KEGG   Rhodococcus opacus B4: ROP_27520
Entry
ROP_27520         CDS       T00882                                 
Symbol
kdhB
Name
(GenBank) putative ketone dehydrogenase small subunit
  KO
K19186  6-hydroxypseudooxynicotine dehydrogenase subunit beta [EC:1.5.99.14]
Organism
rop  Rhodococcus opacus B4
Pathway
rop00760  Nicotinate and nicotinamide metabolism
rop01100  Metabolic pathways
rop01120  Microbial metabolism in diverse environments
Module
rop_M00810  Nicotine degradation, pyridine pathway, nicotine => 2,6-dihydroxypyridine/succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:rop00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ROP_27520 (kdhB)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.14  6-hydroxypseudooxynicotine dehydrogenase
     ROP_27520 (kdhB)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3 Fer2_4
Other DBs
NCBI-ProteinID: BAH50999
NITE: ROP_27520
UniProt: C1B573
Position
2960806..2961315
AA seq 169 aa
MSTHRVTVEVNGETHTREVDARLLLSDFLRHHLGLRGTRVGCEHGVCGSCTVLLSGEPVR
ACLTLAVQTDGEVVDTVEGLGENTEHMHPLQESFSACHGLQCGFCTSGFLMSLKPLYDSG
IEMNATEIREAISGNICRCTGYQQIVEAVDRALHTRDSTDTETSESNDG
NT seq 510 nt   +upstreamnt  +downstreamnt
gtgagcacacaccgcgtcactgtcgaagtcaatggtgagacacacacccgcgaagtcgat
gcgcgacttctgttgtccgatttcctgcgtcaccacctcgggctccgtggcacgcgcgtg
gggtgtgagcacggcgtctgcggttcgtgtacggtactgctttccggtgagcctgttcgt
gcctgcctgactctcgcggtgcagaccgacggcgaggtcgtcgacacggtcgaggggctg
ggcgagaacaccgaacacatgcatcccctgcaggagtcgttttcggcgtgccacggactg
cagtgcgggttctgcacctcggggttcctgatgtcactcaaaccgctctacgacagcgga
atcgagatgaacgcgacggagatccgcgaggcgatctccggcaacatctgccggtgcacg
ggctaccagcagatcgtcgaagccgtcgaccgcgccttgcacactcgagactcgaccgac
accgagacatccgagtccaacgacgggtag

DBGET integrated database retrieval system