KEGG   Rattus norvegicus (rat): 81722
Entry
81722             CDS       T01003                                 

Gene name
Ager
Definition
(RefSeq) advanced glycosylation end product-specific receptor precursor
  KO
K19722  receptor for advanced glycosylation end products
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04613  Neutrophil extracellular trap formation
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05415  Diabetic cardiomyopathy
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    81722 (Ager)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81722 (Ager)
   05022 Pathways of neurodegeneration - multiple diseases
    81722 (Ager)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    81722 (Ager)
   05415 Diabetic cardiomyopathy
    81722 (Ager)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    81722 (Ager)
SSDB
Motif
Pfam: C2-set_2 Ig_3 Ig_2 ig I-set V-set C1-set Ig_5 Ig_4 SCF DUF6479
Other DBs
NCBI-GeneID: 81722
NCBI-ProteinID: NP_445788
RGD: 69258
Ensembl: ENSRNOG00000000439
Vega: OTTRNOG00000001708
UniProt: Q6MG86
Position
20
AA seq 402 aa
MPTGTVARAWVLVLALWGAVAGGQNITARIGEPLMLSCKGAPKKPTQKLEWKLNTGRTEA
WKVLSPQGDPWDSVARILPNGSLLLPAIGIVDEGTFRCRATNRLGKEVKSNYRVRVYQIP
GKPEIVNPASELTANVPNKVGTCVSEGSYPAGTLSWHLDGKPLIPDGKGTVVKEETRRHP
ETGLFTLRSELTVTPAQGGTTPTYSCSFSLGLPRHRPLNTAPIQPRVREPLPPEGIQLLV
EPEGGTVAPGGTVTLTCAISAQPPPQIHWIKDGTPLPLAPSPVLLLPEVGHEDEGIYSCV
ATHPSHGPQESPPVNIRVTETGDEGQAAGSVDGSGLGTLALALGILGGLGIAALLIGAIL
WRKRQPRLEERKAPESQEDEEERAELNQSEEAEMPENGAGGP
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgccaacggggacagtagctagagcctgggtactggttcttgctctgtggggagccgta
gctggtggtcagaacatcacagcccggatcggagagccacttatgctgagctgtaagggg
gcccctaagaagccaacccagaagctagaatggaaactgaacacaggaaggactgaagct
tggaaggtcctctctccccagggagacccctgggacagtgtggctcgaatcctccccaat
ggttcactcctccttccagctatcggaattgtcgatgaggggactttccggtgtcgggca
actaacaggcttgggaaggaggtcaagtccaactaccgagtccgagtctaccagattcct
gggaagccggaaattgtgaatcctgcctctgaactcacagccaatgtccctaataaggtg
gggacgtgtgtgtctgaggggagctaccctgcagggacccttagctggcacttggatggg
aaacctctgattcctgatggcaaagggacagttgtgaaggaggagaccaggaggcaccct
gagacgggactcttcacgcttcggtcagagctcacagtgaccccagcccaaggagggacc
actcctacctattcctgcagcttcagcctgggccttcctcggcacagacccctgaacaca
gcccccatccagccccgagtcagggagcccctgcctccagagggcattcagctgttggtt
gagcctgaaggtggaacagtcgctcctggtgggaccgtgaccctgacctgtgccatctct
gcccagcctccccctcaaatccactggataaaagatggcacacccctgccccttgccccc
agccctgtgctgctcctccctgaggtagggcatgaggatgagggcatctacagctgcgtg
gccacccaccctagccatggacctcaggaaagccctcctgtcaacatcagggtcacagaa
accggtgatgaaggacaagctgcaggctctgtggatgggtctgggctgggaacgctagcc
ctggccttagggatcctgggaggcctgggaatagccgctctgctcattggggccatcctg
tggcgaaaacgacaacccagactcgaggagaggaaggccccagaaagccaggaggacgag
gaggaacgtgcagagctgaatcagtcagaggaagcggaaatgccagagaatggtgcaggg
ggaccttaa

DBGET integrated database retrieval system