIVKIVKGIGETFCQHYTQSTDKQPGSHIDFAVNRLKLAEILYYKILETIMVQET
RRLHGMDMSVLLEQDIFHRSLLACCLEIVLFAYSSPRTFPWIIDVLGLQPFYFYKVIEVV
IRSEEGLSRDMVKHLNSIEEQILESLAWTNNSALWEALRASANKVPSCEEVIFPNNFEIG
NGGSVQGHLPMMPMSPIIHPRVKEVRTDSGSLRKDMQPLSPISVHERYSSPAAGSAKRRL
FGDDPPKETLMEKIMAEGTQLKIAPSSVTAESLSISPGQALLTMATTTVTGTTGRKVTVP
LHGIANDAGEITLVPISMNTTQDSTAESLVSLTAQSLIGASPKQTHLTKTQDAPLTGISK
PKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLD
QLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPGEVVAYNGDYEMT
DGDIEDATKTPNCSSEPVKEERGDLIKFYNAIYVGRVKSFALKYDLSNQDHIMDAPPLSP
FPHIKQQPGSPRRISQQHSIYVSPHKNASGLTPRSALLYKFNGSPSKKAKKRVIAISGDA
ESPAKRLCQENDDVLLKRLQDVVSERANH
NT seq 3150 nt   +upstreamnt  +downstreamnt
atgttcgaggacgagccccacgccgagggggcggcagccgtcgccgcggccagggaggcg
ctgcaggccctgtgccaggagctgaacctggacgaggggagcgccgccgaagccctggac
gacttcaccgccatccgcggcaactacagcctagagggggaagttatacactggctggca
tgctctttgtacgtcgcttgccgcaagagcatcattcctaccgtgggaaagggcgtcatg
gaaggaaactgtgtttcgctgaccagaatactacgctcagctaagttaagcttaattcag
ttttttagtaaaatgaagaagtggatggacatgtcaaacctaccacaagaattccgggag
cgtatagaaaggctagaaagaaattttgaagtatctacagtaatttttaaaaaatttgag
cccatttttttagatatctttcaaaatccatatgaagagctaccaaagttgccacgaagc
agaaagcagaggaggattccttgcagtgttaaggatctctttaatttctgctggacgctc
ttcgtttacactaagggtaattttcgtatgattggtgatgatttagtaaactcatatcat
ttacttctgtgctgcttggacctgatttttgccaatgctataatgtgtccaaatagacga
gacttgttaaatccatcatttaaaggtttaccatcggatttccatgctgtgaacttcaaa
gctgcagaagaaccaccctgtatcattgctgtactttgcgatctgcacgatggactttta
gtagaagcaaaaggaataaaggagcactacttcaaaccatatatttcaaaactctttgac
aagaagattttaaaaggtgaatgtctcttggatctttccagttttactgataatagcaaa
gcagtgaacaaggagtatgaagagtatgttctaactgttggggactttgacgagaggatc
tttttgggagcagatgcagaggaggagatcggaacacctcgaaagttcgctgctgacacc
caatttgggaaactgacatcacaggccagtgtggactgcaaccttcaacaacactttgaa
aaaaaacggtcatttgcaccttctaccccacttactggacggcgctatttacaagaaaaa
gaggcagttaccacacctgttgcttcagctactcagagtgtaagccgattacagagcatt
gtagccggattgaaaagtgccccgagcgagcagcttctgactatttttgaatcttgtatg
cggaatccgatgggaaacattgtaaaaatagtgaaaggaataggagagactttctgccag
cactatacccagtccacagataaacagccaggatctcacatagactttgctgtaaacaga
ctgaaactggcagaaattttgtattataaaatactagagactataatggtccaggaaaca
cgacgacttcatggaatggacatgtcagttcttttagaacaagacatatttcacaggtcc
ttgctggcttgttgtttggaaattgtgctctttgcctatagctcaccccgtactttccct
tggatcattgacgttctcggtttgcagccgttttacttctataaggttattgaggtggtg
atccgctcagaggaggggctctccagagacatggtgaaacacctaaacagcattgaagag
cagattttggagagtttagcttggactaataattctgcactgtgggaagctctccgtgct
tctgcaaataaagttccttcctgtgaagaagttatattcccaaataactttgaaatagga
aatggaggaagtgtgcaaggccatcttcccatgatgccaatgtctccaataatacatcca
agagtcaaggaagttcgcactgacagtgggagccttcgaaaagatatgcagccactgtct
cccatctccgtccatgagcgctacagctcccctgccgcaggaagtgctaagaggagactc
tttggtgatgacccaccaaaggagacattgatggaaaagattatggcagaaggaacacag
ctgaaaattgctccttcaagtgtgactgctgaaagcttgtcaatttcccctgggcaagct
cttctcacaatggccacgaccacagtcacagggacgacgggacggaaggttaccgttcct
ttgcatggtattgccaatgatgctggagaaatcacactggttcctatttccatgaataca
actcaggactccacagctgagagccttgtatcactaactgcacagtcattaattggtgct
tctccaaaacagacccatctgactaaaacgcaagacgctcctctgaccggaataagcaaa
ccaaagagaactgggtccttagcactgttttatagaaaggtctatcatttggcaagtgta
cgcttacgtgatttatgtttaaaacttgatgtttcgaatgagttacgaaggaagatctgg
acatgttttgaattcactttagttcactgccctgatttaatgaaagataggcatttggat
cagctccttctgtgtgccttttacatcatggccaaagtaacaaaagaagaaagaactttt
caagaaataatgaaaagttacagaaatcagccacaagctaatagtcacgtatacaggagt
gttctcttgaaaagtattccaggagaagttgtggcatacaatggtgactatgagatgact
gatggtgacatagaagatgccacaaaaactcccaactgttccagtgaaccagtgaaagag
gaaagaggtgatcttatcaaattctacaatgcgatatatgtaggaagagtgaagtcattt
gcattgaagtatgatttgtccaatcaggaccatataatggatgctccaccgctctctcct
ttcccacatattaagcagcagccgggctccccacgccgcatttctcagcagcattccatt
tatgtctctccgcacaagaacgcatcaggcctcacccccaggagcgcactactctacaag
ttcaacggcagcccctctaagaaggccaagaagcgtgtgatcgccatcagcggagatgca
gagtcacctgccaaacgtctctgccaggagaacgatgatgttttacttaaacgactgcag
gatgttgtcagtgaaagagcgaatcattga

KEGG   Rattus norvegicus (rat): 81758
Entry
81758             CDS       T01003                                 

Symbol
Rbl2
Name
(RefSeq) retinoblastoma-like protein 2
  KO
K16332  retinoblastoma-like protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04151  PI3K-Akt signaling pathway
rno04218  Cellular senescence
rno05165  Human papillomavirus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    81758 (Rbl2)
   04151 PI3K-Akt signaling pathway
    81758 (Rbl2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    81758 (Rbl2)
   04218 Cellular senescence
    81758 (Rbl2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81758 (Rbl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81758 (Rbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    81758 (Rbl2)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    81758 (Rbl2)
SSDB
Motif
Pfam: RB_A RB_B DUF3452 TFIIB Myb_DNA-bind_5
Other DBs
NCBI-GeneID: 81758
NCBI-ProteinID: NP_112356
RGD: 3541
Ensembl: ENSRNOG00000012153
UniProt: O55081
Position
19
AA seq 1135 aa
MASGGNQSSPPPPAAAASSEEEEEDGDTADRAQPAGSPSHQIQQRFEELCSRLNMDEAAR
AEAWSSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTAEGNYVSLTRILRCSEQ
SLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPR
QQRGRKQRRQPCTTSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNALQC
SNRKELVNPNFKGVSEDGHPRDSHPSSDPPCVIEKLCSLHDGLVLEAKGIKQHFWKPYIR
KLFEKKLLRGKEENLTGFLEPGNFAESFKAVNKAYEEYVLATGSLDERIFLGEDAEEEVG
TLSRCVSAASGTESAERTQMRDILQQHLDKSKTLRVCNPLTGVRYVQENSPCVTPVSTAT
HSLNRLHTMLAGLRNAPSEKLEQILRSCSRDPTRAIADRLREMYEIYSQHFQPDENVSNC
AKEMANKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGVLEQDAFHKSLLACCLEVVAFS
YKPPGNFPFIAEIFDVPHYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKTKS
PLWDRIRDNENRVPTCEEVTPPHNLERTDEIYIAGSPLTPRRVGEVRTDAGGLGRSVTSP
TTLYDRYSSPTVSTTRRRLFESDSPSEGSTAGRIPPQPLVNAVPVQNVSGETVSVTPVPG
QTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVTGSIQPLSAQA
LAGSLSSQQVTGTTLQVPGPVAIQQISPGGQQQNQGQPLTSSSIRPRKTSSLSLFFRKVY
YLAGVRLRDLCTKLDISDELRKKIWTCFEFSIVQCPELMMDRHLDQLLMCAIYVMAKVTK
EDKSFQNIMRCYRTQPQARSQVYRSVLIKGKRRNSGSCENRSHQNSPTELNTDRASRDSS
PVMRSNSTLPVPQPSSAPPTPTRLTGANSDIEEEERGDLIQFYNNIYRKQIQTFAMKYSQ
ANSQMDTPPLSPYPFVRTGSPRRVQLSQSHPIYISPHKNEAMLSPREKIFYYFSNSPSKR
LREINSMIRTGETPTKKRGILLDDGSESPAKRICPENHSALLRRLQDVANDRGSH
NT seq 3408 nt   +upstreamnt  +downstreamnt
atggcatctggaggcaaccagtcgtcacctccccctcctgctgctgcagccagctcagag
gaagaggaggaggatggcgacaccgcggaccgggcgcagcccgcagggtccccaagccat
cagatccaacagcggttcgaagagctgtgcagccgccttaacatggacgaggcggcacgc
gccgaggcctggagcagctaccgcagcatgagcgagagctacacgctggagggaaatgat
ctccattggttagcatgtgccttatatgtggcttgcagaaaatctgttcctactgtgagc
aaagggactgctgaaggaaactatgtgtctttaactagaatccttcgatgttctgagcaa
agcctaattgaattttttaacaagatgaagaagtgggaagatatggcaaatttaccccca
cacttccgagaacgaaccgaaagattagaaagaaacttcactgtctccgctgtgatcttt
aagaaatatgaacccatttttcaagacatttttaaatatccccaagaagaacaacctcgc
cagcaaagaggaagaaagcagaggcgacagccctgtaccacatctgaaattttccatttt
tgttgggtgctttttatatacgcaaaaggaaacttccccatgatcagtgatgatctggtc
aattcctaccatcttctgctgtgtgcactagatttagtttatggaaatgccctacaatgc
tctaaccggaaagaacttgtgaaccctaattttaaaggcgtgtccgaggacggccacccc
agggactctcacccgtcctctgatccaccgtgtgtcattgagaagctctgctccttacac
gacggcctagtgctggaggcaaaggggataaagcagcatttctggaaaccctacattagg
aagctttttgaaaagaagctcctcagggggaaggaagaaaatctcactggcttcctggag
cccgggaacttcgcagagagctttaaggctgttaataaggcgtatgaagaatacgtgtta
gccactgggagtctggatgagcggatatttcttggcgaggatgcggaggaggaagttgga
actctctcacggtgtgtaagtgctgcctcgggcacagagagtgccgaacgaacgcagatg
agagacatcttgcagcagcatcttgacaagtctaaaacacttagagtctgcaacccactg
actggcgtgcggtatgttcaggagaacagcccttgtgtgactcccgtctccacagcaaca
cacagcctgaaccgtcttcacaccatgctggccggcctcaggaatgcacccagtgagaag
ctagaacagatactcaggtcatgttcccgagatccgactcgggctatcgctgacaggttg
agagagatgtatgaaatatattctcagcatttccagccagacgagaatgttagtaattgt
gctaaagaaatggccaacaaacactttcgttttgcagaaatgctttactataaagtatta
gagtctgttattgagcaagaacagaagagattgggagacatggacttatctggtgttctg
gagcaagatgcattccataagtcactcctggcctgctgccttgaggtggtcgctttttcc
tataagcctcctggaaatttcccatttattgctgaaatatttgatgtaccacattatcat
ttttataaggtaatagaagtatttattagagcagaagacggtctttgcagagaagtggtc
aaacacctcaatcagattgaagaacaaattttagaccacttggcatggaaaaccaagtcc
ccactgtgggatagaattagagataatgaaaacagagtccctacatgtgaagaggttaca
ccacctcacaacctagagagaacagatgaaatctatattgctggctctcccttaactccg
agaagggtgggtgaagttcgcactgatgctggaggacttggaagaagtgtgacatctcca
accacattgtatgacaggtacagttccccaacagtcagtactactagaaggcggctattt
gagagtgacagtccctctgaaggaagcacggctgggcgcatccccccacaacccctagtc
aatgctgtccctgtgcagaatgtatctggggagactgtttctgtcacaccagttcctgga
cagaccttggtcaccatggcaacagccactgtcacagccaacaatggacaaacagtgacc
attccagtacaaggtattgccaacgaaaatggagggataacattcttcccagtccaagtg
aatgttgggggccaggcacaggctgtgactggctctatccagcccctcagtgctcaagcg
ctggctggaagtctgagttcccaacaggtgacaggaacaactttgcaagtccccggtccg
gtggccattcaacaaatttcccctggaggacaacagcagaaccaaggccagccgttaacc
agcagcagtatcaggcctcggaagactagctccttatcacttttctttagaaaggtttac
tacttagctggtgtccgccttcgagacctttgcacaaaactagatatttcagatgaactg
aggaaaaaaatttggacctgctttgaattctctatagtccagtgtcctgaacttatgatg
gacagacatctggaccagttgttaatgtgtgccatttacgtgatggcaaaggtcacaaaa
gaagacaagtccttccagaatatcatgcgctgttacaggactcagccacaggcccggagc
caggtatacagaagtgtcttgataaaagggaaaagaagaaattctggcagctgtgagaac
agaagccatcagaattctccaacagaactaaatacagacagagccagtagagactccagt
ccagttatgaggtcaaacagcaccttaccagttccacagcccagcagtgcccctcctaca
ccaactcgactcacaggtgccaacagtgacattgaagaggaggaaagaggagacctcatt
cagttctacaacaacatctacaggaaacaaatccaaacgtttgccatgaagtactcacag
gcaaactcccaaatggacacccctcccctgtctccctatccgtttgtaagaacgggctcc
cctcgccgagtacagttatctcaaagtcaccctatctacatttccccacataaaaacgaa
gcaatgctttctcctcgagagaagattttttactacttcagcaacagcccatcaaagaga
ctgagagaaattaacagtatgatacggacaggagagactccaactaaaaagagagggatt
ctcttggacgatggaagtgaatcgcctgcaaaaagaatttgcccagaaaatcattctgct
ctgttacgtcgtctccaagatgtagctaatgaccgaggttcacactga

DBGET integrated database retrieval system