KEGG   Rhodococcus opacus PD630: Pd630_LPD07471
Entry
Pd630_LPD07471    CDS       T03071                                 
Name
(GenBank) Carbon monoxide dehydrogenase large chain
  KO
K19187  6-hydroxypseudooxynicotine dehydrogenase subunit gamma [EC:1.5.99.14]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00760  Nicotinate and nicotinamide metabolism
roa01100  Metabolic pathways
roa01120  Microbial metabolism in diverse environments
Module
roa_M00810  Nicotine degradation, pyridine pathway, nicotine => 2,6-dihydroxypyridine/succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:roa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pd630_LPD07471
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.14  6-hydroxypseudooxynicotine dehydrogenase
     Pd630_LPD07471
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AHK34656
Position
complement(7754442..7756775)
AA seq 777 aa
MSTRNKSWIGESIRRREDERLLTGKALFAADIDLPRQLHLRIVRSTYAHARVLAVDVADA
KRHPGVRLVLTGDDLAHLGTIPLQDLGYHEDYPQIETFTQPPLATDRVLYVGQPVAAVLA
DDPYVAEDAAELVTVDYEVLPAVLDPVDALDTDVELFPGVGNEGVRIEKGYGDVDAAFQN
AAHIVSHEYRTGRHSGVPMETRNCVVQPDPGRDVLFVSGIVHVHDSQKVLARILGMPDTS
VRMRHSEIGGNFGVKGDIFPEYVVAAWAARHLGRPVKWVEDRSEHMVATSHAREQVHRLE
AALDADGRILGLRDEIFHNHGAYFRQAEPLVSDITSVIVVGPYRIPSYSVTLHAVLTNKT
PVAAYRGPGRYESTFARERLLDLASQTVGISAIEIRRRNLLTASDLPWNPGIEMVHEPYH
FVSGDPAEHLEKALTHIDWDSWVTETEQLRSDGKSVGIGVGVLMDKAGLGLYETGAVEVS
AVGRVRVLTGASSVGQGIETVLSQIAAEHLQINPERIDVVHSDTDLVPDGVGSWSSRSTV
LAGGAVREAALAVVAKAKRLASTMLDVPEERLRLVDGAIADSESEVSISLYEIAGRRDPY
TARLEDDEPGLAAHAVYRNNEMNYPYGVTIVQIEVDPATGGHTFRRFFTTTEAGRMINPM
TTRGQIIGAAVQGIGGALYEEFAYEEDGTPIATSFMDYLLPAAQEMPEVDIFVTEDAPSP
DNPLRAKGLGEVGIIAVGAAVAAALDNAIGDGLHTDRIPVTPQRIFERCRSRNKSAD
NT seq 2334 nt   +upstreamnt  +downstreamnt
gtgtcaactcgcaacaagagctggatcggtgaatccatccggcgccgcgaggacgagcgc
ctgctcaccggcaaggcgttgttcgcggctgacatcgatctcccacgccagctgcatcta
cgtatcgtgcggtcgacctacgcccatgcacgcgtcctcgctgtcgatgtggcggacgcg
aagcggcatccgggagtgcggctcgtgctcaccggcgacgatcttgcacatctcggcacg
atcccactccaagacctgggctaccacgaggactatccccaaatcgagaccttcacccag
cctccgctggcaacagatcgagtgctgtacgtgggccagccggtggccgccgtgctagcg
gacgatccctacgttgccgaagatgctgccgaactcgtcaccgttgactacgaggtactc
cccgctgtgctcgatccggtggacgccctcgataccgacgtcgaactcttcccgggggtc
ggtaacgagggtgttcggatcgaaaagggctacggcgacgtcgacgccgccttccagaac
gcggcacacatcgtctctcacgagtaccgcactggccggcactccggagtgccgatggaa
acccgcaactgcgtagtacaaccagaccctggccgtgacgtgctgttcgtatcgggaatc
gttcatgtgcacgactcccaaaaggttctcgcccggattctcggtatgcctgacaccagc
gtgcggatgcgacacagcgagatcggagggaacttcggggtcaaaggtgacattttcccg
gagtatgtcgtagcggcctgggcggcgcggcacctcggcagacctgtgaaatgggtcgag
gatcgatccgagcatatggtggcgacttctcacgcacgcgagcaagtccaccgcctcgag
gccgcactcgatgcggacggccgcatcctgggactgcgggacgagatcttccacaaccac
ggtgcgtatttccgccaagcggaaccgctggtcagcgatatcacctcggtcatcgtcgtc
ggaccgtatcggatcccttcgtactcggtgacgctgcacgcagtgctgacgaacaagacg
ccggtcgcggcgtatcgcggccctgggcggtatgaatcgacgttcgcgcgtgaacgccta
ctcgacctggcgtcgcagactgtaggaatcagcgccatcgagatccgtcgtcgcaacctt
ctcaccgcgtccgacttgccgtggaatcccggcatcgaaatggtgcacgagccataccac
ttcgtctccggtgaccccgccgagcacttggaaaaggcgctgacgcatatcgattgggat
tcctgggtgaccgagaccgagcagctacgcagcgacgggaagagcgtcggcatcggagtc
ggagtcctgatggacaaggccggcctcggactgtacgaaaccggtgccgtggaagtcagc
gcagtgggacgcgtccgcgtcctgaccggcgcatcgtcggtgggtcagggtatcgaaacc
gtgctctcacaaatcgccgccgaacacttgcagatcaatccggaacgaattgatgtcgta
cacagcgacaccgacctcgtaccggacggcgtcgggtcgtggtcgagccggtcgaccgtg
ctcgccggcggggcagtacgtgaagccgccctcgctgtcgtcgcgaaagccaaacgcctt
gcgagcacgatgctggacgtccctgaagaacggctccgactcgtcgatggtgccatcgcc
gattcggagtccgaagtctcgatcagtctctacgagatcgcgggtcgccgagacccgtac
acggcgcgtctggaggatgacgaacccggactcgccgctcacgcggtctatcgcaacaac
gagatgaactatccgtacggggtcaccatcgtccagatcgaggtcgatccggcgaccggc
ggacataccttccggcgattcttcaccaccaccgaggccggtcgaatgatcaacccgatg
acgacgcgcgggcagatcatcggcgccgccgtccaaggcatcggcggagcgctgtacgag
gagttcgcctacgaggaagacggaacgccgatcgcaacctcgttcatggactatctcctg
cccgccgctcaggagatgccggaggtcgacatcttcgtcaccgaggatgcgccttcgccg
gataacccgctgagagccaaaggattgggtgaggtcggcatcatcgcggtcggcgctgca
gttgcggcagcactcgacaacgcaatcggcgacgggctccacaccgatcggatcccggtg
accccgcagcggatcttcgaacgctgtcggtcgaggaacaaatctgccgactga

DBGET integrated database retrieval system