GenomeNet

Database: RefSeq
Entry: NC_001457
LinkDB: NC_001457
Original site: NC_001457 
LOCUS       NC_001457               7353 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Human papillomavirus type 4, complete genome.
ACCESSION   NC_001457
VERSION     NC_001457.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; complete genome; ORF E1; ORF E2; ORF E4; ORF E6; ORF E7;
            ORF L1; ORF L2.
SOURCE      Human papillomavirus 4
  ORGANISM  Human papillomavirus 4
            Viruses; Monodnaviria; Shotokuvirae; Cossaviricota;
            Papovaviricetes; Zurhausenvirales; Papillomaviridae;
            Firstpapillomavirinae; Gammapapillomavirus.
REFERENCE   1  (bases 1 to 7353)
  AUTHORS   Egawa,K., Delius,H., Matsukura,T., Kawashima,M. and de
            Villiers,E.M.
  TITLE     Two novel types of human papillomavirus, HPV 63 and HPV 65:
            comparisons of their clinical and histological features and DNA
            sequences to other HPV types
  JOURNAL   Virology 194 (2), 789-799 (1993)
   PUBMED   8389082
REFERENCE   2  (bases 1 to 7353)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7353)
  AUTHORS   Delius,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JAN-1993) H. Delius, Deutsches
            Krebsforschungszentrum, Abt ATV, Im Neuenheimer Feld 506, W -6900
            Heidelberg, FRG
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to X70827.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7353
                     /organism="Human papillomavirus 4"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10617"
     gene            102..524
                     /locus_tag="HpV4gp1"
                     /db_xref="GeneID:1489450"
     CDS             102..524
                     /locus_tag="HpV4gp1"
                     /note="putative E6 ORF"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_040889.1"
                     /db_xref="GOA:Q07854"
                     /db_xref="InterPro:IPR001334"
                     /db_xref="UniProtKB/Swiss-Prot:Q07854"
                     /db_xref="GeneID:1489450"
                     /translation="MADGRPATLDDFCRRFDISFFDLRLTCIFCSHTVDLADLALFYL
                     KKLSLVFRGNCYYACCSECLRLSALFEQENYFQCSIKAVHLEEIAQKKIKEICIRCIC
                     CLRLLDIVEKLDLLYSDETCYLIRGLWRGYCRNCIRKQ"
     misc_feature    180..509
                     /locus_tag="HpV4gp1"
                     /note="Early Protein (E6); Region: E6; pfam00518"
                     /db_xref="CDD:278919"
     gene            521..823
                     /locus_tag="HpV4gp2"
                     /db_xref="GeneID:1489452"
     CDS             521..823
                     /locus_tag="HpV4gp2"
                     /note="putative E7 ORF"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_040890.1"
                     /db_xref="GOA:Q07857"
                     /db_xref="InterPro:IPR000148"
                     /db_xref="UniProtKB/Swiss-Prot:Q07857"
                     /db_xref="GeneID:1489452"
                     /translation="MRGAAPTVADLNLELNDLVLPANLLSEEVLQSSDDEYEITEEES
                     VVPFRIDTCCYRCEVAVRITLYAAELGLRTLEQLLVEGKLTFCCTACARSLNRNGR"
     misc_feature    527..793
                     /locus_tag="HpV4gp2"
                     /note="E7 protein, Early protein; Region: E7; pfam00527"
                     /db_xref="CDD:278928"
     gene            813..2612
                     /locus_tag="HpV4gp3"
                     /db_xref="GeneID:1489453"
     CDS             813..2612
                     /locus_tag="HpV4gp3"
                     /note="putative E1 ORF"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_040891.1"
                     /db_xref="GOA:Q07846"
                     /db_xref="InterPro:IPR001177"
                     /db_xref="InterPro:IPR014000"
                     /db_xref="InterPro:IPR014015"
                     /db_xref="InterPro:IPR016393"
                     /db_xref="UniProtKB/Swiss-Prot:Q07846"
                     /db_xref="GeneID:1489453"
                     /translation="MADKGTDNFDLEGNNWYIVHEAECTDSIDTLDDLCDESNDDSNI
                     SNLIDDDVVDQGNSLALYNAQINEDCDNALAHLKRKYNKSPEQAVAELSPQLQAVKIT
                     PERHSKRRLFQDSGIFEDEAENSLTQVESESQAGPSSQDGGGDINLLLLQSSNRRATM
                     LAKFKEWYGVSYNEITRIYKSDKSCSDNWVIVIFRAAVEVLESSKIVLKQHCTYIQVK
                     IFGFSALYLVQFKSAKSRETVQKLMCSILNIQEYQMLCDPPKLRSVPTALYFYKHAML
                     TESSVFGQTPDWIAKQTLVSHQAATTAETFELSRMVQWAYDNNYVDECDIAYHYAMYA
                     EEDANAAAYLKSNNQVKHVRDCSTMVRMYKRYEMRDMSMSEWIYKCCDECSEEGDWKP
                     ISQFLKYQGVNILSFLIVLKSFLKGIPKKNCIVIHGPPDTGKSLFCYSFIKFLKGKVV
                     SYVNRSSHFWLQPLMDCKVGFMDDATYVCWTYIDQNLRNALDGNPMCIDAKHRAPQQL
                     KLPPMLITSNIDIKQEQSLMYLHSRIQCFNFPNKMPILDDGSPMYTFTDGTWKSFFQK
                     LGRQLELTDPEEENNGVPSRTFRCTSRSNSDSY"
     misc_feature    813..2606
                     /locus_tag="HpV4gp3"
                     /note="E1; Provisional; Region: PHA02774"
                     /db_xref="CDD:222927"
     misc_feature    813..1175
                     /locus_tag="HpV4gp3"
                     /note="E1 Protein, N terminal domain; Region: PPV_E1_N;
                     pfam00524"
                     /db_xref="CDD:278925"
     misc_feature    1299..2582
                     /locus_tag="HpV4gp3"
                     /note="Papillomavirus helicase; Region: PPV_E1_C;
                     pfam00519"
                     /db_xref="CDD:278920"
     gene            2554..3762
                     /locus_tag="HpV4gp4"
                     /db_xref="GeneID:1489449"
     CDS             2554..3762
                     /locus_tag="HpV4gp4"
                     /note="putative E2 ORF"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_040892.1"
                     /db_xref="GOA:Q07849"
                     /db_xref="InterPro:IPR000427"
                     /db_xref="InterPro:IPR001866"
                     /db_xref="InterPro:IPR009021"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/Swiss-Prot:Q07849"
                     /db_xref="GeneID:1489449"
                     /translation="MESLVARFDALQEAILTHIESQESTLESQIQYWENIRKENAIMH
                     YARKQGLTKLGLQPLPTLAVTEYNAKQAIQIHLTLQSLLKSPFASERWTLTDVSAELI
                     NTSPQNCLKKGGYDVAVWFDNDRQNAMLYTNWDFLYYQDMNEQWHKVKGEVDYDGLYF
                     TDHTGERAYFTLFSSDAQRFSRTGLWTVHFKTQVISSPIVSSTYSSSFDTEEQQLPGP
                     STSYSEVTEQASPTRRRKPRKSDATSTTSPETEGVRLRRRRREGKSGPGSGETPRKRR
                     RGGGRGGGETELGSAPSPAEVGSRHRQVERQGLSRLGLLQAEARDPPMILLKGTANSL
                     KCWRYRKVNSNCCNFLFMSTVWNWVGDCSHNHSRMLIAFDSTDQRDAFVKHNLFPKLC
                     TYTYGSLNSL"
     misc_feature    2554..3144
                     /locus_tag="HpV4gp4"
                     /note="E2 (early) protein, N terminal; Region: PPV_E2_N;
                     pfam00508"
                     /db_xref="CDD:278909"
     misc_feature    3520..3750
                     /locus_tag="HpV4gp4"
                     /note="E2 (early) protein, C terminal; Region: PPV_E2_C;
                     pfam00511"
                     /db_xref="CDD:395411"
     gene            2981..3526
                     /locus_tag="HpV4gp5"
                     /db_xref="GeneID:1489454"
     CDS             2981..3526
                     /locus_tag="HpV4gp5"
                     /note="putative E4 ORF"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_040893.1"
                     /db_xref="UniProtKB/Swiss-Prot:Q07852"
                     /db_xref="GeneID:1489454"
                     /translation="MNSGTKLKVKWIMMAYTLQTIREKELILHYLALMLKDLAELDCG
                     LCILKPKLFPPLLLALHTPPPSTLRNNSYPGPPPATPKLPSRRALLEGGNRGNPTRPP
                     PRPLKPREYDYDEDDEKENQGPGQEKPPAKEEEEEEEEEERPNWDLHHLLQKWGADID
                     KLKDKVCRDLDSYKQKLGIRL"
     misc_feature    3047..3517
                     /locus_tag="HpV4gp5"
                     /note="E4 protein; Provisional; Region: PHA03419"
                     /db_xref="CDD:223079"
     gene            3764..5329
                     /locus_tag="HpV4gp6"
                     /db_xref="GeneID:1489451"
     CDS             3764..5329
                     /locus_tag="HpV4gp6"
                     /note="putative L2 ORF"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_040894.1"
                     /db_xref="GOA:Q07862"
                     /db_xref="InterPro:IPR000784"
                     /db_xref="UniProtKB/Swiss-Prot:Q07862"
                     /db_xref="GeneID:1489451"
                     /translation="MQSLSRRKRDSVPNLYAKCQLSGNCLPDVKNKVEADTLADRLLR
                     WLGSVIYLGGLGIGTGRGSGGSTGYNPIGAPSRVTPSGTLVRPTVPVESLGPSEIIPI
                     DAIDPTTSSVVPLEDLTIPDVTVDSGDTRGIGETTLQPAQVDISTSHDPISDVTGASS
                     HPTIISGEDNAIAVLDVSPIEPPTKRIALATRGASATPHVSVISGTTEFGQSSDLNVF
                     VNATFSGDSIGYTEEIPLEPLNPFQEFEIESPPKTSTPRDVLNRAIGRARDLYNRRVQ
                     QIPTRNPALLTQPSRAIVFGFENPAFDADITQTFERDLEQVAAAPDADFADIVTIGRP
                     RFSETDAGQIRVSRLGRRGTIKTRSGVQIGQAVHFYYDLSTIDTADAIELSTLGQHSG
                     EQSIVDAMIESSLIDPFEMPDPTFTEEQQLLDPLTEDFSQSHLVLTSSRRGTSFTIPT
                     IPPGLGLRIYVDDVGSDLFVSYPESRVIPAGGLPTEPFVPLEPALLSDIFSTDFVYRP
                     SLYRKKRKRLEMF"
     misc_feature    3776..5314
                     /locus_tag="HpV4gp6"
                     /note="Late Protein L2; Region: Late_protein_L2;
                     pfam00513"
                     /db_xref="CDD:278914"
     gene            5345..6895
                     /locus_tag="HpV4gp7"
                     /db_xref="GeneID:1489455"
     CDS             5345..6895
                     /locus_tag="HpV4gp7"
                     /note="putative L1 ORF"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_040895.1"
                     /db_xref="GOA:Q07860"
                     /db_xref="InterPro:IPR002210"
                     /db_xref="InterPro:IPR011222"
                     /db_xref="UniProtKB/Swiss-Prot:Q07860"
                     /db_xref="GeneID:1489455"
                     /translation="MSSWLSTTGKVYLPPAQPVARVLETDEYITGTSLYFHAGTERLL
                     TVGHPYFPVKDVQEPHKVLVPKVSGSQFRVFRFNLPDPNRFALIDNGFYDSDHERLVW
                     KLRGIEIGRGGPLGIGTTGHPLYNKFGDTENPNGYKKQSDDNRQDVSLDPKQTQMFII
                     GCTPAIGEHWDKAEPCPSPAPQQGDCPPIELVNSYIQDGDMCDIGFGAFNFKALQADK
                     SSAPLDVIATVCKWPDFLKMGKDIYGDSLFFFGRREQLYARHFFVRAGTMGDALPEPF
                     EATSDYFIGAQNQQDQYTLGPHIYVGTPSGSLVSSESQLFNRPYWLNRAQGTNNGICW
                     DNQLFVTLVDNTHNTNFTISVKSDGANDNYQYKASDFKQYLRHIEEFEMEFIFQLCKV
                     PLTADVMAHLNVMNPNILDNWQLNFVPPPPSGIEDQYRFLQSRATRCPTQTPATEKED
                     PYKDLSFWVVDLSERFSSELSQFSLGRRFLYQSGLINGSLKRKRIISSSHAQTNTKRS
                     AKRKRSLK"
     misc_feature    5345..6883
                     /locus_tag="HpV4gp7"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02778"
                     /db_xref="CDD:222928"
ORIGIN      
        1 gtctgtaatg atagttggca acaatcatta cttatagcta tatataaccg gaagagatac
       61 atataaaaag ggacagtgca tttctactaa atcctgtcca gatggcagat ggcagacctg
      121 caaccttgga cgacttctgc agacgattcg acatttcctt ttttgatttg cgccttactt
      181 gtattttttg ttctcatact gtcgatcttg cggatcttgc tttattctat cttaagaaac
      241 ttagtttagt atttagagga aattgttatt atgcatgttg ttctgaatgc ttaagattaa
      301 gtgcactgtt tgaacaagag aattattttc aatgttctat taaagctgta catttggagg
      361 aaattgctca gaaaaagatt aaggaaattt gcattagatg catttgctgc cttagattac
      421 ttgatattgt tgagaaatta gatttattat actctgacga gacttgctat ttaataaggg
      481 gtttgtggag gggctattgc agaaattgta ttaggaaaca atgagaggag cagcgcccac
      541 ggttgcagat cttaatttag aactaaatga cttagtgtta ccagcaaacc tgctgagtga
      601 ggaggtcttg caatcttcag atgatgagta tgagattaca gaggaggagt cggtggttcc
      661 atttagaata gacacctgtt gctatagatg tgaagttgct gtaagaatta cattgtatgc
      721 tgctgagctc ggactacgga ccttggaaca acttcttgta gaaggaaagc tgacgttttg
      781 ctgcaccgct tgtgcaagaa gtcttaacag aaatggcaga taaaggtaca gacaattttg
      841 acttagaagg gaataattgg tatattgtcc atgaagcaga atgcactgac agtatagata
      901 cgttggatga tttatgcgac gaaagtaatg acgattcaaa catttctaac ttaattgatg
      961 acgatgtcgt tgatcagggg aattcccttg cgctgtacaa tgcacaaata aatgaggatt
     1021 gtgacaatgc actagcacac ctaaaacgaa agtataacaa aagtccagag caggcagtcg
     1081 ctgaattgag tccgcagttg caggctgtga aaataactcc tgaaagacac agcaaaagga
     1141 gattatttca ggacagtggg attttcgaag atgaagctga aaattctctt acacaggtag
     1201 aatccgagag ccaggctgga ccttctagcc aagatggcgg cggagatatt aatttgttgt
     1261 tgttacaaag tagtaacagg agggcaacaa tgctagcaaa gtttaaagaa tggtatgggg
     1321 tctcatacaa tgaaataaca agaatttata aaagtgataa atcttgtagt gataattggg
     1381 taatagttat ttttagagct gctgttgaag tattagaaag ttcaaagatt gttttaaagc
     1441 agcattgtac atatattcaa gttaagatct ttggattttc agctttatat ttagtacagt
     1501 ttaaaagtgc gaaaagtaga gaaactgtac aaaagttgat gtgttctata ttaaatatcc
     1561 aagaatatca aatgttatgt gatcctccaa aattacgaag tgtacccaca gcattatact
     1621 tttataagca tgctatgtta acagagagtt ctgtttttgg acaaacaccg gattggatcg
     1681 caaaacaaac tctcgtaagt catcaagcag caactactgc agagactttt gagttatcta
     1741 gaatggttca gtgggcatac gataataatt atgtggatga atgtgacatt gcttatcact
     1801 atgcaatgta cgcagaggag gatgcaaatg ctgctgctta tttaaaaagt aataatcaag
     1861 taaagcatgt acgagattgt agtacaatgg tcaggatgta taaaagatat gaaatgagag
     1921 atatgtcaat gtcagaatgg atttataaat gttgtgatga atgttctgaa gaaggagatt
     1981 ggaagccaat ctcacagttt ttaaaatatc aaggtgttaa tatattatcc tttcttatag
     2041 tgcttaaatc atttttaaaa ggtattccaa aaaaaaactg tatagttatt catggtccac
     2101 cagatacagg aaaatcatta ttttgttatt cttttataaa atttttaaaa ggaaaagtag
     2161 tttcatatgt aaatagaagt agccattttt ggttgcagcc tctgatggat tgcaaggtag
     2221 gatttatgga tgatgctacc tatgtgtgct ggacatatat agatcaaaat ttaaggaatg
     2281 cattagatgg taatccaatg tgtattgacg ctaaacacag agcaccacaa caattaaaat
     2341 taccaccaat gctaataacg tcaaatattg atattaaaca ggaacaatct ttaatgtatt
     2401 tacacagtag aatacagtgt tttaattttc ctaacaaaat gcctatttta gatgatggta
     2461 gtcctatgta tacatttact gacggtactt ggaaatcttt tttccaaaag cttggcagac
     2521 aattagaatt aacagatcct gaagaggaaa acaatggagt ccctagtcgc acgtttcgat
     2581 gcacttcaag aagcaattct gactcatatt gagtcacagg agagcacttt ggaatcccaa
     2641 atccaatatt gggaaaatat cagaaaagaa aatgctataa tgcattatgc tcgaaaacaa
     2701 ggcctaacca aattaggtct acaaccactt cctacactag cagtaactga atacaatgca
     2761 aagcaagcta ttcagataca tttaactttg caatcattgt taaaatctcc ctttgcatct
     2821 gaacggtgga cattgacaga tgttagtgca gaactgataa atacctctcc acaaaactgt
     2881 ttaaaaaagg gaggttatga tgttgctgtg tggtttgata atgatagaca gaatgcaatg
     2941 ctgtacacaa attgggactt tttatattat caagatatga atgaacagtg gcacaaagtt
     3001 aaaggtgaag tggattatga tggcttatac tttacagacc atacgggaga aagagcttat
     3061 tttacattat ttagctctga tgctcaaaga tttagcagaa ctggactgtg gactgtgcat
     3121 tttaaaaccc aagttatttc ctcccctatt gttagctcta catactcctc ctccttcgac
     3181 actgaggaac aacagttacc cgggccctcc accagctact ccgaagttac cgagcaggcg
     3241 agccctactc gaaggaggaa accgaggaaa tccgacgcga cctccaccac gtcccctgaa
     3301 accgagggag tacgactacg acgaagacga cgagaaggaa aatcagggcc cgggtcagga
     3361 gaaacccccc gcaaaagaag aagaggagga ggaagaggag gaggagagac cgaattggga
     3421 tctgcaccat ctcctgcaga agtggggagc agacatcgac aagttgaaag acaaggtctg
     3481 tcgcgacttg gactcttaca agcagaagct agggatccgc ctatgatatt gttaaagggc
     3541 acagcaaatt ctttgaaatg ttggagatat agaaaagtta actcaaattg ctgcaacttc
     3601 ttattcatga gtactgtttg gaactgggtt ggagattgct cacataatca tagtcgcatg
     3661 cttattgcat ttgatagcac tgaccaaaga gacgcttttg taaaacacaa cctttttcct
     3721 aaactgtgta catataccta cggctcattg aatagtttat aaaatgcaaa gcttgagtag
     3781 aaggaaaaga gattcagttc caaatcttta tgcaaaatgt caactgtctg gcaattgcct
     3841 acctgatgta aaaaataaag tagaagctga tactcttgct gatcgtttgc tgagatggtt
     3901 gggaagtgta atatacctag gaggcttggg tattggtact gggagaggta gtggggggtc
     3961 aactgggtat aatccaattg gagctccaag tagagtcaca cctagtggta ctttagtaag
     4021 gcctacagtg cctgtggaaa gtttgggacc ctcagaaata atcccaatag atgcaataga
     4081 cccaacaaca tcttctgttg tgccattaga ggatctgacc atcccagatg tcacagtaga
     4141 tagtggagat acaagaggaa taggggagac tactcttcag cctgcacaag tagatatttc
     4201 aacatcacat gaccctatat cagatgtcac tggtgctagc agccacccta caatcatatc
     4261 tggcgaggat aacgccattg cagtgttaga tgtgtcccct atagaacctc ccacaaaacg
     4321 gatagcattg gcaactaggg gagcctcagc aactccacat gtaagtgtca tatctggcac
     4381 aaccgaattc ggtcagtcat ctgatctgaa tgtatttgtg aatgccacat tttcaggcga
     4441 ttccattggt tatacagaag aaattccatt agaaccgttg aacccctttc aagaattcga
     4501 aatagaaagc cctccaaaaa ctagtacacc acgtgacgtt ttaaatcgtg caataggaag
     4561 agcacgggat ttatataata gaagggttca gcaaatacct actaggaacc cagctttact
     4621 gacacagcct tcccgcgcaa tagtatttgg atttgaaaat cccgcctttg atgctgacat
     4681 cactcaaaca tttgagcggg atttagaaca ggttgcagca gctccagatg ctgactttgc
     4741 agacatagtc actatagggc gtccaaggtt ttcagagaca gatgctggtc aaattagagt
     4801 tagcaggctt ggacgccgag gcacaataaa aactagaagt ggtgtgcaaa ttgggcaggc
     4861 ggttcatttt tattacgacc taagtacaat agatactgct gatgctattg aattatctac
     4921 tttaggtcaa cattcaggag aacaaagcat tgttgatgct atgatagaaa gcagcttaat
     4981 agatcctttt gaaatgcccg atcctacttt tacagaagaa caacagcttt tagatccact
     5041 tacagaagat tttagtcagt cacacttggt gcttactagt agcagacgtg ggacatcatt
     5101 tactatacct acaataccac ctggattagg tcttagaatt tatgtagatg atgtaggttc
     5161 tgatttattt gtttcctatc cagaatctag agtaatacct gctggaggtt taccaactga
     5221 gccatttgtt cctctagaac cagctttgtt atctgatata tttagtacgg attttgtata
     5281 tcgtcctagt ttatatcgca agaaacggaa acgattagaa atgttttaat tgttttgcag
     5341 gaacatgtcg agttggttat ctacaacggg taaagtctac ttacctccag ctcaacctgt
     5401 ggcaagagtt ttggaaactg acgaatatat cactggaaca tctctgtatt tccacgctgg
     5461 tacagaaagg cttttaactg taggccatcc ttattttcca gtgaaagatg tacaggaacc
     5521 tcacaaagta ttagttccta aggtttcagg aagtcaattt agagtgttta gattcaattt
     5581 gccagaccca aacagatttg ctttaattga taatggcttt tatgattctg atcatgaacg
     5641 cctagtatgg aaactgaggg gaatagaaat aggaagagga ggaccgcttg gtataggtac
     5701 tacaggtcat cctttatata ataagtttgg agacacagaa aatcctaatg gctacaaaaa
     5761 gcaatcagat gataatagac aggatgtctc tttagaccca aaacaaacac agatgtttat
     5821 tataggttgc actcctgcaa taggtgaaca ttgggataaa gctgaacctt gtcccagccc
     5881 tgctccgcaa cagggagatt gcccaccaat agagcttgta aattcataca ttcaagatgg
     5941 agatatgtgt gacattggat ttggggcttt caattttaaa gctttgcagg ctgataaatc
     6001 tagtgctcct ttggatgtca ttgccacagt ttgtaaatgg ccagattttt taaaaatggg
     6061 gaaagatatc tatggagata gcttgttttt ctttggaaga agagaacaac tatatgccag
     6121 acatttcttt gtcagagcag gcaccatggg agatgctcta ccagaacctt ttgaagctac
     6181 ctcagattat tttattggtg ctcaaaacca acaagatcag tacactttag gacctcatat
     6241 ttatgtaggg acccctagtg gctctttagt atccagtgaa tcccagttgt ttaatcgacc
     6301 gtattggtta aacagagctc agggtacaaa taatggaatt tgttgggata atcagttgtt
     6361 tgttactctt gtagataaca ctcataatac aaactttaca atttctgtga agtcagatgg
     6421 tgctaatgac aattatcagt ataaagctag tgattttaaa cagtacctca gacatataga
     6481 ggagtttgaa atggaattta tatttcaact ttgtaaagtt cctctaactg cagatgttat
     6541 ggctcattta aatgtaatga atcctaatat tttggataat tggcagttaa attttgttcc
     6601 accacctccc tctggaattg aggatcaata tagatttttg caatctagag ctacaagatg
     6661 ccctacacag acccctgcaa ctgaaaaaga agatccatat aaagatttgt ctttttgggt
     6721 tgttgattta agtgaaagat tttccagtga attgagccaa ttttccttag gcaggcggtt
     6781 tttatatcaa agtggtttaa ttaatggttc tctaaaacgt aaaagaataa taagttcttc
     6841 tcatgcacaa actaatacca aacgttctgc caaacgaaaa cggtctctga aataacaatg
     6901 tgaactcttc tggaatgttt tattctgcca ggaaaacctt caactgagcc aaattattat
     6961 ataatcgttc ttaatctcaa aattgagcta attatataag atttgcaaac gtgtatgtat
     7021 ctgtttttgt gaactatagt gaaataaact gccacatact tgccagtgtc cagtctctct
     7081 gagtcatttg gtcaacatgc gtccgcaccc caataattat ttgcatacac agatcagtag
     7141 gagaggcgcc aagacggaca tatcctcttc aaatttcctt aaaattattg aatttaacaa
     7201 ctgtaagcta caaaagaccg ttatcgtttc ctctaacctt gggaaaaagg tgagtgaaag
     7261 ttttattgca ccttttgtga gtcaatttgt ctggcggcgc tgaacgaatt tggctgtcag
     7321 cctttgcacc gggagtggtg gaaaatagtt tct
//
DBGET integrated database retrieval system