Roseovarius sp. THAF27: FIU89_20295 Help Entry FIU89_20295       CDS       T06352                                  Symbol trxA2 Name (GenBank) Thioredoxin   KO K03671   thioredoxin Organism roh  Roseovarius sp. THAF27 Brite KEGG Orthology (KO) [BR:roh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:roh03110]     FIU89_20295 (trxA2) Chaperones and folding catalysts [BR:roh03110]  Protein folding catalysts   Protein disulfide isomerase    FIU89_20295 (trxA2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 Redoxin AhpC-TSA Thioredoxin_9 Thioredoxin_3 Thioredoxin_7 TraF OST3_OST6 Glutaredoxin DSBA Glrx-like Motif Other DBs NCBI-ProteinID:  QFT82973 UniProt:  A0A5P9HAM0 Position 4070540..4070860 Genome browser AA seq 106 aa AA seqDB search MATVAVTDDTFDSEVKNSDIPVVVDFWAEWCGPCKQIGPALEELSSEMDGKVKIAKVNVD ENPNSPSQLGVRGIPALFIFKNGEVVSTKTGAAPKAALQGWIEESI NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggccaccgttgccgtaaccgacgacacgttcgatagcgaagtgaagaactccgacatt cccgtcgtggtggatttctgggccgaatggtgcggcccctgcaagcagatcggcccggcg ctggaagagctgtcctccgagatggatggcaaggtcaagatcgccaaggtgaacgtggac gagaaccccaactcgccgtcgcaactgggcgtgcggggcattccggcgctcttcatcttc aagaacggcgaggtcgtgtcgaccaagaccggcgccgcgcccaaggccgcgctgcaaggc tggatcgaagagtcgatctga

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (13) Pfam (13) All databases (15) Download RDF

DBGET integrated database retrieval system