KEGG   Rattus norvegicus (rat): 81783
Entry
81783             CDS       T01003                                 

Symbol
Ssb
Name
(RefSeq) lupus La protein homolog
  KO
K11090  lupus La protein
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    81783 (Ssb)
SSDB
Motif
Pfam: RRM_3 La RRM_1
Other DBs
NCBI-GeneID: 81783
NCBI-ProteinID: NP_112381
RGD: 620804
Ensembl: ENSRNOG00000007998
UniProt: Q66HM7
Position
3
AA seq 415 aa
MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLETMIKFNRLNR
LTTDFNVIVQALSKSKANLMEVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGFPT
DATLDDIKEWLDDKGQILNIQMRRTLHKTFKGSIFAVFDSIQSAKKFVDTPGQKYKDTNL
LILFKEDYFAKKNEERKQSKVEAKLKAKQEHEGRHKPGSTETRALEGKMGCLLKFSGDLD
DQTCREDLHFLFSNHGEIKWIDFVRGAKEGIILFKEKAKDALEKARSANNGNLLLRNKKV
TWKVLEGHAEKDAMKKITDDQQESLNKWKSKGGHAARRFKGSHVFTAARRFKGRGKGNRP
AYAGAPKGRGQFQGRRTRFDDDDHRRGPVKRGRDGRDREEPASKHKKRENGARDK
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggctgaaaatggagataacgaaaaaatggctgctctggaggccaaaatctgtcatcaa
attgagtattattttggagacttcaatttgccacgagacaagtttttaaaagaacagatc
aaattggatgaaggctgggtacctttggaaacaatgataaaattcaacaggctaaaccga
ctgacaacagactttaatgtaatcgtgcaagcattgagcaaatctaaggcaaatctcatg
gaagtgagtgcagacaaaactaaaattagaagatcaccaagcagaccactccctgaagtg
acggatgagtataagaatgatgtgaaaaatagatctgtttatattaaaggcttcccaact
gatgccacccttgatgatataaaagaatggctagatgataaaggccaaatactgaatatt
cagatgagaagaacattgcacaaaacatttaaggggtcaatatttgctgtgtttgatagt
attcagtctgcaaagaagtttgtggacacccccggccagaagtacaaagacactaatctg
ctaatactcttcaaggaagattactttgcaaaaaaaaatgaagaaagaaagcagagcaaa
gtggaagctaaattaaaagctaaacaagaacatgaaggacgacacaaaccaggaagtact
gaaacaagagctctagaaggaaaaatgggatgcttactgaagttttcaggtgacttggat
gaccagacctgtagagaagatttacacttccttttctcaaatcatggtgaaataaaatgg
attgactttgtcagaggagcaaaagagggaataattctcttcaaagaaaaggctaaggac
gcacttgagaaagccagaagtgcaaataatggtaacctactgttaaggaacaaaaaagtg
acttggaaagtactagaaggacatgcagaaaaagatgcaatgaaaaaaatcacagatgat
caacaagaatctctgaacaaatggaagtcaaaaggaggtcatgcagcccgcagatttaaa
ggaagtcatgtttttacagcagctcgcagatttaaaggaagagggaaaggtaatagacct
gcttatgctggggcacccaaaggaagaggacagtttcaaggaaggaggacaagatttgat
gatgatgatcatcgtcgtggaccagtgaaaagaggaagagacggaagagacagagaagaa
cccgcatcaaagcataagaaaagagagaatggtgctagagacaagtag

DBGET integrated database retrieval system