KEGG   Rhodococcus opacus B4: ROP_27460
Entry
ROP_27460         CDS       T00882                                 
Symbol
kdhL
Name
(GenBank) putative ketone dehydrogenase large subunit
  KO
K19187  6-hydroxypseudooxynicotine dehydrogenase subunit gamma [EC:1.5.99.14]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00760  Nicotinate and nicotinamide metabolism
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
Module
rop_M00810  Nicotine degradation, pyridine pathway, nicotine => 2,6-dihydroxypyridine/succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ROP_27460 (kdhL)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.14  6-hydroxypseudooxynicotine dehydrogenase
     ROP_27460 (kdhL)
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: BAH50993
NITE: ROP_27460
UniProt: C1B567
Position
complement(2953272..2955632)
AA seq 786 aa
MMTNLTEPAVSTRNKSWIGESIRRREDERLLTGKALFAADIDLPHQLHLRIVRSTYAHAR
VLAVDVADAKRHPGVRLVLTGDDLAHLGTIPLQDLGYHEDYPQIETFTQPPLATDRVLYV
GQPVAAVLAEDPYVAEDAAELVTVDYEVLPAVLDPVEALATDIELYPGVGNEGVRIEKGY
GDVDAAFQKAAHIVSHEYRTGRHSGAPMETRNCVVQPDPGRDVLFVSGIVHVHDSQKVLA
RILGMPDTSVRMRHSEIGGNFGVKGDIFPEYVVAAWAARHLGRPVKWVEDRSEHMVATSH
AREQVHRLEAALDADGRILGLRDEIFHNHGAYFRQAEPLVSDITSVIVVGPYRIPSYSVT
LHAVLTNKTPVAAYRGPGRYESTFARERLLDLASQTVGISTIEIRRRNLLTASDLPWNPG
IEMVHEPYHFVSGDPAEHLEKALTHIDWDSWVTETEQLRSKGKSVGIGVGVLMDKAGLGL
YETGAVEVSAVGRVRVLTGASSVGQGIETVLSQIAAENLQIDPERIDVVHSDTDLVPDGV
GSWSSRSTVLAGGAVREAALAVVAKAKRLASTMLDVPEERLRLVEGAIADSESEASISLY
EIAGRRDPYTARLEDDEPGLAAHAVYRNNEMNYPYGVTIVQIEVDPATGGHTFRRFFTTT
EAGRMINPMTTRGQIIGAAVQGIGGALYEEFAYEEDGTPIATSFMDYLLPAAQEMPDVDI
FVTEDAPSPDNPLRAKGLGEVGIIAVGAAVAAALDDAIGDGLHTDRIPVTPQRIFERCRS
RNKTAD
NT seq 2361 nt   +upstreamnt  +downstreamnt
gtgatgacgaacctaactgagcccgcggtgtcaactcgcaacaagagctggatcggtgaa
tccatccggcgccgcgaggacgagcgcctgctcaccggcaaggcgctgttcgcagcggat
atcgatctcccacaccagctgcatctacgtatcgtgcggtcgacctacgcccacgcacgc
gtcctcgcggtcgatgtcgcggacgcgaagaggcatccgggagtgcggctcgtgctcacc
ggcgacgatctcgcgcatctcggcaccatcccactccaggacctgggctaccacgaggac
tatccccaaatcgagaccttcacccagcctcccctggcaacagatcgagtgctgtacgtg
ggccagccggtagccgcggtgctggcggaggatccctacgtcgccgaagacgctgccgaa
ctcgtcaccgtcgactacgaggttctccccgctgtgctcgacccggtggaggcgctcgcg
accgacatcgaactctatccgggggtagggaacgagggagttcggatcgagaaaggatac
ggtgatgtcgacgccgccttccagaaggcggcacacatcgtctctcatgagtaccgcacc
ggccggcactcgggggcgccgatggaaacccgcaactgtgtggtgcagcccgaccctggt
cgcgacgtgctgttcgtatcggggatcgtgcatgtgcacgactcccaaaaagttctcgcc
cggattctgggtatgcccgacaccagcgtgcggatgcggcacagcgagatcggcgggaac
ttcggtgtcaaaggtgacatcttcccggagtatgtcgtagcggcgtgggcggcgcggcac
ctcggaagacctgtgaaatgggtcgaggaccgatccgagcatatggtggcgacgtctcac
gcacgcgagcaagtccaccgcctcgaggccgcactcgatgcggacggccgcatcctggga
ctgcgggacgagatcttccacaaccacggtgcgtacttccgccaggccgaaccgctggtc
agtgatatcacctccgtcatcgtcgtcggaccgtatcggatcccctcgtactcggtgaca
ctgcacgcagtgctgacgaacaagacaccggtcgcggcgtatcgcggccccggacggtat
gaatcgacgttcgcgcgtgaacgcctactcgatctcgcgtcgcagaccgtgggaatcagc
accatcgagatccggcgtcgcaaccttctcaccgcgtccgacttaccgtggaatcccggc
atcgagatggtgcacgagccataccacttcgtctcgggtgaccccgccgagcatttggag
aaggcgctgacgcatatcgattgggattcctgggtgaccgagaccgagcaacttcgcagt
aaggggaagagcgtcggcatcggagtcggagtcctgatggacaaggccggcctcggactg
tacgaaaccggtgccgtggaagtcagcgcagtgggacgcgttcgcgtcctgaccggcgcg
tcgtcggtgggtcagggtatcgaaaccgtgctctctcaaatcgccgccgaaaacttgcag
atcgatccggaacgaattgacgtcgtacacagcgacaccgacctggtgccggacggcgtc
gggtcctggtcgagccggtcgaccgtgctcgccggcggcgcagtgcgtgaagccgccctc
gctgtcgtcgcgaaagccaaacgcctcgcgagcacgatgctcgacgtccctgaagaacgg
ctccggctcgtcgagggtgccatcgccgattcggagtccgaggcatcgatcagtctctac
gagatcgcgggccgacgagacccgtatacggcgcgtctcgaggatgacgaacccgggctc
gccgcccacgcggtctatcgcaacaacgagatgaactatccgtacggggtcaccatcgtc
cagatcgaggtcgatccggcgaccggcggtcatactttccggcgattcttcaccaccacc
gaggccggtcgaatgatcaacccgatgacgacgcgcgggcagatcatcggcgccgccgtc
caaggcatcggtggagcgctgtacgaggagttcgcgtacgaggaagacggaacgcctatc
gcgacctcgttcatggattatctcctgcccgccgctcaggagatgccggacgtcgacatt
ttcgtcaccgaggacgcgccttcgcccgataaccccctgcgagccaaaggattgggcgag
gtcggcatcatcgcggtcggcgcggcagttgcggcagcactcgatgacgcaatcggcgac
gggctccacaccgatcggatcccggtgaccccgcagcggatcttcgaacgctgtcggtcg
aggaacaaaactgccgactga

DBGET integrated database retrieval system