GenomeNet

Database: RefSeq
Entry: NC_001357
LinkDB: NC_001357
Original site: NC_001357 
LOCUS       NC_001357               7857 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Human papillomavirus - 18, complete genome.
ACCESSION   NC_001357
VERSION     NC_001357.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; E1 gene; E2 gene; E5 gene; E6 gene; E7 gene; L1 gene; L2
            gene.
SOURCE      Alphapapillomavirus 7
  ORGANISM  Alphapapillomavirus 7
            Viruses; Monodnaviria; Shotokuvirae; Cossaviricota;
            Papovaviricetes; Zurhausenvirales; Papillomaviridae;
            Firstpapillomavirinae; Alphapapillomavirus.
REFERENCE   1
  AUTHORS   Cole,S.T. and Danos,O.
  TITLE     Nucleotide sequence and comparative analysis of the human
            papillomavirus type 18 genome. Phylogeny of papillomaviruses and
            repeated structure of the E6 and E7 gene products
  JOURNAL   J. Mol. Biol. 193 (4), 599-608 (1987)
   PUBMED   3039146
REFERENCE   2  (bases 1 to 7857)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from X05015.
            Data kindly reviewed (14-AUG-1987) by Danos O.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7857
                     /organism="Alphapapillomavirus 7"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:337042"
     gene            105..581
                     /gene="E6"
                     /locus_tag="HpV18gp1"
                     /db_xref="GeneID:1489088"
     CDS             105..581
                     /gene="E6"
                     /locus_tag="HpV18gp1"
                     /codon_start=1
                     /product="E6 protein"
                     /protein_id="NP_040310.1"
                     /db_xref="GOA:P06463"
                     /db_xref="InterPro:IPR001334"
                     /db_xref="UniProtKB/Swiss-Prot:P06463"
                     /db_xref="GeneID:1489088"
                     /translation="MARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCKTVLELTEV
                     FEFAFKDLFVVYRDSIPHAACHKCIDFYSRIRELRHYSDSVYGDTLEKLTNTGLYNLL
                     IRCLRCQKPLNPAEKLRHLNEKRRFHNIAGHYRGQCHSCCNRARQERLQRRRETQV"
     misc_feature    144..527
                     /gene="E6"
                     /locus_tag="HpV18gp1"
                     /note="Early Protein (E6); Region: E6; cl27673"
                     /db_xref="CDD:332494"
     gene            590..907
                     /gene="E7"
                     /locus_tag="HpV18gp2"
                     /db_xref="GeneID:1489089"
     CDS             590..907
                     /gene="E7"
                     /locus_tag="HpV18gp2"
                     /codon_start=1
                     /product="E7 protein"
                     /protein_id="NP_040311.1"
                     /db_xref="GOA:P06788"
                     /db_xref="UniProtKB/Swiss-Prot:P06788"
                     /db_xref="GeneID:1489089"
                     /translation="MHGPKATLQDIVLHLEPQNEIPVDLLCHEQLSDSEEENDEIDGV
                     NHQHLPARRAEPQRHTMLCMCCKCEARIELVVESSADDLRAFQQLFLNTLSFVCPWCA
                     SQQ"
     misc_feature    590..901
                     /gene="E7"
                     /locus_tag="HpV18gp2"
                     /note="E7 protein, Early protein; Region: E7; cl02891"
                     /db_xref="CDD:295537"
     gene            914..2887
                     /gene="E1"
                     /locus_tag="HpV18gp3"
                     /db_xref="GeneID:1489084"
     CDS             914..2887
                     /gene="E1"
                     /locus_tag="HpV18gp3"
                     /note="E1; The Papillomaviriuses are icosahedral dsDNA
                     viruses that encode 7 early proteins, E1 to E7, and 2 late
                     structural proteins L1 and L2. Host infection by members
                     of the papillomaviruses gives rise to warts and cancer in
                     some instances. The E1 helicase protein is an
                     ATP-dependent DNA helicase that facilitates the
                     inititiation of viral DNA replication through its
                     interactions with the viral E2 protein. The E1-E2 complex
                     binds to the viral origin of replication where E1 acts to
                     unwind the DNA and E2 acts as a transcriptional
                     activator."
                     /codon_start=1
                     /product="E1"
                     /protein_id="NP_040312.1"
                     /db_xref="GOA:P06789"
                     /db_xref="InterPro:IPR001177"
                     /db_xref="UniProtKB/Swiss-Prot:P06789"
                     /db_xref="GeneID:1489084"
                     /translation="MADPEGTDGEGTGCNGWFYVQAIVDKKTGDVISDDEDENATDTG
                     SDMVDFIDTQGTFCEQAELETAQALFHAQEVHNDAQVLHVLKRKFAGGSTENSPLGER
                     LEVDTELSPRLQEISLNSGQKKAKRRLFTISDSGYGCSEVEATQIQVTTNGEHGGNVC
                     SGGSTEAIDNGGTEGNNSSVDGTSDNSNIENVNPQCTIAQLKDLLKVNNKQGAMLAVF
                     KDTYGLSFTDLVRNFKSDKTTCTDWVTAIFGVNPTIAEGFKTLIQPFILYAHIQCLDC
                     KWGVLILALLRYKCGKSRLTVAKGLSTLLHVPETCMLIQPPKLRSSVAALYWYRTGIS
                     NISEVMGDTPEWIQRLTIIQHGIDDSNFDLSEMVQWAFDNELTDESDMAFEYALLADS
                     NSNAAAFLKSNCQAKYLKDCATMCKHYRRAQKRQMNMSQWIRFRCSKIDEGGDWRPIV
                     QFLRYQQIEFITFLGALKSFLKGTPKKNCLVFCGPANTGKSYFGMSFIHFIQGAVISF
                     VNSTSHFWLEPLTDTKVAMLDDATTTCWTYFDTYMRNALDGNPISIDRKHKPLIQLKC
                     PPILLTTNIHPAKDNRWPYLESRITVFEFPNAFPFDKNGNPVYEINDKNWKCFFERTW
                     SRLDLHEEEEDADTEGNPFGTFKLRAGQNHRPL"
     misc_feature    914..2884
                     /gene="E1"
                     /locus_tag="HpV18gp3"
                     /note="E1; Provisional; Region: PHA02774"
                     /db_xref="CDD:222927"
     misc_feature    914..1336
                     /gene="E1"
                     /locus_tag="HpV18gp3"
                     /note="E1 Protein, N terminal domain; Region: PPV_E1_N;
                     pfam00524"
                     /db_xref="CDD:278925"
     misc_feature    1562..2857
                     /gene="E1"
                     /locus_tag="HpV18gp3"
                     /note="Parvovirus non-structural protein NS1; Region:
                     Parvo_NS1; cl24009"
                     /db_xref="CDD:305166"
     gene            2817..3914
                     /gene="E2"
                     /locus_tag="HpV18gp4"
                     /db_xref="GeneID:1489085"
     CDS             2817..3914
                     /gene="E2"
                     /locus_tag="HpV18gp4"
                     /codon_start=1
                     /product="E2 protein"
                     /protein_id="NP_040313.1"
                     /db_xref="GOA:P06790"
                     /db_xref="UniProtKB/Swiss-Prot:P06790"
                     /db_xref="GeneID:1489085"
                     /translation="MQTPKETLSERLSCVQDKIIDHYENDSKDIDSQIQYWQLIRWEN
                     AIFFAAREHGIQTLNHQVVPAYNISKSKAHKAIELQMALQGLAQSRYKTEDWTLQDTC
                     EELWNTEPTHCFKKGGQTVQVYFDGNKDNCMTYVAWDSVYYMTDAGTWDKTATCVSHR
                     GLYYVKEGYNTFYIEFKSECEKYGNTGTWEVHFGNNVIDCNDSMCSTSDDTVSATQLV
                     KQLQHTPSPYSSTVSVGTAKTYGQTSAATRPGHCGLAEKQHCGPVNPLLGAATPTGNN
                     KRRKLCSGNTTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILT
                     VTYHSETQRTKFLNTVAIPDSVQILVGYMTM"
     misc_feature    2832..3416
                     /gene="E2"
                     /locus_tag="HpV18gp4"
                     /note="E2 (early) protein, N terminal; Region: PPV_E2_N;
                     pfam00508"
                     /db_xref="CDD:278909"
     misc_feature    3678..3905
                     /gene="E2"
                     /locus_tag="HpV18gp4"
                     /note="E2 (early) protein, C terminal; Region: PPV_E2_C;
                     pfam00511"
                     /db_xref="CDD:278912"
     gene            3418..3684
                     /gene="E4"
                     /locus_tag="HpV18gp5"
                     /db_xref="GeneID:1489086"
     CDS             3418..3684
                     /gene="E4"
                     /locus_tag="HpV18gp5"
                     /codon_start=1
                     /product="E4 protein"
                     /protein_id="NP_040314.1"
                     /db_xref="InterPro:IPR003861"
                     /db_xref="UniProtKB/Swiss-Prot:P06791"
                     /db_xref="GeneID:1489086"
                     /translation="MTLCAVPVTTRYPLLSLLNSYSTPPHRIPAPCPWAPQRPTARRR
                     LLHDLDTVDSRRSSIVDLSTHFSVQLHLQATTKDGNSVVVTLRL"
     misc_feature    3424..3681
                     /gene="E4"
                     /locus_tag="HpV18gp5"
                     /note="E4 protein; Region: Pap_E4; pfam02711"
                     /db_xref="CDD:367150"
     gene            3936..4157
                     /gene="E5"
                     /locus_tag="HpV18gp6"
                     /db_xref="GeneID:1489087"
     CDS             3936..4157
                     /gene="E5"
                     /locus_tag="HpV18gp6"
                     /codon_start=1
                     /product="E5 protein"
                     /protein_id="NP_040315.1"
                     /db_xref="InterPro:IPR004270"
                     /db_xref="UniProtKB/Swiss-Prot:P06792"
                     /db_xref="GeneID:1489087"
                     /translation="MLSLIFLFCFCVCMYVCCHVPLLPSVCMCAYAWVLVFVYIVVIT
                     SPATAFTVYVFCFLLPMLLLHIHAILSLQ"
     misc_feature    3939..4154
                     /gene="E5"
                     /locus_tag="HpV18gp6"
                     /note="Papillomavirus E5; Region: Papilloma_E5; pfam03025"
                     /db_xref="CDD:145918"
     gene            4244..5632
                     /gene="L2"
                     /locus_tag="HpV18gp7"
                     /db_xref="GeneID:1489091"
     CDS             4244..5632
                     /gene="L2"
                     /locus_tag="HpV18gp7"
                     /codon_start=1
                     /product="L2 protein"
                     /protein_id="NP_040316.1"
                     /db_xref="GOA:P06793"
                     /db_xref="InterPro:IPR000784"
                     /db_xref="UniProtKB/Swiss-Prot:P06793"
                     /db_xref="GeneID:1489091"
                     /translation="MVSHRAARRKRASVTDLYKTCKQSGTCPPDVVPKVEGTTLADKI
                     LQWSSLGIFLGGLGIGTGSGTGGRTGYIPLGGRSNTVVDVGPTRPPVVIEPVGPTDPS
                     IVTLIEDSSVVTSGAPRPTFTGTSGFDITSAGTTTPAVLDITPSSTSVSISTTNFTNP
                     AFSDPSIIEVPQTGEVAGNVFVGTPTSGTHGYEEIPLQTFASSGTGEEPISSTPLPTV
                     RRVAGPRLYSRAYQQVSVANPEFLTRPSSLITYDNPAFEPVDTTLTFDPRSDVPDSDF
                     MDIIRLHRPALTSRRGTVRFSRLGQRATMFTRSGTQIGARVHFYHDISPIAPSPEYIE
                     LQPLVSATEDNDLFDIYADDMDPAVPVPSRSTTSFAFFKYSPTISSASSYSNVTVPLT
                     SSWDVPVYTGPDITLPSTTSVWPIVSPTAPASTQYIGIHGTHYYLWPLYYFIPKKRKR
                     VPYFFADGFVAA"
     misc_feature    4244..>5320
                     /gene="L2"
                     /locus_tag="HpV18gp7"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02777"
                     /db_xref="CDD:165142"
     misc_feature    4262..5593
                     /gene="L2"
                     /locus_tag="HpV18gp7"
                     /note="Late Protein L2; Region: Late_protein_L2;
                     pfam00513"
                     /db_xref="CDD:278914"
     gene            5430..7136
                     /gene="L1"
                     /locus_tag="HpV18gp8"
                     /db_xref="GeneID:1489090"
     CDS             5430..7136
                     /gene="L1"
                     /locus_tag="HpV18gp8"
                     /note="major capsid L1 protein; Two structural proteins
                     are involved in papillomavirus capsid formation, a major
                     (L1) and a minor (L2) protein; L1 forms the pentameric
                     assembly unit of the viral shell while L2 mediates several
                     facets of viral entry including endosomal escape after
                     uncoating"
                     /codon_start=1
                     /product="major capsid L1 protein"
                     /protein_id="NP_040317.1"
                     /db_xref="GOA:P06794"
                     /db_xref="InterPro:IPR002210"
                     /db_xref="InterPro:IPR008975"
                     /db_xref="UniProtKB/Swiss-Prot:P06794"
                     /db_xref="GeneID:1489090"
                     /translation="MCLYTRVLILHYHLLPLYGPLYHPRPLPLHSILVYMVHIIICGH
                     YIILFLRNVNVFPIFLQMALWRPSDNTVYLPPPSVARVVNTDDYVTPTSIFYHAGSSR
                     LLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLV
                     WACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLC
                     ILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQD
                     TKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQ
                     SLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFV
                     TVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVM
                     SYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKF
                     WNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPAKRVRVRA
                     RK"
     misc_feature    5613..7124
                     /gene="L1"
                     /locus_tag="HpV18gp8"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02778"
                     /db_xref="CDD:222928"
ORIGIN      
        1 attaatactt ttaacaattg tagtatataa aaaagggagt aaccgaaaac ggtcgggacc
       61 gaaaacggtg tatataaaag atgtgagaaa cacaccacaa tactatggcg cgctttgagg
      121 atccaacacg gcgaccctac aagctacctg atctgtgcac ggaactgaac acttcactgc
      181 aagacataga aataacctgt gtatattgca agacagtatt ggaacttaca gaggtatttg
      241 aatttgcatt taaagattta tttgtggtgt atagagacag tataccccat gctgcatgcc
      301 ataaatgtat agatttttat tctagaatta gagaattaag acattattca gactctgtgt
      361 atggagacac attggaaaaa ctaactaaca ctgggttata caatttatta ataaggtgcc
      421 tgcggtgcca gaaaccgttg aatccagcag aaaaacttag acaccttaat gaaaaacgac
      481 gatttcacaa catagctggg cactatagag gccagtgcca ttcgtgctgc aaccgagcac
      541 gacaggaacg actccaacga cgcagagaaa cacaagtata atattaagta tgcatggacc
      601 taaggcaaca ttgcaagaca ttgtattgca tttagagccc caaaatgaaa ttccggttga
      661 ccttctatgt cacgagcaat taagcgactc agaggaagaa aacgatgaaa tagatggagt
      721 taatcatcaa catttaccag cccgacgagc cgaaccacaa cgtcacacaa tgttgtgtat
      781 gtgttgtaag tgtgaagcca gaattgagct agtagtagaa agctcagcag acgaccttcg
      841 agcattccag cagctgtttc tgaacaccct gtcctttgtg tgtccgtggt gtgcatccca
      901 gcagtaagca acaatggctg atccagaagg tacagacggg gagggcacgg gttgtaacgg
      961 ctggttttat gtacaagcta ttgtagacaa aaaaacagga gatgtaatat cagatgacga
     1021 ggacgaaaat gcaacagaca cagggtcgga tatggtagat tttattgata cacaaggaac
     1081 attttgtgaa caggcagagc tagagacagc acaggcattg ttccatgcgc aggaggtcca
     1141 caatgatgca caagtgttgc atgttttaaa acgaaagttt gcaggaggca gcacagaaaa
     1201 cagtccatta ggggagcggc tggaggtgga tacagagtta agtccacggt tacaagaaat
     1261 atctttaaat agtgggcaga aaaaggcaaa aaggcggctg tttacaatat cagatagtgg
     1321 ctatggctgt tctgaagtgg aagcaacaca gattcaggta actacaaatg gcgaacatgg
     1381 cggcaatgta tgtagtggcg gcagtacgga ggctatagac aacgggggca cagagggcaa
     1441 caacagcagt gtagacggta caagtgacaa tagcaatata gaaaatgtaa atccacaatg
     1501 taccatagca caattaaaag acttgttaaa agtaaacaat aaacaaggag ctatgttagc
     1561 agtatttaaa gacacatatg ggctatcatt tacagattta gttagaaatt ttaaaagtga
     1621 taaaaccacg tgtacagatt gggttacagc tatatttgga gtaaacccaa caatagcaga
     1681 aggatttaaa acactaatac agccatttat attatatgcc catattcaat gtctagactg
     1741 taaatgggga gtattaatat tagccctgtt gcgttacaaa tgtggtaaga gtagactaac
     1801 agttgctaaa ggtttaagta cgttgttaca cgtacctgaa acttgtatgt taattcaacc
     1861 accaaaattg cgaagtagtg ttgcagcact atattggtat agaacaggaa tatcaaatat
     1921 tagtgaagta atgggagaca cacctgagtg gatacaaaga cttactatta tacaacatgg
     1981 aatagatgat agcaattttg atttgtcaga aatggtacaa tgggcatttg ataatgagct
     2041 gacagatgaa agcgatatgg catttgaata tgccttatta gcagacagca acagcaatgc
     2101 agctgccttt ttaaaaagca attgccaagc taaatattta aaagattgtg ccacaatgtg
     2161 caaacattat aggcgagccc aaaaacgaca aatgaatatg tcacagtgga tacgatttag
     2221 atgttcaaaa atagatgaag ggggagattg gagaccaata gtgcaattcc tgcgatacca
     2281 acaaatagag tttataacat ttttaggagc cttaaaatca tttttaaaag gaacccccaa
     2341 aaaaaattgt ttagtatttt gtggaccagc aaatacagga aaatcatatt ttggaatgag
     2401 ttttatacac tttatacaag gagcagtaat atcatttgtg aattccacta gtcatttttg
     2461 gttggaaccg ttaacagata ctaaggtggc catgttagat gatgcaacga ccacgtgttg
     2521 gacatacttt gatacctata tgagaaatgc gttagatggc aatccaataa gtattgatag
     2581 aaagcacaaa ccattaatac aactaaaatg tcctccaata ctactaacca caaatataca
     2641 tccagcaaag gataatagat ggccatattt agaaagtaga ataacagtat ttgaatttcc
     2701 aaatgcattt ccatttgata aaaatggcaa tccagtatat gaaataaatg acaaaaattg
     2761 gaaatgtttt tttgaaagga catggtccag attagatttg cacgaggaag aggaagatgc
     2821 agacaccgaa ggaaaccctt tcggaacgtt taagttgcgt gcaggacaaa atcatagacc
     2881 actatgaaaa tgacagtaaa gacatagaca gccaaataca gtattggcaa ctaatacgtt
     2941 gggaaaatgc aatattcttt gcagcaaggg aacatggcat acagacatta aaccaccagg
     3001 tggtgccagc ctataacatt tcaaaaagta aagcacataa agctattgaa ctgcaaatgg
     3061 ccctacaagg ccttgcacaa agtcgataca aaaccgagga ttggacactg caagacacat
     3121 gcgaggaact atggaataca gaacctactc actgctttaa aaaaggtggc caaacagtac
     3181 aagtatattt tgatggcaac aaagacaatt gtatgaccta tgtagcatgg gacagtgtgt
     3241 attatatgac tgatgcagga acatgggaca aaaccgctac ctgtgtaagt cacaggggat
     3301 tgtattatgt aaaggaaggg tacaacacgt tttatataga atttaaaagt gaatgtgaaa
     3361 aatatgggaa cacaggtacg tgggaagtac attttgggaa taatgtaatt gattgtaatg
     3421 actctatgtg cagtaccagt gacgacacgg tatccgctac tcagcttgtt aaacagctac
     3481 agcacacccc ctcaccgtat tccagcaccg tgtccgtggg caccgcaaag acctacggcc
     3541 agacgtcggc tgctacacga cctggacact gtggactcgc ggagaagcag cattgtggac
     3601 ctgtcaaccc acttctcggt gcagctacac ctacaggcaa caacaaaaga cggaaactct
     3661 gtagtggtaa cactacgcct ataatacatt taaaaggtga cagaaacagt ttaaaatgtt
     3721 tacggtacag attgcgaaaa catagcgacc actatagaga tatatcatcc acctggcatt
     3781 ggacaggtgc aggcaatgaa aaaacaggaa tactgactgt aacataccat agtgaaacac
     3841 aaagaacaaa atttttaaat actgttgcaa ttccagatag tgtacaaata ttggtgggat
     3901 acatgacaat gtaatacata tgctgtagta ccaatatgtt atcacttatt tttttatttt
     3961 gcttttgtgt atgcatgtat gtgtgctgcc atgtcccgct tttgccatct gtctgtatgt
     4021 gtgcgtatgc atgggtattg gtatttgtgt atattgtggt aataacgtcc cctgccacag
     4081 cattcacagt atatgtattt tgttttttat tgcccatgtt actattgcat atacatgcta
     4141 tattgtcttt acagtaattg tataggttgt tttatacagt gtattgtaca ttgtatattt
     4201 tgttttatac cttttatgct ttttgtattt ttgtaataaa agtatggtat cccaccgtgc
     4261 cgcacgacgc aaacgggctt cggtaactga cttatataaa acatgtaaac aatctggtac
     4321 atgtccacct gatgttgttc ctaaggtgga gggcaccacg ttagcagata aaatattgca
     4381 atggtcaagc cttggtatat ttttgggtgg acttggcata ggtactggca gtggtacagg
     4441 gggtcgtaca gggtacattc cattgggtgg gcgttccaat acagtggtgg atgttggtcc
     4501 tacacgtccc ccagtggtta ttgaacctgt gggccccaca gacccatcta ttgttacatt
     4561 aatagaggac tccagtgtgg ttacatcagg tgcacctagg cctacgttta ctggcacgtc
     4621 tgggtttgat ataacatctg cgggtacaac tacacctgcg gttttggata tcacaccttc
     4681 gtctacctct gtgtctattt ccacaaccaa ttttaccaat cctgcatttt ctgatccgtc
     4741 cattattgaa gttccacaaa ctggggaggt ggcaggtaat gtatttgttg gtacccctac
     4801 atctggaaca catgggtatg aggaaatacc tttacaaaca tttgcttctt ctggtacggg
     4861 ggaggaaccc attagtagta ccccattgcc tactgtgcgg cgtgtagcag gtccccgcct
     4921 ttacagtagg gcctaccaac aagtgtcagt ggctaaccct gagtttctta cacgtccatc
     4981 ctctttaatt acatatgaca acccggcctt tgagcctgtg gacactacat taacatttga
     5041 tcctcgtagt gatgttcctg attcagattt tatggatatt atccgtctac ataggcctgc
     5101 tttaacatcc aggcgtggga ctgttcgctt tagtagatta ggtcaacggg caactatgtt
     5161 tacccgcagc ggtacacaaa taggtgctag ggttcacttt tatcatgata taagtcctat
     5221 tgcaccttcc ccagaatata ttgaactgca gcctttagta tctgccacgg aggacaatga
     5281 cttgtttgat atatatgcag atgacatgga ccctgcagtg cctgtaccat cgcgttctac
     5341 tacctccttt gcatttttta aatattcgcc cactatatct tctgcctctt cctatagtaa
     5401 tgtaacggtc cctttaacct cctcttggga tgtgcctgta tacacgggtc ctgatattac
     5461 attaccatct actacctctg tatggcccat tgtatcaccc acggcccctg cctctacaca
     5521 gtatattggt atacatggta cacattatta tttgtggcca ttatattatt ttattcctaa
     5581 gaaacgtaaa cgtgttccct atttttttgc agatggcttt gtggcggcct agtgacaata
     5641 ccgtatatct tccacctcct tctgtggcaa gagttgtaaa taccgatgat tatgtgactc
     5701 ccacaagcat attttatcat gctggcagct ctagattatt aactgttggt aatccatatt
     5761 ttagggttcc tgcaggtggt ggcaataagc aggatattcc taaggtttct gcataccaat
     5821 atagagtatt tagggtgcag ttacctgacc caaataaatt tggtttacct gatactagta
     5881 tttataatcc tgaaacacaa cgtttagtgt gggcctgtgc tggagtggaa attggccgtg
     5941 gtcagccttt aggtgttggc cttagtgggc atccatttta taataaatta gatgacactg
     6001 aaagttccca tgccgccacg tctaatgttt ctgaggacgt tagggacaat gtgtctgtag
     6061 attataagca gacacagtta tgtattttgg gctgtgcccc tgctattggg gaacactggg
     6121 ctaaaggcac tgcttgtaaa tcgcgtcctt tatcacaggg cgattgcccc cctttagaac
     6181 ttaaaaacac agttttggaa gatggtgata tggtagatac tggatatggt gccatggact
     6241 ttagtacatt gcaagatact aaatgtgagg taccattgga tatttgtcag tctatttgta
     6301 aatatcctga ttatttacaa atgtctgcag atccttatgg ggattccatg tttttttgct
     6361 tacggcgtga gcagcttttt gctaggcatt tttggaatag agcaggtact atgggtgaca
     6421 ctgtgcctca atccttatat attaaaggca caggtatgcc tgcttcacct ggcagctgtg
     6481 tgtattctcc ctctccaagt ggctctattg ttacctctga ctcccagttg tttaataaac
     6541 catattggtt acataaggca cagggtcata acaatggtgt ttgctggcat aatcaattat
     6601 ttgttactgt ggtagatacc actcccagta ccaatttaac aatatgtgct tctacacagt
     6661 ctcctgtacc tgggcaatat gatgctacca aatttaagca gtatagcaga catgttgagg
     6721 aatatgattt gcagtttatt tttcagttgt gtactattac tttaactgca gatgttatgt
     6781 cctatattca tagtatgaat agcagtattt tagaggattg gaactttggt gttccccccc
     6841 ccccaactac tagtttggtg gatacatatc gttttgtaca atctgttgct attacctgtc
     6901 aaaaggatgc tgcaccggct gaaaataagg atccctatga taagttaaag ttttggaatg
     6961 tggatttaaa ggaaaagttt tctttagact tagatcaata tccccttgga cgtaaatttt
     7021 tggttcaggc tggattgcgt cgcaagccca ccataggccc tcgcaaacgt tctgctccat
     7081 ctgccactac gtcttctaaa cctgccaagc gtgtgcgtgt acgtgccagg aagtaatatg
     7141 tgtgtgtgta tatatatata catctattgt tgtgtttgta tgtcctgtgt ttgtgtttgt
     7201 tgtatgattg cattgtatgg tatgtatggt tgttgttgta tgttgtatgt tactatattt
     7261 gttggtatgt ggcattaaat aaaatatgtt ttgtggttct gtgtgttatg tggttgcgcc
     7321 ctagtgagta acaactgtat ttgtgtttgt ggtatgggtg ttgcttgttg ggctatatat
     7381 tgtcctgtat ttcaagttat aaaactgcac accttacagc atccatttta tcctacaatc
     7441 ctccattttg ctgtgcaacc gatttcggtt gcctttggct tatgtctgtg gttttctgca
     7501 caatacagta cgctggcact attgcaaact ttaatctttt gggcactgct cctacatatt
     7561 ttgaacaatt ggcgcgcctc tttggcgcat ataaggcgca cctggtatta gtcattttcc
     7621 tgtccaggtg cgctacaaca attgcttgca taactatatc cactccctaa gtaataaaac
     7681 tgcttttagg cacatatttt agtttgtttt tacttaagct aattgcatac ttggcttgta
     7741 caactacttt catgtccaac attctgtcta cccttaacat gaactataat atgactaagc
     7801 tgtgcataca tagtttatgc aaccgaaata ggttgggcag cacatactat acttttc
//
DBGET integrated database retrieval system