KEGG   Rattus norvegicus (rat): 84389
Entry
84389             CDS       T01003                                 

Symbol
Ccnh
Name
(RefSeq) cyclin-H
  KO
K06634  cyclin H
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03022  Basal transcription factors
rno03420  Nucleotide excision repair
rno04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    84389 (Ccnh)
  09124 Replication and repair
   03420 Nucleotide excision repair
    84389 (Ccnh)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    84389 (Ccnh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:rno03021]
    84389 (Ccnh)
   03400 DNA repair and recombination proteins [BR:rno03400]
    84389 (Ccnh)
Transcription machinery [BR:rno03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     84389 (Ccnh)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     84389 (Ccnh)
SSDB
Motif
Pfam: Cyclin_C_2 Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 84389
NCBI-ProteinID: NP_443213
RGD: 69419
Ensembl: ENSRNOG00000031656
UniProt: Q9R1A0
Position
2
AA seq 323 aa
MYHNSSQKRHWTFASEEQLARLRADANRKFKCKAVANGKVLPNDPLFLEPHEEMTLCKYY
EKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNV
SSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDIKTRYPM
LENPEILRKTADDFLSRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKE
NRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAILKQKLERCHSSDLALNMVTKKRKGYEDD
DYVSKKPKQEEEEWTDDDLVDAL
NT seq 972 nt   +upstreamnt  +downstreamnt
atgtaccacaacagcagccagaagcggcactggaccttcgctagcgaggagcaactggcg
cgtctgcgggccgacgccaaccgcaaattcaagtgcaaagctgtggctaacgggaaggtt
cttccaaatgatccgttgtttcttgagcctcatgaagaaatgacactttgcaaatactat
gaaaaaagattgttggaattttgttcagtgtttaaaccagctatgccacggtctgttgtg
ggtacagcttgtatgtatttcaagcgtttttatcttaataactcagtaatggaatatcac
cctcggataataatgcttacttgtgcatttttggcctgcaaagtagatgaattcaatgtg
tctagtcctcagtttgttgggaaccttcgagagagtcctcttggacaggagaaggcactg
gaacagattttggaatatgaactactacttatacaacaacttaattttcacctcattgtc
cacaatccatatagaccatttgaaggcttcctcattgatataaagactcgataccccatg
ttggagaatccagagattttgaggaaaacggctgatgattttcttagtagaattgcattg
acagatgcttatcttttgtacacaccctcacaaattgccctgactgccattttatcaagt
gcctctagggctggaattactatggaaagctatttatcagagagtctaatgctgaaagaa
aacagaacttgcctgtcacagctactggatataatgaaaagcatgagaaatctagtaaaa
aagtatgagccacccagatctgaagaagttgctattctgaaacagaagttggagcgatgt
cattcttctgaccttgcacttaatatggttacaaagaagaggaaaggctacgaagacgat
gactatgtatcaaagaaacccaaacaggaagaggaggagtggacggacgatgacctggta
gatgctctctaa

DBGET integrated database retrieval system