KEGG   Rhinopithecus roxellana (golden snub-nosed monkey): 104673585
Entry
104673585         CDS       T03989                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome P450 3A8
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
rro  Rhinopithecus roxellana (golden snub-nosed monkey)
Pathway
rro00140  Steroid hormone biosynthesis
rro00591  Linoleic acid metabolism
rro00830  Retinol metabolism
rro00980  Metabolism of xenobiotics by cytochrome P450
rro00982  Drug metabolism - cytochrome P450
rro00983  Drug metabolism - other enzymes
rro01100  Metabolic pathways
rro04976  Bile secretion
rro05204  Chemical carcinogenesis - DNA adducts
rro05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:rro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    104673585
   00591 Linoleic acid metabolism
    104673585
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    104673585
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104673585
   00982 Drug metabolism - cytochrome P450
    104673585
   00983 Drug metabolism - other enzymes
    104673585
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    104673585
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    104673585
   05207 Chemical carcinogenesis - receptor activation
    104673585
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:rro00199]
    104673585
Enzymes [BR:rro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     104673585
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     104673585
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     104673585
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     104673585
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     104673585
    1.14.14.-  
     104673585
Cytochrome P450 [BR:rro00199]
 Cytochrome P450, animal type
  CYP3 family
   104673585
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 104673585
NCBI-ProteinID: XP_010375972
UniProt: A0A2K6P9D2
Position
6
AA seq 503 aa
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGTILSYRKGFWKF
DMECYKKYGKVWGFYDGRLPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKNAISV
AEDEQWKRMRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRRETETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFLTPILEVLNISV
FPREVTSFLRKSVKRIKESRLKDTQKRRVDFLQLMIDSQNSKDTESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTMLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGIFIPKGVVVMIPSYALHHDPKYWPEPEKFLPERFS
KKNKDNIDPYIYTPFGNGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRIG
GLLQTEKPIVLKIESRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttgggaactattttgtcctaccgtaagggcttttggaagttt
gatatggaatgttataaaaagtatggaaaagtgtggggcttttatgatggtcgactgcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaaatgccatctctgta
gctgaggatgaacaatggaagagaatgcgatcgttgctgtctccaaccttcaccagtgga
aaactcaaagagatggtccctatcattgccaagtatggagatgtgttggtgagaaatctg
aggcgtgaaacagagacaggcaagcctgtcaccttgaaagatgtctttggggcctacagc
atggacgtgatcactagcacatcatttggagtgaacatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagacccattcttt
ctctcaataactatcttcccatttctcaccccaattcttgaagtattaaatatctctgtt
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagatacacaaaagcgccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagacactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatgtatgaa
ctggccactcaccctgatgtccaacagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactatgctacagatggagtatctcgacatggtggtg
aatgaaacgctcagattattcccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatattcatacctaaaggggtggtggtgatgattccaagctatgct
cttcaccatgacccaaagtactggccagagcctgagaagttcctccctgaaaggttcagc
aagaagaacaaggacaacatagatccttacatatacacaccatttggaaatggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatcccgctgaaattacgcatagga
ggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system