KEGG   Rattus norvegicus (rat): 81648
Entry
81648             CDS       T01003                                 

Symbol
Crh
Name
(RefSeq) corticoliberin precursor
  KO
K05256  corticotropin-releasing hormone
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04730  Long-term depression
rno04934  Cushing syndrome
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    81648 (Crh)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    81648 (Crh)
 09150 Organismal Systems
  09156 Nervous system
   04730 Long-term depression
    81648 (Crh)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    81648 (Crh)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81648 (Crh)
SSDB
Motif
Pfam: CRF
Other DBs
NCBI-GeneID: 81648
NCBI-ProteinID: NP_112281
RGD: 620505
Ensembl: ENSRNOG00000012703
UniProt: P01143
Position
2
AA seq 187 aa
MRLRLLVSAGMLLVALSPCLPCRALLSRGSVSGAPRAPQPLNFLQPEQPQQPQPILIRMG
EEYFLRLGNLNRSPAARLSPNSTPLTAGRGSRPSHDQAAANFFRVLLQQLQMPQRPLDSS
TELAERGAEDALGGHQGALERERRSEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRK
LMEIIGK
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcggctgcggctgctggtgtccgcgggcatgctgctggtggctctgtcgccctgtctg
ccttgcagggccctgctgagcaggggatccgtctctggagcgccgcgggccccgcagccg
ttgaatttcttgcaaccggagcagccccagcaacctcagccgattctgatccgcatgggt
gaagaatacttcctccgcctggggaacctcaacagaagtcccgctgctcggctgtccccc
aactccacgcccctcaccgcgggtcgcggcagccgcccctcgcacgaccaggctgcggct
aactttttccgcgtgttgctgcagcagctgcagatgcctcagcgcccgctcgacagcagc
acggagctggcggaacgcggcgccgaggatgccctcggtggccaccagggggcgctggag
agggagaggcggtccgaggagccgcccatctctctggatctcaccttccaccttctgagg
gaagtcttggaaatggccagggcagagcagttagctcagcaagctcacagcaacaggaaa
ctgatggagattatcgggaaatga

DBGET integrated database retrieval system