KEGG   Ralstonia pickettii DTP0602: N234_22415
Entry
N234_22415        CDS       T03172                                 

Name
(GenBank) 2,4,6-trichlorophenol monooxygenase
  KO
K24293  3,5,6-trichloropyridin-2-ol/2,4,6-trichlorophenol monooxygenase [EC:1.14.14.172 1.14.14.173]
Organism
rpj  Ralstonia pickettii DTP0602
Pathway
rpj00361  Chlorocyclohexane and chlorobenzene degradation
rpj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rpj00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    N234_22415
Enzymes [BR:rpj01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.172  3,5,6-trichloropyridin-2-ol monooxygenase
     N234_22415
    1.14.14.173  2,4,6-trichlorophenol monooxygenase
     N234_22415
SSDB
Motif
Pfam: HpaB_N HpaB Acyl-CoA_dh_M TMEM33_Pom33
Other DBs
NCBI-GeneID: 17104385
NCBI-ProteinID: AGW92781
Structure
PDB: 
6JHM

Position
2:312653..314206
AA seq 517 aa
MIRTGTQYLESLNDGRNVWVGNEKIDNVATHPKTRDYAQRHADFYDLHHRPDLQDVMTYI
DEGGQRRAMQWFGHRDKEQLRRKRKYHETVMREMAGASFPRTPDVNNYVLTTYIDDPAPW
ETQSIGDDGHIKAGKIVDFIRYAREHDLNCAPQFVDPQMDRSNPDAQERSPGLRVVEKNE
KGIVVNGVKAIGTGVAFADWIHIGVFFRPGIPGDQVIFAATPVNTPGVTIVCRESLVKDD
KVEHPLAAQGDELDGMTVFENVFIPWSHVFHIGNPNHAKLYPQRVFDWLHYHALIRQMVR
AELVAGLAVLITEHIGTNKIPAVQTRVAKLIGFHQAMLAHLIASEELGFHTPGGHYKPNI
LIYDFGRALYLENFSQMIYELVDLSGRSALIFASEDQWNDDKLNGWFERMNNGPVGRPHD
RVKIGRVIRDLFLTDWGSRLFVFENFNGTPLQGIRMLTMQRAEFSGSGPYGKLARQVCGI
DSAVTDDTEYRKTADYAKALDAARHQEEVALAGAMAI
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgattcgtaccggcacgcagtacctggaatccctgaacgacggccgcaatgtctgggtc
ggcaacgagaagatcgacaacgttgccacccaccccaagacacgcgactacgcgcagcgc
cacgccgacttctacgacctgcaccatcgcccggacctgcaggacgtgatgacctatatc
gacgagggtggccagcgccgggccatgcagtggttcggccaccgcgacaaggagcagctg
cgccgcaagcgcaagtaccacgagactgtcatgcgcgagatggcgggcgcgtcgttcccc
cgcacgccggacgtcaacaactatgtgctgaccacctacatcgacgaccccgcgccgtgg
gaaacgcagtcgatcggcgacgacgggcatatcaaggccggcaagatcgtcgacttcatc
cgctacgcccgggagcatgacctgaactgcgccccgcagttcgtggacccgcagatggac
cgttccaacccggacgcgcaggagcgctcgcccggcctgcgcgtggtggaaaagaacgaa
aagggcatcgtggtgaacggcgtgaaggccatcggcaccggcgtggcctttgccgactgg
atccacatcggcgtgttcttccgccccggtattcccggcgaccaggtcatctttgccgcg
acaccggtcaacacgccgggcgtcaccatcgtctgccgcgagagcctggtcaaggatgac
aaggtcgagcacccgcttgccgcgcagggcgacgaactcgacggcatgaccgtattcgag
aacgtcttcatcccgtggtcgcacgtcttccatatcggcaatcccaaccatgccaagctg
tacccgcagcgcgtgttcgactggctgcactaccacgcgctgatccggcagatggtgcgg
gccgagctggtggccggcctggcggtgctgatcaccgagcatatcggcaccaacaagatc
ccggcggtgcagacccgtgtggccaagctgatcggtttccaccaggccatgctggcacac
ctgatcgccagcgaggaactgggcttccatacgcccggcggccactacaagcccaacatc
ctgatctacgacttcggccgtgcgctctacctcgagaatttctcgcagatgatctacgag
ctggtggacctgtccggccgcagtgcgctgatctttgccagcgaggaccagtggaacgac
gacaagctcaatggctggttcgagcgcatgaacaacggcccggtgggccgcccgcatgac
cgcgtgaagatcggccgcgtgatccgcgacctgttcctcaccgactggggcagccgcctg
ttcgtgttcgagaacttcaacggcacgccgctgcagggcatccgcatgctgaccatgcag
cgcgccgagttctcgggctccgggccgtacggcaagctggcgcggcaggtgtgcggcatc
gattcggcggtgaccgacgacaccgaataccgcaagaccgccgactacgccaaggcgctc
gacgccgcacggcaccaggaagaagtcgcgctggcgggcgccatggcgatttga

DBGET integrated database retrieval system