GenomeNet

Database: RefSeq
Entry: NC_001356
LinkDB: NC_001356
Original site: NC_001356 
LOCUS       NC_001356               7815 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Human papillomavirus - 1, complete genome.
ACCESSION   NC_001356
VERSION     NC_001356.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; E6 gene; E7 gene; E8 gene; L1 gene; L2 gene; major capsid
            protein L1; minor capsid protein L2.
SOURCE      Mupapillomavirus 1
  ORGANISM  Mupapillomavirus 1
            Viruses; Monodnaviria; Shotokuvirae; Cossaviricota;
            Papovaviricetes; Zurhausenvirales; Papillomaviridae;
            Firstpapillomavirinae; Mupapillomavirus.
REFERENCE   1  (bases 1 to 7815)
  AUTHORS   Danos,O., Katinka,M. and Yaniv,M.
  TITLE     Human papillomavirus 1a complete DNA sequence: a novel type of
            genome organization among papovaviridae
  JOURNAL   EMBO J. 1 (2), 231-236 (1982)
   PUBMED   6325156
REFERENCE   2  (bases 1 to 7815)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7815)
  AUTHORS   Danos,O.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-JAN-1985) Danos O.
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from V01116.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7815
                     /organism="Mupapillomavirus 1"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:334203"
                     /type="1a"
     gene            104..526
                     /gene="E6"
                     /locus_tag="HpV1agp1"
                     /db_xref="GeneID:1489169"
     CDS             104..526
                     /gene="E6"
                     /locus_tag="HpV1agp1"
                     /codon_start=1
                     /product="E6 protein"
                     /protein_id="NP_040305.1"
                     /db_xref="UniProtKB/Swiss-Prot:P06929"
                     /db_xref="GeneID:1489169"
                     /translation="MATPIRTVRQLSESLCIPYIDVLLPCNFCNYFLSNAEKLLFDHF
                     DLHLVWRDNLVFGCCQGCARTVSLLEFVLYYQESYEVPEIEEILDRPLLQIELRCVTC
                     IKKLSVAEKLEVVSNGERVHRVRNRLKAKCSLCRLYAI"
     misc_feature    179..502
                     /gene="E6"
                     /locus_tag="HpV1agp1"
                     /note="Early Protein (E6); Region: E6; pfam00518"
                     /db_xref="CDD:306907"
     gene            165..356
                     /gene="E8"
                     /locus_tag="HpV1agp2"
                     /db_xref="GeneID:1489170"
     CDS             165..356
                     /gene="E8"
                     /locus_tag="HpV1agp2"
                     /codon_start=1
                     /product="E8 protein"
                     /protein_id="NP_040306.1"
                     /db_xref="UniProtKB/TrEMBL:Q84215"
                     /db_xref="GeneID:1489170"
                     /translation="MFYCLVIFVIIFCLMLRSCFLIILICILSGETIWCLDAVKGVLE
                     LLAYWSLFYIIRSLMRYRK"
     gene            529..810
                     /gene="E7"
                     /locus_tag="HpV1agp3"
                     /db_xref="GeneID:1489171"
     CDS             529..810
                     /gene="E7"
                     /locus_tag="HpV1agp3"
                     /codon_start=1
                     /product="E7 protein"
                     /protein_id="NP_040307.1"
                     /db_xref="UniProtKB/Swiss-Prot:P06465"
                     /db_xref="GeneID:1489171"
                     /translation="MVGEMPALKDLVLQLEPSVLDLDLYCYEEVPPDDIEEELVSPQQ
                     PYAVVASCAYCEKLVRLTVLADHSAIRQLEELLLRSLNIVCPLCTLQRQ"
     misc_feature    535..792
                     /gene="E7"
                     /locus_tag="HpV1agp3"
                     /note="E7 protein, Early protein; Region: E7; pfam00527"
                     /db_xref="CDD:278928"
     gene            812..2650
                     /locus_tag="HpV1agp4"
                     /db_xref="GeneID:1724533"
     CDS             812..2650
                     /locus_tag="HpV1agp4"
                     /note="Predicted by GeneMark; E1; The Papillomaviriuses
                     are icosahedral dsDNA viruses that encode 7 early
                     proteins, E1 to E7, and 2 late structural proteins L1 and
                     L2. Host infection by members of the papillomaviruses
                     gives rise to warts and cancer in some instances. The E1
                     helicase protein is an ATP-dependent DNA helicase that
                     facilitates the inititiation of viral DNA replication
                     through its interactions with the viral E2 protein. The
                     E1-E2 complex binds to the viral origin of replication
                     where E1 acts to unwind the DNA and E2 acts as a
                     transcriptional activator"
                     /codon_start=1
                     /product="E1"
                     /protein_id="NP_597739.1"
                     /db_xref="GeneID:1724533"
                     /translation="MADNKGTENDWFLVEATDCEETLEETSLGDLDNVSCVSDLSDLL
                     DEAPQSQGNSLELFHKQESLESEQELNALKRKLLYSPQARSADETDIASISPRLETIS
                     ITKQDKKRYRRQLFSQDDSGLELSLLQDETENIDESTQVDQQQKEHTGEVGAAGVNIL
                     KASNIRAALLSRFKDTAGVSFTDLTRSYKSNKTCCGDWVLAVWGVRENLIDSVKELLQ
                     THCVYIQLEHAVTEKNRFLFLLVRFKAQKSRETVIKLITTILPVDASYILSEPPKSRS
                     VAAALFWYKRSMSSTVFTWGTTLEWIAQQTLINHQLDSESPFELCKMVQWAYDNGHTE
                     ECKIAYYYAVLADEDENARAFLSSNSQAKYVKDCAQMVRHYLRAEMAQMSMSEWIFRK
                     LDNVEGSGNWKEIVRFLRFQEVEFISFMIAFKDLLCGKPKKNCLLIFGPPNTGKSMFC
                     TSLLKLLGGKVISYCNSKSQFWLQPLADAKIGLLDDATKPCWDYMDIYMRNALDGNTI
                     CIDLKHRAPQQIKCPPLLITSNIDVKSDTCWMYLHSRISAFKFAHEFPFKDNGDPGFS
                     LTDENWKSFFERFWQQLELSDQEDEGNDGKPQQSLRLTARAANEPI"
     misc_feature    812..2647
                     /locus_tag="HpV1agp4"
                     /note="E1; Provisional; Region: PHA02774"
                     /db_xref="CDD:222927"
     misc_feature    812..1192
                     /locus_tag="HpV1agp4"
                     /note="E1 Protein, N terminal domain; Region: PPV_E1_N;
                     pfam00524"
                     /db_xref="CDD:278925"
     misc_feature    1325..2620
                     /locus_tag="HpV1agp4"
                     /note="Papillomavirus helicase; Region: PPV_E1_C;
                     pfam00519"
                     /db_xref="CDD:278920"
     gene            2637..3797
                     /locus_tag="HpV1agp5"
                     /db_xref="GeneID:1724532"
     CDS             2637..3797
                     /locus_tag="HpV1agp5"
                     /note="Predicted by GeneMark"
                     /codon_start=1
                     /product="regulatory protein E2"
                     /protein_id="NP_597740.1"
                     /db_xref="GeneID:1724532"
                     /translation="MNLYEQDSKLIEDQIKQWNLIRQEQVLFHFARKNGVMRIGLQAV
                     PSLASSQEKAKTAIEMVLHLESLKDSPYGTEDWSLQDTSRELFLAPPAGTFKKSGSTL
                     EVTYDNNPDNQTRHTIWNHVYYQNGDDVWRKVSSGVDAVGVYYLEHDGYKNYYVLFAE
                     EASKYSTTGQYAVNYRGKRFTNVMSSTSSPRAAGAPAVHSDYPTLSESDTAQQSTSID
                     YTELPGQGETSQVRQRQQKTPVRRRPYGRRRSRSPRGGGRREGESTPSRTPGSVPSAR
                     DVGSIHTTPQKGHSSRLRRLLQEAWDPPVVCVKGGANQLKCLRYRLKASTQVDFDSIS
                     TTWHWTDRKNTERIGSARMLVKFIDEAQREKFLERVALPRSVSVFLGQFNGS"
     misc_feature    2637..3182
                     /locus_tag="HpV1agp5"
                     /note="E2 (early) protein, N terminal; Region: PPV_E2_N;
                     pfam00508"
                     /db_xref="CDD:278909"
     misc_feature    3546..3785
                     /locus_tag="HpV1agp5"
                     /note="E2 (early) protein, C terminal; Region: PPV_E2_C;
                     pfam00511"
                     /db_xref="CDD:278912"
     gene            3897..5420
                     /gene="L2"
                     /locus_tag="HpV1agp6"
                     /db_xref="GeneID:1489172"
     CDS             3897..5420
                     /gene="L2"
                     /locus_tag="HpV1agp6"
                     /codon_start=1
                     /product="minor capsid protein L2"
                     /protein_id="NP_040308.1"
                     /db_xref="UniProtKB/Swiss-Prot:P03105"
                     /db_xref="GeneID:1489172"
                     /translation="MYRLRRKRAAPKDIYPSCKISNTCPPDIQNKIEHTTIADKILQY
                     GSLGVFLGGLGIGTARGSGGRIGYTPLGEGGGVRVATRPTPVRPTIPVETVGPSEIFP
                     IDVVDPTGPAVIPLQDLGRDFPIPTVQVIAEIHPISDIPNIVASSTNEGESAILDVLR
                     GNATIRTVSRTQYNNPSFTVASTSNISAGEASTSDIVFVSNGSGDRVVGEDIPLVELN
                     LGLETDTSSVVQETAFSSSTPIAERPSFRPSRFYNRRLYEQVQVQDPRFVEQPQSMVT
                     FDNPAFEPELDEVSIIFQRDLDALAQTPVPEFRDVVYLSKPTFSREPGGRLRVSRLGK
                     SSTIRTRLGTAIGARTHFFYDLSSIAPEDSIELLPLGEHSQTTVISSNLGDTAFIQGE
                     TAEDDLEVISLETPQLYSEEELLDTNESVGENLQLTITNSEGEVSILDLTQSRVRPPF
                     GTEDTSLHVYYPNSSKGTPIINPEESFTPLVIIALNNSTGDFELHPSLRKRRKRAYV"
     misc_feature    3903..5408
                     /gene="L2"
                     /locus_tag="HpV1agp6"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02777"
                     /db_xref="CDD:165142"
     misc_feature    3909..5408
                     /gene="L2"
                     /locus_tag="HpV1agp6"
                     /note="Late Protein L2; Region: Late_protein_L2;
                     pfam00513"
                     /db_xref="CDD:278914"
     gene            5413..6939
                     /gene="L1"
                     /locus_tag="HpV1agp7"
                     /db_xref="GeneID:1489173"
     CDS             5413..6939
                     /gene="L1"
                     /locus_tag="HpV1agp7"
                     /note="major capsid L1 protein; Two structural proteins
                     are involved in papillomavirus capsid formation, a major
                     (L1) and a minor (L2) protein; L1 forms the pentameric
                     assembly unit of the viral shell while L2 mediates several
                     facets of viral entry including endosomal escape after
                     uncoating"
                     /codon_start=1
                     /product="major capsid L1 protein"
                     /protein_id="NP_040309.1"
                     /db_xref="UniProtKB/Swiss-Prot:P03099"
                     /db_xref="GeneID:1489173"
                     /translation="MYNVFQMAVWLPAQNKFYLPPQPITRILSTDEYVTRTNLFYHAT
                     SERLLLVGHPLFEISSNQTVTIPKVSPNAFRVFRVRFADPNRFAFGDKAIFNPETERL
                     VWGLRGIEIGRGQPLGIGITGHPLLNKLDDAENPTNYINTHANGDSRQNTAFDAKQTQ
                     MFLVGCTPASGEHWTSSRCPGEQVKLGDCPRVQMIESVIEDGDMMDIGFGAMDFAALQ
                     QDKSDVPLDVVQATCKYPDYIRMNHEAYGNSMFFFARREQMYTRHFFTRGGSVGDKEA
                     VPQSLYLTADAEPRTTLATTNYVGTPSGSMVSSDVQLFNRSYWLQRCQGQNNGICWRN
                     QLFITVGDNTRGTSLSISMKNNASTTYSNANFNDFLRHTEEFDLSFIVQLCKVKLTPE
                     NLAYIHTMDPNILEDWQLSVSQPPTNPLEDQYRFLGSSLAAKCPEQAPPEPQTDPYSQ
                     YKFWEVDLTERMSEQLDQFPLGRKFLYQSGMTQRTATSSTTKRKTVRVSTSAKRRRKA
                     "
     misc_feature    5431..6933
                     /gene="L1"
                     /locus_tag="HpV1agp7"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02778"
                     /db_xref="CDD:222928"
ORIGIN      
        1 gttaactacc atcattcatt attctagtta caacaagaac ctaggagtta tatgccagaa
       61 gtaagcctat aaaatacaca ggtaagactc tgcacaggac cagatggcga caccaatccg
      121 gaccgtcaga cagctttccg aaagcctctg tatcccatat attgatgttt tattgccttg
      181 taatttttgt aattattttt tgtctaatgc tgagaagctg ctttttgatc attttgattt
      241 gcatcttgtc tggagagaca atttggtgtt tggatgctgt caagggtgtg ctagaactgt
      301 tagcctattg gagtttgttt tatattatca ggagtcttat gaggtaccgg aaatagaaga
      361 aattttggac agacctttat tgcaaattga actccgttgt gttacatgca taaaaaaact
      421 gagtgttgct gaaaaattgg aggttgtgtc aaacggagaa agagtgcata gagttagaaa
      481 cagacttaaa gcaaagtgta gtttgtgtcg cttgtatgct atataacaat ggtgggcgaa
      541 atgccagcac taaaggacct ggttcttcaa cttgaaccaa gcgtcctaga tttagatctt
      601 tattgttacg aggaggtgcc tcctgatgac atagaggagg agttagtgtc gcctcagcaa
      661 ccttatgctg tcgttgcttc ctgtgcctat tgcgagaaac tggttcgatt gaccgtcctc
      721 gcggatcaca gcgccattag acagctggag gaactccttc tgcgatcttt gaacatcgtg
      781 tgcccactgt gcaccctaca gcgacagtaa aatggcagat aataaaggta ctgaaaacga
      841 ttggtttttg gtggaggcga cagattgtga ggaaacgtta gaggaaacct cacttggtga
      901 cctagataat gtttcttgtg ttagcgactt atctgattta ttagacgagg cgccgcaaag
      961 ccaggggaat tccctggaat tgttccacaa gcaagaatcg ctggaaagcg aacaggaact
     1021 taatgcttta aaacgaaagt tactttacag tcctcaggcg agaagcgcgg acgaaacaga
     1081 cattgctagc attagtccta gattagaaac tatttctatt acaaagcaag acaaaaaaag
     1141 gtatcgaagg caactgtttt ctcaggatga tagtggttta gagctatcgc tgcttcagga
     1201 tgaaactgaa aatattgatg aatcgacaca ggtagatcaa cagcagaaag aacatactgg
     1261 ggaagttggg gccgctgggg tgaacatttt gaaagctagt aatatccgcg ccgcattatt
     1321 aagcagattt aaagatacgg ctggcgtcag ttttacagac ctgacgcggt cgtacaagag
     1381 caacaaaacc tgttgtggag attgggtttt ggcagtttgg ggtgtccgtg aaaatttaat
     1441 tgacagtgta aaagaattat tgcaaaccca ttgtgtgtat attcaattgg aacatgcagt
     1501 aactgaaaaa aatagatttt tatttttatt ggtacgattt aaagcccaga aaagtagaga
     1561 gactgtgata aaacttataa ccacaattct tccagttgat gctagctata ttttgtctga
     1621 gcctccaaaa tcaagaagtg tggctgctgc attattttgg tataaaagat ctatgtcttc
     1681 aactgttttt acatggggta caactttgga gtggattgca cagcaaaccc ttattaatca
     1741 tcagttagat tccgaaagtc cctttgagct ttgtaaaatg gttcagtggg cctatgataa
     1801 tggacataca gaagagtgta aaattgcata ttattatgct gttttagcag atgaggatga
     1861 aaatgcaagg gcatttctaa gctctaattc acaggcaaaa tatgtgaaag actgtgcaca
     1921 aatggtaaga cactatttac gtgctgagat ggcacaaatg tctatgtcag agtggatttt
     1981 tagaaaacta gataatgtag aaggttctgg taattggaaa gaaattgtaa gatttttaag
     2041 atttcaagaa gttgaattta taagctttat gattgcattt aaagatttgt tatgtggtaa
     2101 gccaaagaaa aactgtttgt taatatttgg acctccaaat acaggaaaat caatgttttg
     2161 tacaagttta ttaaagttgt taggagggaa agtgatttca tactgtaaca gtaaaagtca
     2221 gttttggttg cagcctctgg ctgatgctaa gatagggcta ttagatgatg caacaaagcc
     2281 atgttgggat tatatggaca tttatatgag aaatgcattg gatggtaaca ctatttgtat
     2341 tgatttaaaa catagagctc ctcaacaaat taaatgccca cctttactta ttactagtaa
     2401 tattgatgtt aaatcagata cctgttggat gtatttgcat agtagaatat cagcttttaa
     2461 atttgctcat gagtttccat ttaaagacaa tggtgatcca ggattttcct taacagacga
     2521 aaattggaaa tctttctttg aaaggttttg gcaacagtta gaattaagtg accaagaaga
     2581 cgagggaaac gatggaaaac ctcagcagtc gcttagactt actgcaagag cagctaatga
     2641 acctatatga acaggacagt aaattgatag aagatcaaat taagcagtgg aatctaatta
     2701 gacaagaaca agttcttttc catttcgcca gaaaaaatgg ggtaatgaga attggattgc
     2761 aggcagttcc atctttagcg tcctcacagg agaaggcaaa gacagctatt gaaatggtgt
     2821 tacatttaga gtctttaaag gactcacctt atggcacaga ggattggtca cttcaagaca
     2881 ctagcagaga gctgtttttg gcacccccag ctggcacctt caagaagagt ggcagcacac
     2941 ttgaggttac ctatgacaat aaccctgata atcagacaag gcacacaatt tggaatcatg
     3001 tgtattatca aaatggggac gatgtatgga gaaaagtatc cagtggtgtt gatgctgtag
     3061 gagtgtacta tttagaacac gatggctata aaaattatta tgtgttattt gctgaggagg
     3121 cctctaagta cagcacaaca ggacaatatg ctgtaaatta caggggtaaa aggtttacaa
     3181 atgttatgtc ttccactagc tccccaaggg ctgctggggc tcctgcagta cactccgact
     3241 acccaaccct atccgagagt gacaccgccc agcaatcgac gtccatcgac tacaccgaac
     3301 tcccaggaca gggggagacc tcgcaggtcc gacaaagaca gcagaaaaca cctgtacgca
     3361 gacggcctta cggacggcga agatccagaa gtcccagagg tggaggacga agagaaggag
     3421 aatcaacgcc ctctaggaca cccggatctg tcccttctgc gcgagacgtt ggaagtatac
     3481 acacaacgcc tcaaaaggga cattcttcaa gacttagacg acttctgcag gaagcttggg
     3541 atccacccgt ggtctgtgta aaagggggtg ccaatcagct taagtgtctc aggtacagac
     3601 ttaaagcatc tactcaagtt gactttgaca gcataagcac cacatggcat tggacagata
     3661 gaaaaaacac cgagaggata ggtagtgcta gaatgttagt aaagtttatt gatgaggctc
     3721 aacgagagaa gtttcttgag agagttgctt tgcccagatc agtgtctgtg tttttgggac
     3781 agtttaatgg gtcttaaaat taatggaagt tgattttgct tggacgtgtg tacatagtcc
     3841 ctgtatatat tcccctccta cccccacata ccttgaagct tgcaacattg taacaaatgt
     3901 atcgcctacg tagaaaacgc gctgccccca aagatatata cccctcatgc aaaatatcaa
     3961 acacctgccc acctgacatt caaaataaaa ttgagcatac aacaattgct gataaaatat
     4021 tgcaatatgg cagtctggga gtttttttgg gaggtttggg cattggaaca gccagaggct
     4081 ctggaggaag aattggttat actcccctcg gtgagggtgg tggggttaga gttgctactc
     4141 gtccaactcc agtaaggcct acaatacctg tggaaacagt aggccccagt gaaattttcc
     4201 ccatagatgt tgtagatcct acaggccctg ctgttattcc cctacaagat ttaggtagag
     4261 acttcccaat accaactgtg caggttattg cagaaattca ccctatttct gacataccaa
     4321 acattgttgc atcttcaaca aatgaaggag aatctgccat attagatgtg ttacgaggga
     4381 atgcaaccat acgcactgtt tcaagaacac aatacaataa cccctctttc actgttgcat
     4441 ctacatctaa tataagtgct ggagaagcat caacatcaga tattgtattt gttagcaatg
     4501 gttcaggtga cagggtggtg ggcgaggata tccccttggt agaattaaac ttaggccttg
     4561 aaacagacac atcttctgtt gtacaagaaa cagcattttc cagcagcaca ccaattgctg
     4621 aaagaccctc ttttaggccc tcaagattct ataataggcg tctatatgaa caggtgcaag
     4681 tacaagaccc taggttcgtt gagcagccac agtcaatggt cacttttgat aatccagcat
     4741 ttgagccaga gcttgatgag gtgtctatta tcttccaaag agacttagat gctcttgctc
     4801 agacaccagt gcctgaattt agagatgtag tttatctgag caagcccaca ttttcgcggg
     4861 aaccaggggg acggttaagg gttagccgcc ttggcaaaag ttcaactatt cgtacacgcc
     4921 tgggcacagc aattggcgcc agaacccact ttttctatga tttaagttct attgctccag
     4981 aagactcaat tgaattattg cctttaggtg agcatagtca aacaacagtc attagttcca
     5041 acttaggtga cacagcattt atacaaggtg agacagcaga ggatgactta gaagttatct
     5101 ctttagaaac accacaatta tattcagaag aagagctttt agacacaaac gaaagtgtgg
     5161 gcgaaaattt gcaacttact attactaact cagagggtga ggtttctata ctagatttaa
     5221 cacaaagcag agtcaggcca ccttttggca ctgaagatac tagcttgcat gtatattacc
     5281 caaattcttc taaagggact ccaataatta atcctgaaga atcatttaca cctttggtta
     5341 ttatagctct taacaactca acaggggatt ttgagttaca tcctagtctt agaaagcgtc
     5401 gtaaaagagc ttatgtataa tgtttttcag atggctgtct ggttaccagc gcagaataag
     5461 ttctatcttc ctccccagcc catcactaga atcctgtcca ctgatgaata tgtaaccaga
     5521 accaatctct tctaccatgc aacatctgaa cgtctactgc tggtcggaca tcctttgttt
     5581 gagatctcca gtaatcaaac tgtaactata ccaaaagtgt caccaaatgc atttagagtt
     5641 tttagggtgc gttttgctga tccaaataga tttgcatttg gggataaggc aatttttaat
     5701 ccagaaacag aaagattagt ttggggccta agagggatag agataggtag aggccagcct
     5761 ttaggtatag gaataacggg ccaccctctt ttaaataagt tagatgatgc agaaaatcca
     5821 acaaattata ttaatactca tgcaaatgga gattctagac aaaatactgc ttttgatgca
     5881 aaacagacac aaatgttcct cgtcggctgt actcctgctt caggtgaaca ctggacaagt
     5941 agtcgttgcc caggggaaca agtgaaactt ggggactgcc ccagggtgca aatgatagag
     6001 tctgtcatag aagatggtga catgatggat attggttttg gggctatgga ttttgctgct
     6061 ttacagcaag acaagtctga tgtcccttta gatgttgttc aagcaacatg caaatatcct
     6121 gattatatca gaatgaacca tgaagcctat ggcaactcta tgtttttttt tgcacgtcgc
     6181 gagcaaatgt ataccaggca cttttttact cgcgggggtt cggtgggtga taaggaggca
     6241 gtcccacaaa gcctgtattt aacagcagat gctgaaccaa gaacaacttt agcaacaaca
     6301 aattatgtag gcacaccaag tggctctatg gtttcatctg atgtccaatt gtttaataga
     6361 tcttactggc ttcagcgatg tcaaggccag aataatggca tttgctggag aaaccagtta
     6421 tttattacag ttggagataa taccagagga acaagtttat ctatcagtat gaaaaacaat
     6481 gcaagtacta catattccaa tgctaatttt aatgattttc taagacatac tgaagaattt
     6541 gatctttctt ttatagttca gctttgtaaa gtaaagttaa ctcccgaaaa tctagcctac
     6601 attcatacaa tggaccctaa tattttagag gattggcaac tatctgtatc tcaaccacct
     6661 accaatcctc tagaagatca atataggttt ttagggtctt ccttggcagc aaaatgtcca
     6721 gaacaggcgc ctcctgagcc ccagactgat ccttatagtc aatataaatt ctgggaagtc
     6781 gatctcacag aaaggatgtc cgaacaatta gaccaatttc cactaggaag gaaatttcta
     6841 tatcaaagtg gcatgacaca acgtactgct actagttcca ccacaaagcg caaaacagtg
     6901 cgtgtatcta cgtcagccaa gcgcaggcgt aaggcttagt atatattata tataactata
     6961 tttattagta gattatttat tatatatttt tatattttta tactttttat acttgtttag
     7021 ttctaaatag acatgtaaga tttacattag tataagtagg catgtattta cataaaatag
     7081 tcttggaaac cttttattag tgaaccatca tttacaatag tgacatcata gttcatctgc
     7141 aattgctatt ccatcgttct tcacatattc tacagtagtg ttctctagat tgtattgcta
     7201 ttttcctgtt aggcaaacaa caacatctgt acatggacca aacaacccac tttcatttta
     7261 ttgtgctgca tatattccag attgttgagg atttatttgt ttagactccg gtgcattata
     7321 cacaagtgtg cattttttgt gttctctgat tgattgtgtg ttattttcct gcaatatgca
     7381 ataaaagtga gctgtccttt ctttttgtta atccctccct actccaataa aaaatcccta
     7441 cccctaaaat ctgtttgtgc tggttttatt aataattgcg ctcttttata taataagtac
     7501 tattaacacc gcacccgttg tggctaatcc cttatggtat ttaaaagact acacctacag
     7561 gatgtattgt cttcattgtt tatggtttac cgcgctccaa agacggtttg cccaaagacg
     7621 gtttgccaac cgcggttagg acttgtttca atttgctgcc aaacttatct ggtcgtgctc
     7681 caacgggttt cctgccaagc acctaaaacg gtaggtgtgt actcttttca agaattaaca
     7741 aaggagattt ctcccgccaa attagtttcg agcgaccgaa ttcggtcgta aaaatctaaa
     7801 gtgatgattg ttgtt
//
DBGET integrated database retrieval system