KEGG   Rattus norvegicus (rat): 79255
Entry
79255             CDS       T01003                                 

Gene name
Atf4
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04022  cGMP-PKG signaling pathway
rno04137  Mitophagy - animal
rno04141  Protein processing in endoplasmic reticulum
rno04151  PI3K-Akt signaling pathway
rno04210  Apoptosis
rno04211  Longevity regulating pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04668  TNF signaling pathway
rno04720  Long-term potentiation
rno04722  Neurotrophin signaling pathway
rno04725  Cholinergic synapse
rno04728  Dopaminergic synapse
rno04911  Insulin secretion
rno04912  GnRH signaling pathway
rno04915  Estrogen signaling pathway
rno04918  Thyroid hormone synthesis
rno04922  Glucagon signaling pathway
rno04925  Aldosterone synthesis and secretion
rno04926  Relaxin signaling pathway
rno04927  Cortisol synthesis and secretion
rno04928  Parathyroid hormone synthesis, secretion and action
rno04932  Non-alcoholic fatty liver disease
rno04934  Cushing syndrome
rno04935  Growth hormone synthesis, secretion and action
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05030  Cocaine addiction
rno05031  Amphetamine addiction
rno05034  Alcoholism
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05203  Viral carcinogenesis
rno05207  Chemical carcinogenesis - receptor activation
rno05215  Prostate cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    79255 (Atf4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    79255 (Atf4)
   04668 TNF signaling pathway
    79255 (Atf4)
   04022 cGMP-PKG signaling pathway
    79255 (Atf4)
   04151 PI3K-Akt signaling pathway
    79255 (Atf4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    79255 (Atf4)
  09143 Cell growth and death
   04210 Apoptosis
    79255 (Atf4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    79255 (Atf4)
   04922 Glucagon signaling pathway
    79255 (Atf4)
   04912 GnRH signaling pathway
    79255 (Atf4)
   04915 Estrogen signaling pathway
    79255 (Atf4)
   04926 Relaxin signaling pathway
    79255 (Atf4)
   04935 Growth hormone synthesis, secretion and action
    79255 (Atf4)
   04918 Thyroid hormone synthesis
    79255 (Atf4)
   04928 Parathyroid hormone synthesis, secretion and action
    79255 (Atf4)
   04925 Aldosterone synthesis and secretion
    79255 (Atf4)
   04927 Cortisol synthesis and secretion
    79255 (Atf4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    79255 (Atf4)
  09156 Nervous system
   04725 Cholinergic synapse
    79255 (Atf4)
   04728 Dopaminergic synapse
    79255 (Atf4)
   04720 Long-term potentiation
    79255 (Atf4)
   04722 Neurotrophin signaling pathway
    79255 (Atf4)
  09149 Aging
   04211 Longevity regulating pathway
    79255 (Atf4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    79255 (Atf4)
   05203 Viral carcinogenesis
    79255 (Atf4)
  09162 Cancer: specific types
   05215 Prostate cancer
    79255 (Atf4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    79255 (Atf4)
   05161 Hepatitis B
    79255 (Atf4)
   05163 Human cytomegalovirus infection
    79255 (Atf4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    79255 (Atf4)
   05012 Parkinson disease
    79255 (Atf4)
   05014 Amyotrophic lateral sclerosis
    79255 (Atf4)
   05020 Prion disease
    79255 (Atf4)
   05022 Pathways of neurodegeneration - multiple diseases
    79255 (Atf4)
  09165 Substance dependence
   05030 Cocaine addiction
    79255 (Atf4)
   05031 Amphetamine addiction
    79255 (Atf4)
   05034 Alcoholism
    79255 (Atf4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    79255 (Atf4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    79255 (Atf4)
   04934 Cushing syndrome
    79255 (Atf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    79255 (Atf4)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    79255 (Atf4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 Fez1 Laminin_II DUF3450 AAA_13
Other DBs
NCBI-GeneID: 79255
NCBI-ProteinID: NP_077379
RGD: 621863
Ensembl: ENSRNOG00000017801
Vega: OTTRNOG00000002100
UniProt: Q9ES19 B0BMW3
Position
7
AA seq 347 aa
MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAGSSEWL
AMDGLVSASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLATLDDTCDL
FAPLVQETNKEPPQTVNPIGHLPESVIKVDQAAPFTFLQPLPCSPGFLSSTPDHSFSLEL
GSEVDISEGDRKPDSAAYITLTPQCVKEEDTPSDSDSGICMSPESYLGSPQHSPSTSRAP
PDSLPSPGVPRGSRPKPYDPPGVSVTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQE
ALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaccgagatgagcttcctgaacagcgaagtgttggcgggggacttaatgtcccccttc
gaccagtcgggtttgggggctgaagaaagcctaggtctcttagatgactatctggaggtg
gccaagcacttcaaacctcatgggttctccagcgacaaggcgggctcctcagaatggctg
gctatggatgggttggtcagtgcctcagacaccggcaaggaggatgccttttccgggaca
gattggatgttggagaaaatggacctgaaagagtttgacttcgatgctctgtttcgaatg
gatgacctggaaaccatgccagatgagcttttggccacgttggatgacacatgtgatctt
tttgcccctctagtccaagagactaataaggagccccctcagacagtgaacccaattggc
catctcccagaaagtgtaataaaagtcgaccaggctgccccctttacattcttgcagcct
cttccctgttccccagggtttctgtcttccactccagatcattcctttagtttagagctg
ggaagtgaggttgatatctctgaaggagataggaagcctgactctgctgcttatattact
ctaacccctcagtgtgtaaaggaggaagacactccctctgatagtgacagtggcatctgt
atgagccctgagtcctacctgggctctccccaacacagcccttccacctccagggcccca
ccagacagtctgccttctccaggtgttcctcgtggttctcgacccaaaccttatgaccca
cctggagttagtgtgacagctaaagtgaagactgaaaagttggataagaagctgaaaaag
atggagcaaaacaagacagcagctactaggtaccgccagaagaagagggctgagcaggaa
gccctcactggcgagtgtaaagagctagaaaagaagaacgaggctctgaaagagaaggca
gattctctcgccaaagagattcagtatctaaaagacctgatagaagaggtccgtaaggca
agggggaagaagagagttccttaa

DBGET integrated database retrieval system