GenomeNet

Database: RefSeq
Entry: NC_001355
LinkDB: NC_001355
Original site: NC_001355 
LOCUS       NC_001355               7902 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Human papillomavirus type 6b, complete genome.
ACCESSION   NC_001355 NC_001838
VERSION     NC_001355.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; E1 gene; E2 gene; E4 gene; E5a gene; E5b gene; E6 gene; E7
            gene; L1 gene; L2 gene; major capsid protein L1; minor capsid
            protein L2; regulatory protein E2; replication protein E1.
SOURCE      Human papillomavirus type 6b
  ORGANISM  Human papillomavirus type 6b
            Viruses; Monodnaviria; Shotokuvirae; Cossaviricota;
            Papovaviricetes; Zurhausenvirales; Papillomaviridae;
            Firstpapillomavirinae; Alphapapillomavirus.
REFERENCE   1
  AUTHORS   Schwarz,E., Durst,M., Demankowski,C., Lattermann,O., Zech,R.,
            Wolfsperger,E., Suhai,S. and zur Hausen,H.
  TITLE     DNA sequence and genome organization of genital human
            papillomavirus type 6b
  JOURNAL   EMBO J. 2 (12), 2341-2348 (1983)
   PUBMED   6321162
REFERENCE   2  (bases 1 to 7902)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from X00203.
            On Aug 14, 2013 this sequence version replaced NC_001838.1.
            There are two types of open reading frames:
            putative early open reading frames (E) and
            putative late open reading frames (L);
            open reading frames L1 and L2 are expected to code for the viral
            structural polypeptides.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7902
                     /organism="Human papillomavirus type 6b"
                     /mol_type="genomic DNA"
                     /strain="type 6b (HPV6b)"
                     /db_xref="taxon:10600"
     gene            64..554
                     /gene="E6"
                     /locus_tag="HPV6bgp1"
                     /db_xref="GeneID:1489368"
     regulatory      64..67
                     /regulatory_class="TATA_box"
                     /gene="E6"
                     /locus_tag="HPV6bgp1"
     CDS             102..554
                     /gene="E6"
                     /locus_tag="HPV6bgp1"
                     /note="E6 protein; E6 proteins are small zinc-binding
                     proteins that share a conserved zinc-binding CXXC motif;
                     they act as adapter proteins that alter specific cellular
                     pathways"
                     /codon_start=1
                     /product="E6 protein"
                     /protein_id="NP_040296.1"
                     /db_xref="GOA:P06462"
                     /db_xref="InterPro:IPR001334"
                     /db_xref="UniProtKB/Swiss-Prot:P06462"
                     /db_xref="GeneID:1489368"
                     /translation="MESANASTSATTIDQLCKTFNLSMHTLQINCVFCKNALTTAEIY
                     SYAYKHLKVLFRGGYPYAACACCLEFHGKINQYRHFDYAGYATTVEEETKQDILDVLI
                     RCYLCHKPLCEVEKVKHILTKARFIKLNCTWKGRCLHCWTTCMEDMLP"
     misc_feature    102..551
                     /gene="E6"
                     /locus_tag="HPV6bgp1"
                     /note="E6 protein; Provisional; Region: PHA02779"
                     /db_xref="CDD:222929"
     gene            530..826
                     /gene="E7"
                     /locus_tag="HPV6bgp2"
                     /db_xref="GeneID:1489369"
     CDS             530..826
                     /gene="E7"
                     /locus_tag="HPV6bgp2"
                     /note="E7 protein; involved in regulation of
                     transcription"
                     /codon_start=1
                     /product="E7 protein"
                     /protein_id="NP_040297.1"
                     /db_xref="GOA:P06464"
                     /db_xref="InterPro:IPR000148"
                     /db_xref="UniProtKB/Swiss-Prot:P06464"
                     /db_xref="GeneID:1489369"
                     /translation="MHGRHVTLKDIVLDLQPPDPVGLHCYEQLVDSSEDEVDEVDGQD
                     SQPLKQHFQIVTCCCGCDSNVRLVVQCTETDIREVQQLLLGTLNIVCPICAPKT"
     misc_feature    530..823
                     /gene="E7"
                     /locus_tag="HPV6bgp2"
                     /note="E7 protein; Provisional; Region: PHA02776"
                     /db_xref="CDD:165141"
     gene            832..2781
                     /gene="E1"
                     /locus_tag="HPV6bgp3"
                     /db_xref="GeneID:1489363"
     CDS             832..2781
                     /gene="E1"
                     /locus_tag="HPV6bgp3"
                     /note="E1; The Papillomaviriuses are icosahedral dsDNA
                     viruses that encode 7 early proteins, E1 to E7, and 2 late
                     structural proteins L1 and L2. Host infection by members
                     of the papillomaviruses gives rise to warts and cancer in
                     some instances. The E1 helicase protein is an
                     ATP-dependent DNA helicase that facilitates the
                     inititiation of viral DNA replication through its
                     interactions with the viral E2 protein. The E1-E2 complex
                     binds to the viral origin of replication where E1 acts to
                     unwind the DNA and E2 acts as a transcriptional
                     activator."
                     /codon_start=1
                     /product="E1"
                     /protein_id="NP_040298.1"
                     /db_xref="GOA:P03113"
                     /db_xref="InterPro:IPR001177"
                     /db_xref="UniProtKB/Swiss-Prot:P03113"
                     /db_xref="UniProtKB/Swiss-Prot:P06459"
                     /db_xref="GeneID:1489363"
                     /translation="MADDSGTENEGSGCTGWFMVEAIVQHPTGTQISDDEDEEVEDSG
                     YDMVDFIDDSNITHNSLEAQALFNRQEADTHYATVQDLKRKYLGSPYVSPINTIAEAV
                     ESEISPRLDAIKLTRQPKKVKRRLFQTRELTDSGYGYSEVEAGTGTQVEKHGVPENGG
                     DGQEKDTGRDIEGEEHTEAEAPTNSVREHAGTAGILELLKCKDLRAALLGKFKECFGL
                     SFIDLIRPFKSDKTTCLDWVVAGFGIHHSISEAFQKLIEPLSLYAHIQWLTNAWGMVL
                     LVLLRFKVNKSRSTVARTLATLLNIPENQMLIEPPKIQSGVAALYWFRTGISNASTVI
                     GEAPEWITRQTVIEHGLADSQFKLTEMVQWAYDNDICEESEIAFEYAQRGDFDSNARA
                     FLNSNMQAKYVKDCATMCRHYKHAEMRKMSIKQWIKHRGSKIEGTGNWKPIVQFLRHQ
                     NIEFIPFLTKFKLWLHGTPKKNCIAIVGPPDTGKSYFCMSLISFLGGTVISHVNSSSH
                     FWLQPLVDAKVALLDDATQPCWIYMDTYMRNLLDGNPMSIDRKHKALTLIKCPPLLVT
                     SNIDITKEDKYKYLHTRVTTFTFPNPFPFDRNGNAVYELSNTNWKCFFERLSSSLDIQ
                     DSEDEEDGSNSQAFRCVPGTVVRTL"
     misc_feature    832..2778
                     /gene="E1"
                     /locus_tag="HPV6bgp3"
                     /note="E1; Provisional; Region: PHA02774"
                     /db_xref="CDD:222927"
     gene            2723..3829
                     /gene="E2"
                     /locus_tag="HPV6bgp4"
                     /db_xref="GeneID:1489364"
     CDS             2723..3829
                     /gene="E2"
                     /locus_tag="HPV6bgp4"
                     /codon_start=1
                     /product="regulatory protein E2"
                     /protein_id="NP_040299.1"
                     /db_xref="GOA:P03119"
                     /db_xref="InterPro:IPR000427"
                     /db_xref="InterPro:IPR001866"
                     /db_xref="InterPro:IPR009021"
                     /db_xref="UniProtKB/Swiss-Prot:P03119"
                     /db_xref="GeneID:1489364"
                     /translation="MEAIAKRLDACQEQLLELYEENSTDLHKHVLHWKCMRHESVLLY
                     KAKQMGLSHIGMQVVPPLKVSEAKGHNAIEMQMHLESLLRTEYSMEPWTLQETSYEMW
                     QTPPKRCFKKRGKTVEVKFDGCANNTMDYVVWTDVYVQDNDTWVKVHSMVDAKGIYYT
                     CGQFKTYYVNFVKEAEKYGSTKHWEVCYGSTVICSPASVSSTTQEVSIPESTTYTPAQ
                     TSTLVSSSTKEDAVQTPPRKRARGVQQSPCNALCVAHIGPVDSGNHNLITNNHDQHQR
                     RNNSNSSATPIVQFQGESNCLKCFRYRLNDRHRHLFDLISSTWHWASSKAPHKHAIVT
                     VTYDSEEQRQQFLDVVKIPPTISHKLGFMSLHLL"
     misc_feature    2723..3301
                     /gene="E2"
                     /locus_tag="HPV6bgp4"
                     /note="E2 (early) protein, N terminal; Region: PPV_E2_N;
                     pfam00508"
                     /db_xref="CDD:278909"
     misc_feature    3578..3811
                     /gene="E2"
                     /locus_tag="HPV6bgp4"
                     /note="E2 (early) protein, C terminal; Region: PPV_E2_C;
                     pfam00511"
                     /db_xref="CDD:395411"
     gene            3255..3584
                     /gene="E4"
                     /locus_tag="HPV6bgp5"
                     /db_xref="GeneID:1489365"
     CDS             3255..3584
                     /gene="E4"
                     /locus_tag="HPV6bgp5"
                     /codon_start=1
                     /product="E4 protein"
                     /protein_id="NP_040300.1"
                     /db_xref="UniProtKB/Swiss-Prot:P06459"
                     /db_xref="GeneID:1489365"
                     /translation="MGAPNIGKYVMAAQLYVLLHLYLALHKKYPFLNLLHTPPHRPPP
                     LCPQAPRKTQCKRRLGNEHEESNSPLATPCVWPTLDPWTVETTTSSLTITTSTKDGTT
                     VTVQLRL"
     misc_feature    3255..3581
                     /gene="E4"
                     /locus_tag="HPV6bgp5"
                     /note="E4 protein; Provisional; Region: PHA03417"
                     /db_xref="CDD:177645"
     gene            3887..4162
                     /gene="E5a"
                     /locus_tag="HPV6bgp6"
                     /db_xref="GeneID:1489366"
     CDS             3887..4162
                     /gene="E5a"
                     /locus_tag="HPV6bgp6"
                     /codon_start=1
                     /product="E5a protein"
                     /protein_id="NP_040301.1"
                     /db_xref="InterPro:IPR008736"
                     /db_xref="UniProtKB/Swiss-Prot:P06460"
                     /db_xref="GeneID:1489366"
                     /translation="MEVVPVQIAAGTTSTFILPVIIAFVVCFVSIILIVWISEFIVYT
                     SVLVLTLLLYLLLWLLLTTPLQFFLLTLLVCYCPALYIHYYIVTTQQ"
     misc_feature    3887..4159
                     /gene="E5a"
                     /locus_tag="HPV6bgp6"
                     /note="Papillomavirus E5A protein; Region: Papilloma_E5A;
                     pfam05776"
                     /db_xref="CDD:147756"
     gene            4159..4377
                     /gene="E5b"
                     /locus_tag="HPV6bgp7"
                     /db_xref="GeneID:1489367"
     CDS             4159..4377
                     /gene="E5b"
                     /locus_tag="HPV6bgp7"
                     /codon_start=1
                     /product="E5b protein"
                     /protein_id="NP_040302.1"
                     /db_xref="UniProtKB/Swiss-Prot:P06461"
                     /db_xref="GeneID:1489367"
                     /translation="MMLTCQFNDGDTWLGLWLLCAFIVGMLGLLLMHYRAVQGDKHTK
                     CKKCNKHNCNDDYVTMHYTTDGDYIYMN"
     misc_feature    4159..4374
                     /gene="E5b"
                     /locus_tag="HPV6bgp7"
                     /note="Family of unknown function (DUF5472); Region:
                     DUF5472; pfam17566"
                     /db_xref="CDD:340281"
     gene            4423..5802
                     /gene="L2"
                     /locus_tag="HPV6bgp8"
                     /db_xref="GeneID:1489371"
     CDS             4423..5802
                     /gene="L2"
                     /locus_tag="HPV6bgp8"
                     /codon_start=1
                     /product="minor capsid protein L2"
                     /protein_id="NP_040303.1"
                     /db_xref="GOA:P03106"
                     /db_xref="InterPro:IPR000784"
                     /db_xref="UniProtKB/Swiss-Prot:P03106"
                     /db_xref="GeneID:1489371"
                     /translation="MAHSRARRRKRASATQLYQTCKLTGTCPPDVIPKVEHNTIADQI
                     LKWGSLGVFFGGLGIGTGSGTGGRTGYVPLQTSAKPSITSGPMARPPVVVEPVAPSDP
                     SIVSLIEESAIINAGAPEIVPPAHGGFTITSSETTTPAILDVSVTSHTTTSIFRNPVF
                     TEPSVTQPQPPVEANGHILISAPTVTSHPIEEIPLDTFVVSSSDSGPTSSTPVPGTAP
                     RPRVGLYSRALHQVQVTDPAFLSTPQRLITYDNPVYEGEDVSVQFSHDSIHNAPDEAF
                     MDIIRLHRPAIASRRGLVRYSRIGQRGSMHTRSGKHIGARIHYFYDISPIAQAAEEIE
                     MHPLVAAQDDTFDIYAESFEPGINPTQHPVTNISDTYLTSTPNTVTQPWGNTTVPLSL
                     PNDLFLQSGPDITFPTAPMGTPFSPVTPALPTGPVFITGSGFYLHPAWYFARKRRKRI
                     PLFFSDVAA"
     misc_feature    4465..5769
                     /gene="L2"
                     /locus_tag="HPV6bgp8"
                     /note="Late Protein L2; Region: Late_protein_L2; cl28153"
                     /db_xref="CDD:332973"
     regulatory      4554..4559
                     /regulatory_class="polyA_signal_sequence"
                     /gene="L2"
                     /locus_tag="HPV6bgp8"
     gene            5789..7291
                     /gene="L1"
                     /locus_tag="HPV6bgp9"
                     /db_xref="GeneID:1489370"
     CDS             5789..7291
                     /gene="L1"
                     /locus_tag="HPV6bgp9"
                     /note="major capsid L1 protein; Two structural proteins
                     are involved in papillomavirus capsid formation, a major
                     (L1) and a minor (L2) protein; L1 forms the pentameric
                     assembly unit of the viral shell while L2 mediates several
                     facets of viral entry including endosomal escape after
                     uncoating"
                     /codon_start=1
                     /product="major capsid L1 protein"
                     /protein_id="NP_040304.1"
                     /db_xref="GOA:P69899"
                     /db_xref="InterPro:IPR002210"
                     /db_xref="InterPro:IPR008975"
                     /db_xref="UniProtKB/Swiss-Prot:P69899"
                     /db_xref="GeneID:1489370"
                     /translation="MWRPSDSTVYVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAV
                     GHPYFSIKRANKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGL
                     EVGRGQPLGVGVSGHPFLNKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPP
                     LGEHWGKGKQCTNTPVQAGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPI
                     DICGTTCKYPDYLQMAADPYGDRLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGS
                     GNRTSVGSSIYVNTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTR
                     STNMTLCASVTTSSTYTNSDYKEYMRHVEEYDLQFIFQLCSITLSAEVMAYIHTMNPS
                     VLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKF
                     SSELDQYPLGRKFLLQSGYRGRSSIRTGVKRPAVSKASAAPKRKRAKTKR"
     misc_feature    5789..7282
                     /gene="L1"
                     /locus_tag="HPV6bgp9"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02778"
                     /db_xref="CDD:222928"
     repeat_region   7292..7315
                     /rpt_type=TANDEM
     repeat_region   7316..7339
                     /rpt_type=TANDEM
     regulatory      7407..7412
                     /regulatory_class="polyA_signal_sequence"
     repeat_region   7681..7705
                     /rpt_type=INVERTED
ORIGIN      
        1 gttaataaca atcttggttt aaaaaatagg agggaccgaa aacggttcaa ccgaaaacgg
       61 ttgtatataa accagcccta aaatttagca aacgaggcat tatggaaagt gcaaatgcct
      121 ccacgtctgc aacgaccata gaccagttgt gcaagacgtt taatctatct atgcatacgt
      181 tgcaaattaa ttgtgtgttt tgcaagaatg cactgaccac agcagagatt tattcatatg
      241 catataaaca cctaaaggtc ctgtttcgag gcggctatcc atatgcagcc tgcgcgtgct
      301 gcctagaatt tcatggaaaa ataaaccaat atagacactt tgattatgct ggatatgcaa
      361 caacagttga agaagaaact aaacaagaca tcttagacgt gctaattcgg tgctacctgt
      421 gtcacaaacc gctgtgtgaa gtagaaaagg taaaacatat actaaccaag gcgcggttca
      481 taaagctaaa ttgtacgtgg aagggtcgct gcctacactg ctggacaaca tgcatggaag
      541 acatgttacc ctaaaggata ttgtattaga cctgcaacct ccagaccctg tagggttaca
      601 ttgctatgag caattagtag acagctcaga agatgaggtg gacgaagtgg acggacaaga
      661 ttcacaacct ttaaaacaac atttccaaat agtgacctgt tgctgtggat gtgacagcaa
      721 cgttcgactg gttgtgcagt gtacagaaac agacatcaga gaagtgcaac agcttctgtt
      781 gggaacacta aacatagtgt gtcccatctg cgcaccgaag acctaacaac gatggcggac
      841 gattcaggta cagaaaatga ggggtctggg tgtacaggat ggtttatggt agaagctata
      901 gtgcaacacc caacaggtac acaaatatca gacgatgagg atgaggaggt ggaggacagt
      961 gggtatgaca tggtggactt tattgatgac agcaatatta cacacaattc actggaagca
     1021 caggcattgt ttaacaggca ggaggcggac acccattatg cgactgtgca ggacctaaaa
     1081 cgaaagtatt taggtagtcc atatgttagt cctataaaca ctatagccga ggcagtggaa
     1141 agtgaaataa gtccacgatt ggacgccatt aaacttacaa gacagccaaa aaaggtaaag
     1201 cgacggctgt ttcaaaccag ggaactaacg gacagtggat atggctattc tgaagtggaa
     1261 gctggaacgg gaacgcaggt agagaaacat ggcgtaccgg aaaatggggg agatggtcag
     1321 gaaaaggaca caggaaggga catagagggg gaggaacata cagaggcgga agcgcccaca
     1381 aacagtgtac gggagcatgc aggcacagca ggaatattgg aattgttaaa atgtaaagat
     1441 ttacgggcag cattacttgg taagtttaaa gaatgctttg ggctgtcttt tatagattta
     1501 attaggccat ttaaaagtga taaaacaaca tgtttagatt gggtggtagc agggtttggt
     1561 atacatcata gcatatcaga ggcatttcaa aaattaattg agccattaag tttatatgca
     1621 catatacaat ggctaacaaa tgcatgggga atggtattgt tagtattatt aagatttaaa
     1681 gtaaataaaa gtagaagtac cgttgcacgt acacttgcaa cgctattaaa tatacctgaa
     1741 aaccaaatgt taatagagcc accaaaaata caaagtggtg ttgcagccct gtattggttt
     1801 cgtacaggta tatcaaatgc cagtacagtt ataggggaag caccagaatg gataacacgc
     1861 caaacagtta ttgaacacgg gttggcagac agtcagttta aattaacaga aatggtgcag
     1921 tgggcgtatg ataatgacat atgcgaggag agtgaaattg catttgaata tgcacaaagg
     1981 ggagattttg attctaatgc acgagcattt ttaaatagca atatgcaggc aaaatatgtg
     2041 aaagattgtg caactatgtg tagacattat aaacatgcag aaatgaggaa gatgtctata
     2101 aaacaatgga taaaacatag gggttctaaa atagaaggca caggaaattg gaaaccaatt
     2161 gtacaattcc tacgacatca aaatatagaa ttcattcctt ttttaactaa atttaaatta
     2221 tggctgcacg gtacgccaaa aaaaaactgc atagccatag taggccctcc agatactggg
     2281 aaatcgtact tttgtatgag tttaataagc tttctaggag gtacagttat tagtcatgta
     2341 aattccagca gccatttttg gttgcaaccg ttagtagatg ctaaggtagc attgttagat
     2401 gatgcaacac agccatgttg gatatatatg gatacatata tgagaaattt gttagatggt
     2461 aatcctatga gtattgacag aaagcataaa gcattgacat taattaaatg tccacctctg
     2521 ctagtaacgt ccaacataga tattactaaa gaagataaat ataagtattt acatactaga
     2581 gtaacaacat ttacatttcc aaatccattc ccttttgaca gaaatgggaa tgcagtgtat
     2641 gaactgtcaa atacaaactg gaaatgtttt tttgaaagac tgtcgtcaag cctagacatt
     2701 caggattctg aggacgagga agatggaagc aatagccaag cgtttagatg cgtgccagga
     2761 acagttgtta gaactttatg aagaaaacag tactgaccta cacaaacatg tattgcattg
     2821 gaaatgcatg agacatgaaa gtgtattatt atataaagca aaacaaatgg gcctaagcca
     2881 cataggaatg caagtagtgc caccattaaa ggtgtccgaa gcaaaaggac ataatgccat
     2941 tgaaatgcaa atgcatttag aatcattatt aaggactgag tatagtatgg aaccgtggac
     3001 attacaagaa acaagttatg aaatgtggca aacaccacct aaacgctgtt ttaaaaaacg
     3061 gggcaaaact gtagaagtta aatttgatgg ctgtgcaaac aatacaatgg attatgtggt
     3121 atggacagat gtgtatgtgc aggacaatga cacctgggta aaggtgcata gtatggtaga
     3181 tgctaagggt atatattaca catgtggaca atttaaaaca tattatgtaa actttgtaaa
     3241 agaggcagaa aagtatggga gcaccaaaca ttgggaagta tgttatggca gcacagttat
     3301 atgttctcct gcatctgtat ctagcactac acaagaagta tccattcctg aatctactac
     3361 atacaccccc gcacagacct ccacccttgt gtcctcaagc accaaggaag acgcagtgca
     3421 aacgccgcct aggaaacgag cacgaggagt ccaacagtcc ccttgcaacg ccttgtgtgt
     3481 ggcccacatt ggacccgtgg acagtggaaa ccacaacctc atcactaaca atcacgacca
     3541 gcaccaaaga cggaacaaca gtaacagttc agctacgcct atagtgcaat ttcaaggtga
     3601 atccaattgt ttaaagtgtt ttagatatag gctaaatgac agacacagac atttatttga
     3661 tttaatatca tcaacgtggc actgggcctc ctcaaaggca ccacataaac atgccattgt
     3721 aactgtaaca tatgatagtg aggaacaaag gcaacagttt ttagatgttg taaaaatacc
     3781 ccctaccatt agccacaaac tgggatttat gtcactgcac ctattgtaat ttgtatatat
     3841 gtaaatgtgt aaatatatgg tattggtgta atacaactgt acatgtatgg aagtggtgcc
     3901 tgtacaaata gctgcaggaa caaccagcac attcatactg cctgttataa ttgcatttgt
     3961 tgtatgtttt gttagcatca tacttattgt atggatatct gagtttattg tgtacacatc
     4021 tgtgctagta ctaacactgc ttttatattt actattgtgg ctgctattaa caaccccctt
     4081 gcaatttttc ctactaactc tacttgtgtg ttactgtccc gcattgtata tacactacta
     4141 tattgttacc acacagcaat gatgctaaca tgtcaattta atgatggaga tacctggctg
     4201 ggtttgtggt tgttatgtgc ctttattgta gggatgttgg ggttattatt gatgcactat
     4261 agagctgtac aaggggataa acacaccaaa tgtaagaagt gtaacaaaca caactgtaat
     4321 gatgattatg taactatgca ttatactact gatggtgatt atatatatat gaattagagt
     4381 aaaccgtttt ttatatttgt aacagtgtat gctttgtata ccatggcaca tagtagggcc
     4441 cgacgacgca agcgtgcgtc agctacacag ctatatcaaa catgtaaact cactggaaca
     4501 tgccccccag atgtaattcc taaggtggag cacaacacca ttgcagatca aatattaaaa
     4561 tggggaagtt tgggggtgtt ttttggaggg ttgggtatag gcacgggttc cggcactggg
     4621 ggtcgtactg gctatgttcc cttacaaact tctgcaaaac cttctattac tagtgggcct
     4681 atggctcgtc ctcctgtggt ggtggagcct gtggcccctt cggatccatc tattgtgtct
     4741 ttaattgaag aatcggcaat cattaacgca ggggcgcctg aaattgtgcc ccctgcacac
     4801 ggtgggttta caattacatc ctctgaaaca actacccctg caatattgga tgtatcagtt
     4861 actagtcaca ctactactag tatatttaga aatcctgtct ttacagaacc ttctgtaaca
     4921 caaccccaac cacccgtgga ggctaatgga catatattaa tttctgcacc cactgtaacg
     4981 tcacacccta tagaggaaat tcctttagat acttttgtgg tatcatctag tgatagcggt
     5041 cctacatcca gtacccctgt tcctggtact gcacctcggc ctcgtgtggg cctatatagt
     5101 cgtgcattgc accaggtgca ggttacagac cctgcatttc tttccactcc tcaacgctta
     5161 attacatatg ataaccctgt atatgaaggg gaggatgtta gtgtacaatt tagtcatgat
     5221 tctatacaca atgcacctga tgaggctttt atggacataa ttcgtttgca cagacctgcc
     5281 attgcgtccc gacgtggcct tgtgcggtac agtcgcattg gacaacgggg gtctatgcac
     5341 actcgcagcg gaaagcacat aggggcccgc attcattatt tttatgatat ttcacctatt
     5401 gcacaggctg cagaagaaat agaaatgcac cctcttgtgg ctgcacagga tgatacattt
     5461 gatatttatg ctgaatcttt tgaacctggc attaacccta cccaacaccc tgttacaaat
     5521 atatcagata catatttaac ttccacacct aatacagtta cacaaccgtg gggtaacacc
     5581 acagttccat tgtcacttcc taatgacctg tttttacaat ctggccctga tataactttt
     5641 cctactgcac ctatgggaac accctttagt cctgtaactc ctgctttacc tacaggccct
     5701 gttttcatta caggttctgg attttatttg catcctgcat ggtattttgc acgtaaacgc
     5761 cgtaaacgta ttcccttatt tttttcagat gtggcggcct agcgacagca cagtatatgt
     5821 gcctcctcct aaccctgtat ccaaagttgt tgccacggat gcttatgtta ctcgcaccaa
     5881 catattttat catgccagca gttctagact tcttgcagtg ggacatcctt atttttccat
     5941 aaaacgggct aacaaaactg ttgtgccaaa ggtgtcagga tatcaataca gggtatttaa
     6001 ggtggtgtta ccagatccta acaaatttgc attgcctgac tcgtctcttt tcgatcccac
     6061 aacacaacgt ttagtatggg catgcacagg cctagaggtg ggcaggggac agccattagg
     6121 tgtgggtgta agtggacatc ctttcctaaa taaatatgat gatgttgaaa attcagggag
     6181 tggtggtaac cctggacagg ataacagggt taatgtaggt atggattata aacaaacaca
     6241 attatgcatg gttggatgtg cccccccttt gggcgagcat tggggtaaag gtaaacagtg
     6301 tactaataca cctgtacagg ctggtgactg cccgccctta gaacttatta ccagtgttat
     6361 acaggatggc gatatggttg acacaggctt tggtgctatg aattttgctg atttgcagac
     6421 caataaatca gatgttccta ttgacatatg tggcactaca tgtaaatatc cagattattt
     6481 acaaatggct gcagacccat atggtgatag attatttttt tttctacgga aggaacaaat
     6541 gtttgccaga cattttttta acagggctgg cgaggtgggg gaacctgtgc ctgatacact
     6601 tataattaag ggtagtggaa atcgcacgtc tgtagggagt agtatatatg ttaacacccc
     6661 gagcggctct ttggtgtcct ctgaggcaca attgtttaat aagccatatt ggctacaaaa
     6721 agcccaggga cataacaatg gtatttgttg gggtaatcaa ctgtttgtta ctgtggtaga
     6781 taccacacgc agtaccaaca tgacattatg tgcatccgta actacatctt ccacatacac
     6841 caattctgat tataaagagt acatgcgtca tgtggaagag tatgatttac aatttatttt
     6901 tcaattatgt agcattacat tgtctgctga agtaatggcc tatattcaca caatgaatcc
     6961 ctctgttttg gaagactgga actttgggtt atcgcctccc ccaaatggta cattagaaga
     7021 tacctatagg tatgtgcagt cacaggccat tacctgtcaa aagcccactc ctgaaaagga
     7081 aaagccagat ccctataaga accttagttt ttgggaggtt aatttaaaag aaaagttttc
     7141 tagtgaattg gatcagtatc ctttgggacg caagtttttg ttacaaagtg gatatagggg
     7201 acggtcctct attcgtacag gtgttaagcg ccctgctgtt tccaaagcct ctgctgcccc
     7261 taaacgtaag cgcgccaaaa ctaaaaggta atatatgtgt atatgtactg ttatatatat
     7321 gtgtgtatgt actgttatgt atatgtgtgt gtgtgttctg tgtgtaatgt aagttatttg
     7381 tgtaatgtgt atgtgtgttt atgtgcaata aacaattacc tcttgttaca ccctgtgact
     7441 cagtggctgt tgcacgcgtt ttggtttgca cgcgccttac acacataagt aatatacatg
     7501 cacaatatat atatttttgt ttaaaatact atacttttat atttgcaacc gttttcggtt
     7561 gcccttagca tacactttcc accaatttgt tacaacgtgt ttcctcttaa tcctatatat
     7621 tttgtgccag gtacacattg ccctgccaag ttgcttgcca agtgcatcat atcctgccaa
     7681 ccacacacct ggcgccaggg tgcggtattg ccttactcat aaacctgtct ttgtgttata
     7741 cttttatgca ctgtagccaa ctcttaaaag catttttggc ttgtagcagc acattttttt
     7801 gctcttactg tttggtatac aataacataa aaatgagtaa cctaaggtca cacacctgcg
     7861 accggtttcg gttatccaca ccctacatat ttccttctta ta
//
DBGET integrated database retrieval system