GenomeNet

Database: RefSeq
Entry: NC_001498
LinkDB: NC_001498
Original site: NC_001498 
LOCUS       NC_001498              15894 bp    cRNA    linear   VRL 13-AUG-2018
DEFINITION  Measles virus, complete genome.
ACCESSION   NC_001498
VERSION     NC_001498.1
DBLINK      Project: 15025
            BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Measles morbillivirus
  ORGANISM  Measles morbillivirus
            Viruses; Riboviria; Orthornavirae; Negarnaviricota;
            Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae;
            Orthoparamyxovirinae; Morbillivirus.
REFERENCE   1  (sites)
  AUTHORS   Rima,B.K. and Duprex,W.P.
  TITLE     The measles virus replication cycle
  JOURNAL   Curr. Top. Microbiol. Immunol. 329, 77-102 (2009)
   PUBMED   19198563
REFERENCE   2
  AUTHORS   Takeuchi,K., Miyajima,N., Kobune,F. and Tashiro,M.
  TITLE     Comparative nucleotide sequence analyses of the entire genomes of
            B95a cell-isolated and vero cell-isolated measles viruses from the
            same patient
  JOURNAL   Virus Genes 20 (3), 253-257 (2000)
   PUBMED   10949953
REFERENCE   3  (bases 1807 to 2705)
  AUTHORS   Wardrop,E.A. and Briedis,D.J.
  TITLE     Characterization of V protein in measles virus-infected cells
  JOURNAL   J. Virol. 65 (7), 3421-3428 (1991)
   PUBMED   2041073
REFERENCE   4  (bases 1748 to 3402)
  AUTHORS   Cattaneo,R., Kaelin,K., Baczko,K. and Billeter,M.A.
  TITLE     Measles virus editing provides an additional cysteine-rich protein
  JOURNAL   Cell 56 (5), 759-764 (1989)
   PUBMED   2924348
REFERENCE   5  (bases 1748 to 3402)
  AUTHORS   Bellini,W.J., Englund,G., Richardson,C.D., Rozenblatt,S. and
            Lazzarini,R.A.
  TITLE     Matrix genes of measles virus and canine distemper virus: cloning,
            nucleotide sequences, and deduced amino acid sequences
  JOURNAL   J. Virol. 58 (2), 408-416 (1986)
   PUBMED   3754588
REFERENCE   6  (bases 1748 to 3402)
  AUTHORS   Bellini,W.J., Englund,G., Rozenblatt,S., Arnheiter,H. and
            Richardson,C.D.
  TITLE     Measles virus P gene codes for two proteins
  JOURNAL   J. Virol. 53 (3), 908-919 (1985)
   PUBMED   3882996
REFERENCE   7  (bases 1 to 15894)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   8  (bases 1 to 15894)
  AUTHORS   Takeuchi,K., Tanabayashi,K. and Tashiro,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-JUL-1998) Kaoru Takeuchi, National Institute of
            Infectious Diseases, Viral Disease and Vaccine Contorol; 4-7-1
            Gakuen, Musashi-murayama, Tokyo 208-0011, Japan
            (E-mail:ktake@nih.go.jp, Tel:81-42-561-0771(ex.530),
            Fax:81-42-567-5631)
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AB016162.
            Sequence updated (21-Jul-1998)
            Sequence updated (11-Dec-1998).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..15894
                     /organism="Measles morbillivirus"
                     /mol_type="viral cRNA"
                     /strain="Ichinose-B95a"
                     /db_xref="taxon:11234"
     gene            56..1744
                     /gene="N"
                     /locus_tag="MeVgp1"
                     /db_xref="GeneID:1489804"
     mRNA            56..1744
                     /gene="N"
                     /locus_tag="MeVgp1"
                     /product="gene N"
                     /db_xref="GeneID:1489804"
     CDS             108..1685
                     /gene="N"
                     /locus_tag="MeVgp1"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="NP_056918.1"
                     /db_xref="GeneID:1489804"
                     /translation="MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSS
                     ITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLFVESPGQLIQRITDDPDVSIRLL
                     EVVQSDQSQSGLTFASRGTNMEDEADQYFSHDDPSSSDQSRSGWFENKEISDIEVQDP
                     EGFNMILGTILAQIWVLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDV
                     VRNRIAEDLSLRRFMVALILDIKRTPGNKPRIAEMICDIDTYIVEAGLASFILTIKFG
                     IETMYPALGLHEFAGELSTLESLMNLYQQMGETAPYMVILENSIQNKFSAGSYPLLWS
                     YAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDAR
                     LVSEIAMHTTEDRISRAVGPRQAQVSFLHGDQSENELPGLGGKEDRRVKQGRGEARES
                     YRETGSSRASDARAAHPPTSMPLDIDTASESGQDPQDSRRSADALLRLQAMAGILEEQ
                     GSDTDTPRVYNDRDLLD"
     misc_feature    108..1679
                     /gene="N"
                     /locus_tag="MeVgp1"
                     /note="Paramyxovirus nucleocapsid protein; Region:
                     Paramyxo_ncap; pfam00973"
                     /db_xref="CDD:395775"
     gene            1748..3402
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /db_xref="GeneID:1489805"
     mRNA            1748..3402
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /product="P/V/C"
                     /experiment="cDNA sequencing"
                     /note="three proteins are translated from this mRNA;
                     translation of phosphoprotein is initiated from an
                     alternative site; V protein is translated from mRNA
                     modified by the addition of a non-templated G"
                     /citation=[4]
                     /db_xref="GeneID:1489805"
     CDS             1807..3330
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /note="subunit of RNA dependent RNA polymerase (RdRp);
                     chaperone for Measles virus nucleocapsid protein"
                     /codon_start=1
                     /product="phosphoprotein"
                     /protein_id="NP_056919.1"
                     /db_xref="GeneID:1489805"
                     /translation="MAEEQARHVKNGLECIRALKAEPIGSLAVEEAMAAWSEISDNPG
                     QDRATCKEEEAGSSGLSKPCLSAIGSTEGGAPRIRGQGSGESDDDAETLGIPSRNLQA
                     SSTGLQCYHVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDDESENSDVDIGEPDT
                     EGYAITDRGSAPISMGFRASDVETAEGGEIHELLKLQSRGNNFPKLGKTLNVPPPPNP
                     SRASTSETPIKKGTDARLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPECV
                     SNAALIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIIS
                     KLESLLLLKGEVESIKKQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVELNP
                     DLKPIIGRDSGRALAEVLKKPVASRQLQGMTNGRTSSRGQLLKEFQLKPIGKKVSSAV
                     GFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK"
     misc_feature    1816..2742
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /note="Paramyxovirus structural protein V/P N-terminus;
                     Region: Paramyxo_PNT; pfam13825"
                     /db_xref="CDD:372740"
     misc_feature    2776..3312
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /note="Paramyxovirus P/V phosphoprotein C-terminal;
                     Region: Paramyx_P_V_C; pfam03210"
                     /db_xref="CDD:281237"
     CDS             join(1807..2499,2499..2705)
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /experiment="antibody studies of V protein in tissue
                     culture cells"
                     /experiment="in vitro translation of synthetic RNA"
                     /exception="RNA editing"
                     /note="prevents interferon induced transcriptional
                     responses in Measles virus; translated from P/V/C mRNA
                     modified by co-transcriptional insertion of non-templated
                     G at genome position 2499 nt"
                     /citation=[3]
                     /citation=[4]
                     /codon_start=1
                     /product="V protein"
                     /protein_id="YP_003873249.2"
                     /db_xref="GeneID:1489805"
                     /translation="MAEEQARHVKNGLECIRALKAEPIGSLAVEEAMAAWSEISDNPG
                     QDRATCKEEEAGSSGLSKPCLSAIGSTEGGAPRIRGQGSGESDDDAETLGIPSRNLQA
                     SSTGLQCYHVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDDESENSDVDIGEPDT
                     EGYAITDRGSAPISMGFRASDVETAEGGEIHELLKLQSRGNNFPKLGKTLNVPPPPNP
                     SRASTSETPIKKGHRREIGLIWNGDRVFIDRWCNPMCSKVTLGTIRARCTCGECPRVC
                     EQCRTDTGVDTRIWYHNLPEIPE"
     misc_feature    1816..>2499
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /note="Paramyxovirus structural protein V/P N-terminus;
                     Region: Paramyxo_PNT; pfam13825"
                     /db_xref="CDD:372740"
     misc_feature    2517..2648
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /note="Zinc-binding domain of Paramyxoviridae V protein;
                     Region: zf-Paramyx-P; pfam13008"
                     /db_xref="CDD:372427"
     CDS             1829..2389
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /experiment="antibody studies of C protein in tissue
                     culture cells"
                     /note="prevents interferon-induced transcriptional
                     responses; acts as infectivity factor; inhibits
                     transcription; translated from overlapping reading frame
                     in P/V/C mRNA using alternative start site"
                     /citation=[6]
                     /codon_start=1
                     /product="C protein"
                     /protein_id="NP_056920.1"
                     /db_xref="GeneID:1489805"
                     /translation="MSKTDWNASGLSRPSPSAHWPSRKPWQHGQKYQTTQDRTEPPAR
                     KRRQAVRVSANHASQQLDQLKAVHLASAVRDLEKAMTTLKLWESPQEISRHQALGYSV
                     IMFMITAVKRLRESKMLTLSWFNQALMVIAPSQEETMNLKTAMWILANLIPRDMLSLT
                     GDLLPSLWGSGLLMLKLQKEGRSTSS"
     misc_feature    1859..2350
                     /gene="P/V/C"
                     /locus_tag="MeVgp2"
                     /gene_synonym="P"
                     /note="Non-structural protein C; Region: Paramyxo_NS_C;
                     pfam02725"
                     /db_xref="CDD:280822"
     gene            3406..4872
                     /gene="M"
                     /locus_tag="MeVgp3"
                     /db_xref="GeneID:1489803"
     mRNA            3406..4872
                     /gene="M"
                     /locus_tag="MeVgp3"
                     /product="M gene"
                     /db_xref="GeneID:1489803"
     CDS             3438..4445
                     /gene="M"
                     /locus_tag="MeVgp3"
                     /note="hydrophobic protein on inner leaflet of membrane;
                     inhibits transcription"
                     /codon_start=1
                     /product="matrix protein"
                     /protein_id="NP_056921.1"
                     /db_xref="GeneID:1489803"
                     /translation="MTEIYDFDKSAWDIKGSIAPIQPTTYSDGRLVPQVRVIDPGLGD
                     RKDECFMYMFLLGVVEDSDPLGPPIGRAFGSLPLGVGRSTAKPEELLKEATELDIVVR
                     RTAGLNEKLVFYNNTPLTLLTPWRKVLTTGSVFNANQVCNAVNLIPLDTPQRFRVVYM
                     SITRLSDNGYYTVPRRMLEFRSVNAVAFNLLVTLRIDKAIGPGKIIDNAEQLPEATFM
                     VHIGNFRRKKSEVYSADYCKMKIEKMGLVFALGGIGGTSLHIRSTGKMSKTLHAQLGF
                     KKTLCYPLMDINEDLNRLLWRSRCKIVRIQAVLQPSVPQEFRIYDDVIINDDQGLFKV
                     L"
     misc_feature    3447..4430
                     /gene="M"
                     /locus_tag="MeVgp3"
                     /note="Viral matrix protein; Region: Matrix; pfam00661"
                     /db_xref="CDD:395535"
     gene            4876..7247
                     /gene="F"
                     /locus_tag="MeVgp4"
                     /db_xref="GeneID:1489800"
     mRNA            4876..7247
                     /gene="F"
                     /locus_tag="MeVgp4"
                     /product="F gene"
                     /db_xref="GeneID:1489800"
     CDS             5458..7110
                     /gene="F"
                     /locus_tag="MeVgp4"
                     /note="type I transmembrane glycoprotein; synthesized as
                     precurser peptide F0; cleaved to a disulphide linked F1-F2
                     complex by furin-like protease; acylated"
                     /codon_start=1
                     /product="fusion protein"
                     /protein_id="NP_056922.1"
                     /db_xref="GeneID:1489800"
                     /translation="MGLKVNVSAIFMAVLLTLQTPTGQIHWGNLSKIGVVGIGSASYK
                     VMTRSSHQSLVIKLMPNITLLNNCTRVEIAEYRRLLRTVLEPIRDALNAMTQNIRPVQ
                     SVASSRRHKRFAGVVLAGAALGVATAAQITAGIALHQSMLNSQAIDNLRASLETTNQA
                     IEAIRQAGQEMILAVQGVQDYINNELIPSMNQLSCDLIGQKLGLKLLRYYTEILSLFG
                     PSLRDPISAEISIQALSYALGGDINKVLEKLGYSGGDLLGILESRGIKARITHVDTES
                     YFIVLSIAYPTLSEIKGVIVHRLEGVSYNIGSQEWYTTVPKYVATQGYLISNFDESSC
                     TFMPEGTVCSQNALYPMSPLLQECLRGSTKSCARTLVSGSFGNRFILSQGNLIANCAS
                     ILCKCYTTGTIINQDPDKILTYIAADHCPVVEVNGVTIQVGSRRYPDAVYLHRIDLGP
                     PISLERLDVGTNLGNAIAKLEDAKELLESSDQILRSMKGLSSTSIVYILIAVCLGGLI
                     GIPALICCCRGRCNKKGEQVGMSRPGLKPDLTGTSKSYVRSL"
     misc_feature    5533..6945
                     /gene="F"
                     /locus_tag="MeVgp4"
                     /note="Fusion glycoprotein F0; Region: Fusion_gly;
                     pfam00523"
                     /db_xref="CDD:395418"
     gene            7251..9208
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /db_xref="GeneID:1489801"
     mRNA            7251..9208
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /product="H gene"
                     /db_xref="GeneID:1489801"
     CDS             7271..9124
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="type II transmembrane glycoprotein; attachment
                     glycoprotein that interacts directly with entry receptors"
                     /codon_start=1
                     /product="hemagglutinin protein"
                     /protein_id="NP_056923.1"
                     /db_xref="GeneID:1489801"
                     /translation="MSPQRDRINAFYKDNPHPKGSRIVINREHLMIDRPYVLLAVLFV
                     MFLSLIGLLAIAGIRLHRAAIYTAEIHKSLSTNLDVTNSIEHQVKDVLTPLFKIIGDE
                     VGLRTPQRFTDLVKFISDKIKFLNPDREYDFRDLTWCINPPERIKLDYDQYCADVAAE
                     ELMNALVNSTLLEARATNQFLAVSKGNCSGPTTIRGQFSNMSLSLLDLYLSRGYNVSS
                     IVTMTSQGMYGGTYLVGKPNLSSKGSELSQLSMHRVFEVGVIRNPGLGAPVFHMTNYF
                     EQPVSNDFSNCMVALGELKFAALCHREDSITIPYQGSGKGVSFQLVKLGVWKSPTDMR
                     SWVPLSTDDPVIDRLYLSSHRGVIADNQAKWAVPTTRTDDKLRMETCFQQACKGKNQA
                     LCENPEWAPLKDNRIPSYGVLSVNLSLTVELKIKIASGFGPLITHGSGMDLYKTNHNN
                     VYWLTIPPMKNLALGVINTLEWIPRFKVSPNLFTVPIKEAGEDCHAPTYLPAEVDGDV
                     KLSSNLVILPGQDLQYVLATYDTSRVEHAVVYYVYSPSRSFSYFYPFRLPIKGVPIEL
                     QVECFTWDKKLWCRHFCVLADSESGGHITHSGMVGMGVSCTVTREDGTNRR"
     misc_feature    7829..9073
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="Measles virus hemagglutinin; Region: MV-h; cd15467"
                     /db_xref="CDD:271231"
     misc_feature    7916..8107
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="Sialidase propeller 1 [structural motif]; Region:
                     Sialidase propeller 1"
                     /db_xref="CDD:271231"
     misc_feature    8120..8281
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="Sialidase propeller 2 [structural motif]; Region:
                     Sialidase propeller 2"
                     /db_xref="CDD:271231"
     misc_feature    8312..8560
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="Sialidase propeller 3 [structural motif]; Region:
                     Sialidase propeller 3"
                     /db_xref="CDD:271231"
     misc_feature    8585..8710
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="Sialidase propeller 4 [structural motif]; Region:
                     Sialidase propeller 4"
                     /db_xref="CDD:271231"
     misc_feature    8795..8929
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="Sialidase propeller 5 [structural motif]; Region:
                     Sialidase propeller 5"
                     /db_xref="CDD:271231"
     misc_feature    8960..9073
                     /gene="H"
                     /locus_tag="MeVgp5"
                     /note="Sialidase propeller 6 [structural motif]; Region:
                     Sialidase propeller 6"
                     /db_xref="CDD:271231"
     gene            9212..15854
                     /gene="L"
                     /locus_tag="MeVgp6"
                     /db_xref="GeneID:1489802"
     mRNA            9212..15854
                     /gene="L"
                     /locus_tag="MeVgp6"
                     /product="L gene"
                     /db_xref="GeneID:1489802"
     CDS             9234..15785
                     /gene="L"
                     /locus_tag="MeVgp6"
                     /note="large subunit of RNA dependent RNA polymerase
                     (RdRp); RNA synthesis, capping, and polyadenylation"
                     /codon_start=1
                     /product="large polymerase protein"
                     /protein_id="NP_056924.1"
                     /db_xref="GeneID:1489802"
                     /translation="MDSLSVNQILYPEVHLDSPIVTNKIVAILEYARVPHAYSLEDPT
                     LCQNIKHRLKNGFSNQMIINNVEVGNVIKSKLRSYPAHSHIPYPNCNQDLFNIEDKES
                     TRKIRELLKKGNSLYSKVSDKVFQCLRDTNSRLGLGSELREDIKEKIINLGVYMHSSQ
                     WFEPFLFWFTVKTEMRSVIKSQTHTCHRRRHTPVFFTGSSVELLISRDLVAIISKESQ
                     HVYYLTFELVLMYCDVIEGRLMTETAMTIDARYAELLGRVRYMWKLIDGFFPALGNPT
                     YQIVAMLEPLSLAYLQLRDITVELRGAFLNHCFTEIHDVLDQNGFSDEGTYHELIEAL
                     DYIFITDDIHLTGEIFSFFRSFGHPRLEAVTAAENVRKYMNQPKVIVYETLMKGHAIF
                     CGIIINGYRDRHGGSWPPLTLPLHAADTIRNAQASGEGLTHEQCVDNWKSFAGVRFGC
                     FMPLSLDSDLTMYLKDKALAALQREWDSVYPKEFLRYDPPKGTGSRRLVDVFLNDSSF
                     DPYDMIMYVVSGAYLHDPEFNLSYSLKEKEIKETGRLFAKMTYKMRACQVIAENLISN
                     GIGKYFKDNGMAKDEHDLTKALHTLAVSGVPKDLKESHRGGPVLKTYSRSPVHTSTRN
                     VKAEKGFVGFPHVIRQNQDTDHPENIETYETVSAFITTDLKKYCLNWRYETISLFAQR
                     LNEIYGLPSFFQWLHKRLETSVLYVSDPHCPPDLDAHVPLCKVPNDQIFIKYPMGGIE
                     GYCQKLWTISTIPYLYLAAYESGVRIASLVQGDNQTIAVTKRVPSTWPYNLKKREAAR
                     VTRDYFVILRQRLHDIGHHLKANETIVSSHFFVYSKGIYYDGLLVSQSLKSIARCVFW
                     SETIVDETRAACSNIATTMAKSIERGYDRYLAYSLNVLKVIQQILISLGFTINSTMTR
                     DVVIPLLTNNDLLIRMALLPAPIGGMNYLNMSRLFVRNIGDPVTSSIADLKRMILASL
                     MPEETLHQVMTQQPGDSSFLDWASDPYSANLVCVQSITRLLKNITARFVLIHSPNPML
                     KGLFHDDSKEEDERLAAFLMDRHIIVPRAAHEILDHSVTGARESIAGMLDTTKGLIRA
                     SMRKGGLTSRVITRLSNYDYEQFRAGMVLLTGRKRNVLIDKESCSVQLARALRSHMWA
                     RLARGRPIYGLEVPDVLESMRGHLIRRHETCVICECGSVNYGWFFVPSGCQLDDIDKE
                     TSSLRVPYIGSTTDERTDMKLAFVRAPSRSLRSAVRIATVYSWAYGDDDSSWNEAWLL
                     ARQRANVSLEELRVITPISTSTNLAHRLRDRSTQVKYSGTSLVRVARYTTISNDNLSF
                     VISDKKVDTNFIYQQGMLLGLGVLETLFRLEKDTGSSNTVLHLHVETDCCVIPMIDHP
                     RIPSSRKLELRAELCTNPLIYDNAPLIDRDATRLYTQSHRRHLVEFVTWSTPQLYHIL
                     AKSTALSMIDLVTKFEKDHMNEISALIGDDDINSFITEFLLIEPRLFTIYLGQCAAIN
                     WAFDVHYHRPSGKYQMGELLSSFLSRMSKGVFKVLVNALSHPKIYKKFWHCGIIEPIH
                     GPSLDAQNLHTTVCNMVYTCYMTYLDLLLNEELEEFTFLLCESDEDVVPDRFDNIQAK
                     HLCVLADLYCQPGTCPPIRGLRPVEKCAVLTDHIKAEARLSPAGSSWNINPIIVDHYS
                     CSLTYLRRGSIKQIRLRVDPGFIFDALAEVNVSQPKVGSNNISNMSIKDFRPPHDDVA
                     KLLKDINTSKHNLPISGGSLANYEIHAFRRIGLNSSACYKAVEISTLIRRCLEPGEDG
                     LFLGEGSGSMLITYKEILKLNKCFYNSGVSANSRSGQRELAPYPSEVGLVEHRMGVGN
                     IVKVLFNGRPEVTWVGSIDCFNFIVSNIPTSSVGFIHSDIETLPNKDTIEKLEELAAI
                     LSMALLLGKIGSILVIKLMPFSGDFVQGFISYVGSHYREVNLVYPRYSNFISTESYLV
                     MTDLKANRLMNPEKIKQQIIESSVRTSPGLIGHILSIKQLSCIQAIVGGAVSRGDINP
                     ILKKLTPIEQVLISCGLAINGPKLCKELIHHDVASGQDGLLNSILILYRELARFKDNQ
                     RSQQGMFHAYPVLVSSRQRELVSRITRKFWGHILLYSGNRKLINRFIQNLKSGYLVLD
                     LHQNIFVKNLSKSEKQIIMTGGLKREWVFKVTVKETKEWYKLVGYSALIKD"
     misc_feature    9270..12587
                     /gene="L"
                     /locus_tag="MeVgp6"
                     /note="Mononegavirales RNA dependent RNA polymerase;
                     Region: Mononeg_RNA_pol; pfam00946"
                     /db_xref="CDD:395756"
     misc_feature    12936..15773
                     /gene="L"
                     /locus_tag="MeVgp6"
                     /note="mRNA capping enzyme, paramyxovirus family; Region:
                     paramyx_RNAcap; TIGR04198"
                     /db_xref="CDD:275046"
ORIGIN      
        1 accaaacaaa gttgggtaag gatagatcaa tcaatgatca tattctagta cacttaggat
       61 tcaagatcct attatcaggg acaagagcag gattagggat atccgagatg gccacacttt
      121 tgaggagctt agcattgttc aaaagaaaca aggacaaacc acccattaca tcaggatccg
      181 gtggagccat cagaggaatc aaacacatta ttatagtacc aattcctgga gattcctcaa
      241 ttaccactcg atccagacta ctggaccggt tggtcaggtt aattggaaac ccggatgtga
      301 gcgggcccaa actaacaggg gcactaatag gtatattatc cttatttgtg gagtctccag
      361 gtcaattgat tcagaggatc accgatgacc ctgacgttag catcaggctg ttagaggttg
      421 ttcagagtga ccagtcacaa tctggcctta ccttcgcatc aagaggtacc aacatggagg
      481 atgaggcgga ccaatacttt tcacatgatg atccaagcag tagtgatcaa tccaggtccg
      541 gatggttcga gaacaaggaa atctcagata ttgaagtgca agaccctgag ggattcaaca
      601 tgattctggg taccattcta gcccagatct gggtcttgct cgcaaaggcg gttacggccc
      661 cagacacggc agctgattcg gagctaagaa ggtggataaa gtacacccaa caaagaaggg
      721 tagttggtga atttagattg gagagaaaat ggttggatgt ggtgaggaac aggattgccg
      781 aggacctctc tttacgccga ttcatggtgg ctctaatcct ggatatcaag aggacacccg
      841 ggaacaaacc taggattgct gaaatgatat gtgacattga tacatatatc gtagaggcag
      901 gattagccag ttttatcctg actattaagt ttgggataga aactatgtat cctgctcttg
      961 gactgcatga atttgctggt gagttatcca cacttgagtc cttgatgaat ctttaccagc
     1021 aaatgggaga aactgcaccc tacatggtaa tcctagagaa ctcaattcag aacaagttca
     1081 gtgcaggatc ataccctctg ctctggagct atgccatggg agtaggagtg gaacttgaaa
     1141 actccatggg aggtttgaac tttggtcgat cttactttga tccagcatat tttagattag
     1201 ggcaagagat ggtgaggagg tcagctggaa aggtcagttc cacattggca tccgaactcg
     1261 gtatcactgc cgaggatgca aggcttgttt cagagattgc aatgcatact actgaggaca
     1321 ggatcagtag agcggtcgga cccagacaag cccaagtgtc atttctacac ggtgatcaaa
     1381 gtgagaatga gctaccagga ttggggggca aggaagatag gagggtcaaa cagggtcggg
     1441 gagaagccag ggagagctac agagaaaccg ggtccagcag agcaagtgat gcgagagctg
     1501 cccatcctcc aaccagcatg cccctagaca ttgacactgc atcggagtca ggccaagatc
     1561 cgcaggacag tcgaaggtca gctgacgccc tgctcaggct gcaagccatg gcaggaatct
     1621 tggaagaaca aggctcagac acggacaccc ctagggtata caatgacaga gatcttctag
     1681 actaggtgcg agaggccgag gaccagaaca acatccgcct accctccatc attgttataa
     1741 aaaacttagg aaccaggtcc acacagccgc cagccaacca accatccact cccacgactg
     1801 gagccgatgg cagaagagca ggcacgccat gtcaaaaacg gactggaatg catccgggct
     1861 ctcaaggccg agcccatcgg ctcactggcc gtcgaggaag ccatggcagc atggtcagaa
     1921 atatcagaca acccaggaca ggaccgagcc acctgcaagg aagaggaggc aggcagttcg
     1981 ggtctcagca aaccatgcct ctcagcaatt ggatcaactg aaggcggtgc acctcgcatc
     2041 cgcggtcagg gatctggaga aagcgatgac gacgctgaaa ctttgggaat cccctcaaga
     2101 aatctccagg catcaagcac tgggttacag tgttatcatg tttatgatca cagcggtgaa
     2161 gcggttaagg gaatccaaga tgctgactct atcatggttc aatcaggcct tgatggtgat
     2221 agcaccctct caggaggaga cgatgaatct gaaaacagcg atgtggatat tggcgaacct
     2281 gataccgagg gatatgctat cactgaccgg ggatctgctc ccatctctat ggggttcagg
     2341 gcttctgatg ttgaaactgc agaaggaggg gagatccacg agctcctgaa actccaatcc
     2401 agaggcaaca actttccgaa gcttgggaaa actctcaatg ttcctccgcc cccgaacccc
     2461 agtagggcca gcacttccga gacacccatt aaaaagggca cagacgcgag attggcctca
     2521 tttggaacgg agatcgcgtc tttattgaca ggtggtgcaa cccaatgtgc tcgaaagtca
     2581 ccctcggaac catcagggcc aggtgcacct gcggggaatg tccccgagtg tgtgagcaat
     2641 gccgcactga tacaggagtg gacacccgaa tctggtacca caatctcccc gagatcccag
     2701 aataatgaag aagggggaga ctattatgat gatgagctgt tctccgatgt ccaagacatc
     2761 aaaacagcct tggccaaaat acacgaggat aatcagaaga taatctccaa gctagaatca
     2821 ttgctgttat tgaagggaga agttgagtca attaagaagc agatcaacag gcaaaatatc
     2881 agcatatcca ccctggaagg acacctctca agcatcatga ttgccattcc tggacttggg
     2941 aaggatccca acgaccccac tgcagatgtc gaactcaatc ccgacctgaa acccatcata
     3001 ggcagagatt caggccgagc actggccgaa gttctcaaga agcccgttgc cagccgacaa
     3061 ctccagggaa tgactaatgg acggaccagt tccagaggac agctgctgaa ggaatttcaa
     3121 ctaaagccga tcgggaaaaa ggtgagctca gccgtcgggt ttgttcctga caccggccct
     3181 gcatcacgca gtgtaatccg ctccattata aaatccagcc ggctagagga ggatcggaag
     3241 cgttacctga tgactctcct tgatgatatc aaaggagcca acgatcttgc caagttccac
     3301 cagatgctga tgaagataat aatgaagtag ctacagctca acttacctgc caaccccatg
     3361 ccagtcgacc taattagtac aacctaaatc cattataaaa aacttaggag caaagtgatt
     3421 gcctcctaag ttccacaatg acagagatct acgatttcga caagtcggca tgggacatca
     3481 aagggtcgat cgctccgata caacctacca cctacagtga tggcaggctg gtgccccagg
     3541 tcagagtcat agatcctggt ctaggtgata ggaaggatga atgctttatg tacatgtttc
     3601 tgctgggggt tgttgaggac agcgatcccc tagggcctcc aatcgggcga gcattcgggt
     3661 ccctgccctt aggtgttggt agatccacag caaaacccga ggaactcctc aaagaggcca
     3721 ctgagcttga catagttgtt agacgtacag cagggctcaa tgaaaaactg gtgttctaca
     3781 acaacacccc actaaccctc ctcacacctt ggagaaaggt cctaacaaca gggagtgtct
     3841 tcaatgcaaa ccaagtgtgc aatgcggtta atctaatacc gctggacacc ccgcagaggt
     3901 tccgtgttgt ttatatgagc atcacccgtc tttcggataa cgggtattac accgttccca
     3961 gaagaatgct ggaattcaga tcggtcaatg cagtggcctt caacctgcta gtgaccctta
     4021 ggattgacaa ggcgattggc cctgggaaga tcatcgacaa tgcagagcaa cttcctgagg
     4081 caacatttat ggtccacatc gggaacttca ggagaaagaa gagtgaagtc tactctgccg
     4141 attattgcaa aatgaaaatc gaaaagatgg gcctggtttt tgcacttggt gggatagggg
     4201 gcaccagtct tcacattaga agcacaggca aaatgagcaa gactctccat gcacaactcg
     4261 ggttcaagaa gaccttatgt tacccactga tggatatcaa tgaagacctt aatcggttac
     4321 tctggaggag cagatgcaag atagtaagaa tccaggcagt tttgcagcca tcagttcctc
     4381 aagaattccg catttacgac gacgtgatca taaatgatga ccaaggacta ttcaaagttc
     4441 tgtagaccgc agtgcccagc aatacccgaa aacgaccccc ctcataatga cagccagaag
     4501 gcccggacaa aaaagccccc tccagaagac tccacggacc aagcgagagg ccagccagca
     4561 gccgacagca agtgtggaca ccaggcggcc caagcacaga acagccccga cacaaggcca
     4621 ccaccagcca tcccaatctg cgtcctcctc gtgggacccc cgaggaccaa ccccgaaggt
     4681 cgctccgaac acagaccacc aaccgcatcc ccacagctcc cgggaaagga acccccagca
     4741 actggaaggc ccctcccccc ctcccccaac gcaagaaccc cacaaccgaa ccgcacaagc
     4801 gaccgaggtg acccaaccgc aggcatccga ctccttagac agatcctctc cccccggcat
     4861 actaaacaaa acttagggcc aaggaacaca cacactcgac agaacccaga ccccggcccg
     4921 cggcaccgcg cccccacccc ccgaaaacca gagggagccc ccaaccaaac ccgccggccc
     4981 ccccggtgcc cacaggtagg cacaccaacc cccgaccaga cccagcaccc agccaccgac
     5041 aatccaagac ggggggcccc ccccaaaaaa aggcccccag gggccgacag ccagcatcgc
     5101 gaggaagcac acccacccca cacacgacca cggcaaccga accagagtcc agaccaccct
     5161 gggccaccag ctcccagact cggccatcac cccgcaaaaa ggaaaggcca caacccgcgc
     5221 accccagccc cgatccggcg ggcagccact caacccgaac cagcacccaa gagcgatccc
     5281 tgggggaccc ccaaaccgca aaagacatca gtatcccaca gcctctccaa gtcccccggt
     5341 ctcctcctct tctcgaaggg accaaaagat caatccacca catccgacga cactcaattc
     5401 cccaccccca aaggagacac cgggaatccc agaatcaaga ctcatccagt gtccatcatg
     5461 ggtctcaagg tgaacgtctc tgccatattc atggcagtac tgttaactct ccaaacaccc
     5521 accggtcaaa tccattgggg caatctctct aagatagggg tggtagggat aggaagtgca
     5581 agctacaaag ttatgactcg ttccagccat caatcattgg tcataaaatt aatgcccaat
     5641 ataactctcc tcaataactg cacgagggta gagatcgcag aatacaggag actactgaga
     5701 acagttttgg aaccaattag agatgcactt aatgcaatga cccagaatat aagaccggtt
     5761 cagagtgtag cttcaagtag gagacacaag agatttgcgg gagttgtcct ggcaggtgcg
     5821 gccctaggcg ttgccacagc tgctcagata acagccggca ttgcacttca ccagtccatg
     5881 ctgaactctc aagccatcga caatctgaga gcaagcctgg aaactactaa tcaggcaatt
     5941 gaggcaatca gacaagcagg gcaggagatg atattggctg ttcagggtgt ccaagactac
     6001 atcaataatg agctgatacc gtctatgaac caactatctt gtgatttaat cggccagaag
     6061 ctagggctca aattgctcag atactataca gaaatcctgt cattatttgg ccccagctta
     6121 cgggacccca tatctgcgga gatatccatc caggctttga gctatgcgct tggaggagat
     6181 atcaataagg tattagaaaa gctcggatac agtggaggtg atttactggg catcttagag
     6241 agcagaggaa taaaggcccg gataactcac gtcgacacag agtcctactt cattgtactc
     6301 agtatagcct atccgacgct gtccgagatt aagggggtga ttgtccaccg gctagagggg
     6361 gtctcgtaca atataggctc tcaagagtgg tataccactg tgcccaagta tgttgcaacc
     6421 caagggtacc ttatctcgaa ttttgatgag tcatcgtgta ctttcatgcc agaggggact
     6481 gtgtgcagcc aaaatgcctt gtacccgatg agtcctctgc tccaagaatg cctccggggg
     6541 tccaccaagt cctgtgctcg tacactcgta tccgggtctt ttgggaaccg gttcatttta
     6601 tcacaaggga acctaatagc caattgtgca tcaatcctct gcaagtgtta cacaacagga
     6661 acgatcatta atcaagaccc tgacaagatc ctaacataca ttgctgccga tcactgcccg
     6721 gtggtcgagg tgaacggtgt gaccatccaa gtcgggagca ggaggtatcc ggacgcggtg
     6781 tacctgcaca gaattgacct cggtcctccc atatcattgg agaggttgga cgtagggaca
     6841 aatctgggga atgcaattgc taagttggag gatgccaagg aattgttgga gtcatcggac
     6901 cagatattga ggagtatgaa aggtttatcg agcactagca tagtttacat cctgattgca
     6961 gtgtgtcttg gagggttgat agggatcccc gctttaatat gttgctgcag ggggcgctgt
     7021 aacaaaaagg gagaacaagt tggtatgtca agaccaggcc taaagcctga tcttacaggg
     7081 acatcaaaat cctatgtaag gtcgctctga tcctctacaa ctcttgaaac acagatttcc
     7141 cacaagtctc ctcttcgtca tcaagcaacc accgcatcca gcatcaagcc cacctgaaat
     7201 tgtctccggc ttccctctgg ccgaacgata tcggtagtta attaaaactt agggtgcaag
     7261 atcatccaca atgtcaccac aacgagaccg aataaatgcc ttctacaaag acaacccaca
     7321 tcctaaggga agtaggatag ttattaacag agaacatctt atgattgata gaccttatgt
     7381 tttgctggct gttctattcg tcatgtttct gagcttgatc gggttgctag ccattgcagg
     7441 cattagactc catcgtgcag ccatctacac cgcagagatc cataagagcc tcagcaccaa
     7501 tctagatgta actaactcga tcgagcatca ggtcaaggac gtgctgacac cactcttcaa
     7561 gatcattggt gatgaagtgg gcctgaggac acctcagaga ttcactgacc tagtgaaatt
     7621 catctctgac aaaattaaat tccttaatcc ggatagggag tacgacttca gagatctcac
     7681 ttggtgtatc aacccgccag agagaatcaa attggattat gatcaatact gtgcagatgt
     7741 ggctgctgaa gaactcatga atgcattggt gaactcaact ctactggagg ccagggcaac
     7801 caatcagttc ctagctgtct caaagggaaa ctgctcaggg cccactacaa tcagaggtca
     7861 attctcaaac atgtcgctgt ccctgttgga cttgtattta agtcgaggtt acaatgtgtc
     7921 atctatagtc actatgacat cccagggaat gtacggggga acttacctag tgggaaagcc
     7981 taatctgagc agtaaagggt cagagttgtc acaactgagc atgcaccgag tgtttgaagt
     8041 aggggttatc agaaatccgg gtttgggggc tccggtgttc catatgacaa actattttga
     8101 gcaaccagtc agtaatgatt tcagcaactg catggtggct ttgggggagc ttaaattcgc
     8161 agccctctgt cacagggaag attctatcac aattccctat caggggtcag ggaaaggtgt
     8221 cagcttccag ctcgtcaagc taggtgtctg gaaatcccca accgacatgc gatcctgggt
     8281 ccccctatca acggatgatc cagtgataga taggctttac ctctcatctc acagaggtgt
     8341 tatcgctgac aatcaagcaa aatgggctgt cccgacaaca cggacagatg acaagttgcg
     8401 aatggagaca tgcttccagc aggcgtgtaa gggtaaaaac caagcactct gcgagaatcc
     8461 cgagtgggca ccattgaagg ataacaggat tccttcatac ggggtcttgt ctgttaatct
     8521 gagtctgaca gttgagctta aaatcaaaat tgcttcagga ttcgggccat tgatcacaca
     8581 cggttcaggg atggacctat acaaaaccaa ccacaacaat gtgtattggc tgactatccc
     8641 gccaatgaag aacctagcct taggtgtaat caacacattg gagtggatac cgagattcaa
     8701 ggttagtccc aacctcttca ctgttccaat caaggaagca ggcgaggact gccatgcccc
     8761 aacataccta cctgcggagg tggatggtga tgtcaaactc agttccaatc tggtaattct
     8821 acctggtcag gatctccaat atgttttggc aacctacgat acttccaggg ttgaacatgc
     8881 tgtggtttat tatgtttaca gcccaagccg ctcattttct tacttttatc cttttaggtt
     8941 gcctataaag ggggtcccaa tcgaattaca agtggaatgc ttcacatggg acaaaaaact
     9001 ctggtgccgt cacttctgtg tgcttgcgga ctcagaatct ggtggacata tcactcactc
     9061 tgggatggtg ggcatgggag tcagctgcac agtcactcgg gaagatggaa ccaatcgcag
     9121 atagggctgc cagtgaaccg atcacatgat gtcacccaga catcaggcat acccactagt
     9181 gtgaaataga catcagaatt aagaaaaacg tagggtccaa gtggtttccc gttatggact
     9241 cgctatctgt caaccagatc ttataccctg aagttcacct agatagcccg atagttacca
     9301 ataagatagt agctatcctg gagtatgctc gagtccctca cgcttacagc ctggaggacc
     9361 ctacactgtg tcagaacatc aagcaccgcc taaaaaacgg attctccaac caaatgatta
     9421 taaacaatgt ggaagttggg aatgtcatca agtccaagct taggagttat ccggcccact
     9481 ctcatattcc atatccaaat tgtaatcagg atttatttaa catagaagac aaagagtcaa
     9541 caaggaagat ccgtgagctc ctaaaaaagg gaaattcgct gtactccaaa gtcagtgata
     9601 aggttttcca atgcctgagg gacactaact cacggcttgg cctaggctcc gaattgaggg
     9661 aggacatcaa ggagaaaatt attaacttgg gagtttacat gcacagctcc caatggtttg
     9721 agccctttct gttttggttt acagtcaaga ctgagatgag gtcagtgatt aaatcacaaa
     9781 cccatacttg ccataggagg agacacacac ctgtattctt cactggtagt tcagttgagc
     9841 tgttaatctc tcgtgacctt gttgctataa tcagtaagga gtctcaacat gtatattacc
     9901 tgacgtttga actggttttg atgtattgtg atgtcataga ggggaggtta atgacagaga
     9961 ccgctatgac cattgatgct aggtatgcag aacttctagg aagagtcaga tacatgtgga
    10021 aactgataga tggtttcttc cctgcactcg ggaatccaac ttatcaaatt gtagccatgc
    10081 tggagccact ttcacttgct tacctgcaac tgagggatat aacagtagaa ctcagaggtg
    10141 ctttccttaa ccactgcttt actgaaatac atgatgttct tgaccaaaac gggttttctg
    10201 atgaaggtac ttatcatgag ttaattgaag ccctagatta cattttcata actgatgaca
    10261 tacatctgac aggggagatt ttctcatttt tcagaagttt cggccacccc agacttgaag
    10321 cagtaacggc tgctgaaaat gtcaggaaat acatgaatca gcctaaagtc attgtgtatg
    10381 agactctgat gaaaggtcat gccatatttt gtggaatcat aatcaacggc tatcgtgaca
    10441 ggcacggagg cagttggcca cccctgaccc tccccctgca tgctgcagac acaatccgga
    10501 atgctcaagc ttcaggtgaa gggttaacac atgagcagtg cgttgataac tggaaatcat
    10561 ttgctggagt gagatttggc tgttttatgc ctcttagcct ggacagtgat ctgacaatgt
    10621 acctaaagga caaggcactt gctgctctcc aaagggaatg ggattcagtt tacccgaaag
    10681 agttcctgcg ttacgatcct cccaagggaa ccgggtcacg gaggcttgta gatgttttcc
    10741 ttaatgattc gagctttgac ccatatgata tgataatgta tgtcgtaagt ggagcctacc
    10801 tccatgaccc tgagttcaac ctgtcttaca gcctgaaaga aaaggagatc aaggaaacag
    10861 gtagactttt cgctaaaatg acttacaaaa tgagggcatg ccaagtgatc gctgaaaatc
    10921 taatctcaaa cgggattggc aagtatttta aggacaatgg gatggccaag gatgagcacg
    10981 atttgactaa ggcactccac actctggctg tctcaggagt ccccaaagat ctcaaagaaa
    11041 gtcacagggg ggggccagtc ttaaaaacct actcccgaag cccagtccac acaagtacca
    11101 ggaacgttaa agcagaaaaa gggtttgtag gattccctca tgtaattcgg cagaatcaag
    11161 acactgatca tccggagaat atagaaacct acgagacagt cagcgcattt atcacgactg
    11221 atctcaagaa gtactgcctt aattggagat atgagaccat cagcttattt gcacagaggc
    11281 taaatgagat ttacggatta ccctcatttt ttcagtggct gcataagagg cttgaaacct
    11341 ctgtcctcta tgtaagtgac cctcattgcc cccccgacct tgacgcccat gtcccgttat
    11401 gcaaagtccc caatgaccaa atcttcatca agtaccctat gggaggtata gaagggtatt
    11461 gtcagaagct gtggaccatc agcaccattc cctacttata cctggctgct tatgagagcg
    11521 gggtaaggat tgcttcgtta gtgcaagggg acaatcagac catagccgta acaaaaaggg
    11581 tacccagcac atggccttac aaccttaaga aacgggaagc tgctagagta actagagatt
    11641 actttgtaat tcttaggcaa aggctacatg acattggcca tcacctcaag gcaaatgaga
    11701 caattgtttc atcacatttt tttgtctatt caaaaggaat atattatgat gggctacttg
    11761 tgtcccaatc actcaagagc atcgcaagat gtgtattctg gtcagagact atagttgatg
    11821 aaacaagggc agcatgcagt aatattgcta caacaatggc taaaagcatc gagagaggtt
    11881 atgaccgtta tcttgcatat tccctgaacg tcctaaaagt gatacagcaa attttgatct
    11941 ctcttggctt cacaatcaat tcaaccatga cccgagatgt agtcataccc ctcctcacaa
    12001 acaacgatct cttaataagg atggcactgt tgcccgctcc tattgggggg atgaattatc
    12061 tgaatatgag caggctgttt gtcagaaaca tcggtgatcc agtaacatca tcaattgctg
    12121 atctcaagag aatgattctc gcatcactaa tgcctgaaga gaccctccat caagtaatga
    12181 cacaacaacc gggggactct tcattcctag actgggctag cgacccttac tcagcaaatc
    12241 ttgtatgcgt ccagagcatc actagactcc tcaagaacat aactgcaagg tttgtcctaa
    12301 tccatagtcc aaacccaatg ttaaaagggt tattccatga tgacagtaaa gaagaggacg
    12361 agagactggc ggcattcctc atggacaggc atattatagt acctagggca gctcatgaaa
    12421 tcctggatca tagtgtcaca ggggcaagag agtctattgc aggcatgcta gataccacaa
    12481 aaggcctgat tcgagccagc atgaggaagg gggggttaac ctctcgagtg ataaccagat
    12541 tgtccaatta tgactatgaa caatttagag cagggatggt gctattgaca ggaagaaaga
    12601 gaaatgtcct cattgacaaa gagtcatgtt cagtgcagct ggctagagcc ctaagaagcc
    12661 atatgtgggc aagactagct cgaggacggc ctatttacgg ccttgaggtc cctgatgtac
    12721 tagaatctat gcgaggccac cttattcggc gtcatgagac atgtgtcatc tgcgagtgtg
    12781 gatcagtcaa ctacggatgg ttttttgtcc cctcgggttg ccaactggat gatattgaca
    12841 aggaaacatc atccttgaga gtcccatata ttggttctac cactgatgag agaacagaca
    12901 tgaagctcgc cttcgtaaga gccccaagta gatccttgcg atctgccgtt agaatagcaa
    12961 cagtgtactc atgggcttac ggtgatgatg atagctcttg gaacgaagcc tggttgttgg
    13021 caaggcaaag ggccaatgtg agcctggagg agctaagggt gatcactccc atctcgactt
    13081 cgactaattt agcgcatagg ttgagggatc gtagcactca agtgaaatac tcaggtacat
    13141 cccttgtccg agtggcaagg tataccacaa tctccaacga caatctctca tttgtcatat
    13201 cagataagaa ggttgatact aactttatat accaacaagg aatgcttcta gggttgggtg
    13261 ttttagaaac attgtttcga ctcgagaaag atactggatc atctaacacg gtattacatc
    13321 ttcacgtcga aacagattgt tgcgtgatcc cgatgataga tcatcccagg atacccagct
    13381 cccgcaagct agagctgagg gcagagctat gtaccaaccc attgatatat gataatgcac
    13441 ctttaattga cagagatgca acaaggctat acacccagag ccataggagg caccttgtgg
    13501 aatttgttac atggtccaca ccccaactat atcacattct agctaagtcc acagcactat
    13561 ctatgattga cctggtaaca aaatttgaga aggaccatat gaatgaaatt tcagctctca
    13621 taggggatga cgatatcaat agtttcataa ctgagtttct gcttatagag ccaagattat
    13681 tcaccatcta cttgggccag tgtgcagcca tcaattgggc atttgatgta cattatcata
    13741 gaccatcagg gaaatatcag atgggtgagc tgttgtcttc gttcctttct agaatgagca
    13801 aaggagtgtt taaggtgctt gtcaatgctc taagccaccc aaagatctac aagaaattct
    13861 ggcattgtgg tattatagag cctatccatg gtccttcact tgatgctcaa aacttgcaca
    13921 caactgtgtg caacatggtt tacacatgct atatgaccta cctcgacctg ttgttgaatg
    13981 aagagttaga agagttcaca tttcttttgt gtgaaagcga tgaggatgta gtaccggaca
    14041 gattcgacaa catccaggca aaacacttgt gtgttctggc agatttgtac tgtcaaccag
    14101 ggacctgccc accgattcga ggtctaaggc cggtagagaa atgtgcagtt ctaaccgatc
    14161 atatcaaggc agaggctagg ttatctccag caggatcttc gtggaacata aatccaatta
    14221 ttgtagacca ttactcatgc tctctgactt atctccgtcg aggatctatc aaacagataa
    14281 gattgagagt tgatccagga ttcatttttg acgccctcgc tgaggtaaat gtcagtcagc
    14341 caaaggtcgg cagcaacaac atctcaaata tgagcatcaa ggatttcaga cctccacacg
    14401 atgatgttgc aaaattgctc aaagatatca acacaagcaa gcacaatctt cccatttcag
    14461 ggggtagtct cgccaattat gaaatccatg ctttccgcag aatcgggtta aactcatctg
    14521 cttgctacaa agctgttgag atatcaacat taattaggag atgccttgag ccaggggaag
    14581 acggcttgtt cttgggtgag gggtcgggtt ctatgttgat cacttataag gagatactaa
    14641 aactaaacaa gtgcttctat aatagtgggg tttccgccaa ttctagatct ggtcaaaggg
    14701 aattagcacc ctatccctcc gaagttggcc ttgtcgaaca cagaatggga gtaggtaata
    14761 ttgtcaaggt gctctttaac gggaggcccg aagtcacgtg ggtaggcagt atagattgct
    14821 tcaatttcat agtcagtaat atccctacct ctagtgtggg gtttatccat tcagatatag
    14881 agaccttacc taacaaagat actatagaga agctagagga attggcagcc atcttatcga
    14941 tggctctact ccttggcaaa ataggatcaa tactggtgat taagcttatg cctttcagcg
    15001 gggattttgt tcagggattt ataagctatg tagggtctca ttatagagaa gtgaaccttg
    15061 tctaccctag gtacagcaac ttcatatcta ctgaatctta tttagttatg acagatctca
    15121 aagctaaccg gctaatgaat cctgaaaaga tcaagcagca gataattgaa tcatctgtgc
    15181 ggacttcacc tggacttata ggtcacatcc tatccattaa gcaactaagc tgcatacaag
    15241 caattgtggg aggcgcagtt agtagaggtg atatcaaccc tattctgaaa aaacttacac
    15301 ctatagagca ggtgctgatc agttgcgggt tggcaattaa cggacctaaa ctgtgcaaag
    15361 aattaatcca ccatgatgtt gcctcagggc aagatggatt gcttaactct atactcatcc
    15421 tctacaggga gttggcaaga ttcaaagaca accaaagaag tcaacaaggg atgttccacg
    15481 cttaccccgt attggtaagt agtaggcaac gagaacttgt atctaggatc actcgcaaat
    15541 tttgggggca tattcttctt tactccggga acagaaagtt gataaatcgg tttatccaga
    15601 atctcaagtc cggttatcta gtactagact tacaccagaa tatcttcgtt aagaatctat
    15661 ccaagtcaga gaaacagatt attatgacgg ggggtttaaa acgtgagtgg gtttttaagg
    15721 taacagtcaa ggagaccaaa gaatggtaca agttagtcgg atacagcgct ctgattaagg
    15781 attaattggt tgaactccgg aaccctaatc ctgccctagg tagttaggca ttatttgcaa
    15841 tatattaaag aaaactttga aaatacgaag tttctattcc cagctttgtc tggt
//
DBGET integrated database retrieval system