GenomeNet

Database: RefSeq
Entry: NC_001549
LinkDB: NC_001549
Original site: NC_001549 
LOCUS       NC_001549               9623 bp ss-RNA     linear   VRL 13-AUG-2018
DEFINITION  Simian immunodeficiency virus, complete genome.
ACCESSION   NC_001549 NC_001870
VERSION     NC_001549.1
DBLINK      Project: 15501
            BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Simian immunodeficiency virus (SIV)
  ORGANISM  Simian immunodeficiency virus
            Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes;
            Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus.
REFERENCE   1  (bases 1 to 9623)
  AUTHORS   Fomsgaard,A., Hirsch,V.M., Allan,J.S. and Johnson,P.R.
  TITLE     A highly divergent proviral DNA clone of SIV from a distinct
            species of African green monkey
  JOURNAL   Virology 182 (1), 397-402 (1991)
   PUBMED   2024476
REFERENCE   2  (bases 1 to 9623)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from M58410.
            On Feb 10, 2013 this sequence version replaced NC_001870.1.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..9623
                     /organism="Simian immunodeficiency virus"
                     /mol_type="genomic RNA"
                     /isolate="677"
                     /host="Cercopithecus aethiops (African green monkey)"
                     /db_xref="taxon:11723"
                     /clone="gri-1"
     repeat_region   1..688
                     /note="5' LTR"
                     /rpt_type=long_terminal_repeat
     repeat_region   461..588
                     /note="R repeat 5' copy"
     gene            897..5314
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /db_xref="GeneID:1490009"
     CDS             join(897..2197,2197..5314)
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /ribosomal_slippage
                     /codon_start=1
                     /product="Gag-Pol"
                     /protein_id="NP_687035.1"
                     /db_xref="GeneID:1490009"
                     /translation="MGGGHSALSGRSLDTFEKIRLRPNGKKKYQIKHLIWAGKEMERF
                     GLHEKLLETKEGCQKIIEVLTPLEPTGSEGLKALFNLCCVIWCIHAEQKVKDTEEAVV
                     TVKQHYHLVDKNEKAAKKKNETTAPPGGESRNYPVVNQNNAWVHQPLSPRTLNAWVKC
                     VEEKRWGAEVVPMFQALSEGCLSYDVNQMLNVIGDHQGALQILKEVINEEAAEWDRTH
                     RPPAGPLPAGQLRDPTGSDIAGTTSSIQEQIEWTFNANPRIDVGAQYRKWVILGLQKV
                     VQMYNPQKVLDIRQGPKEPFQDYVDRFYKALRAEQAPQDVKNWMTQTLLIQNANPDCK
                     LILKGLGMNPTLEEMLIACQGVGGPQHKAKLMVEMMSNGQNMVQVGPQKKGPRGPLKC
                     FNCGKFGHMQRECKAPRQIKCFKCGKIGHMAKDCKNGQANFFRVWPLGRSETKKFCAI
                     QRRHSWSGTNSPPNGNSLRSSKEAPPAVCREGTAPERGERTDKETEGERSGGCFLELP
                     LWRRPMKRVIIEGTPVQALLDTGADDTIIQEKDLHFPPHKPWRSKVVGGIGGGIHVKE
                     YQGVQVQLEDKIITGSILIGSTPINIIGRNILAQAGMKLVMGVLSSQIEETKVQLKEG
                     KDGPKLKQWPLSREKIEALTEICKQMEEEGKLSRIGGENPYNTPVFAIKKKDKTQWRM
                     LVDFRELNKATQDFFEVQLGIPHPAGLQKKKQITVIDIGDAYYSIPLCKEFRKYTAFT
                     IPSVNNTGPGIRYQFNCLPQGWKGSPTIFQNTAANILEEIKRHTPGLEIVQYMDDLWL
                     ASDHDETRHNQQVDIVRKMLLEKGLETPDKKVQREPPWEWMGYKLHPNKWTINKIELP
                     PLEGEWTVNKIQKVVGVLNWASQIYPGIKTKHTCAMLRGKKNLLEEIVWTEEAEAEYK
                     NNQGIVQETQEGTYYDPLKELIATVQKQGEGQWTYQFTQEGAVLKVGRYAKQRETHTN
                     DLRTLAHLVQKICKEALTIWGRLPRVQLPVDKKTWDMWWQDYWQVSWIPEWEFVSTPL
                     LVKLWYSLVKEPIKGEDVYYVDGAASKVTKLGKAGYLSERGKSRIRELENTTNQQAEL
                     TAVKMALEDSGENVNIVTDSQYVMNILTACPQESNSPLVEQIIQALMKKRQVYLQWVP
                     AHKGIGGNTEIDKLVSKGIRQILFLDRIEEAQDDHAKYHNNWRSMVQEFGLPNIVAKE
                     IVAACPKCQIRGEPKHGQVDASIETWQMDCTHLEGKVIIVAVHVASGFIEAEVIPRET
                     GKETAHFLLKLLARWPVKHLHTDNGPNFTSQNVAAVCWWGNIEHTTGIPYNPQSQGSV
                     ESMNRQLKEIISQIRDDCERLETAVQMATHIHNFKRKGGIGGISSAERLVNMLTTQLE
                     LNTLQNQIQKILNFKVYYREGRDPVWKGPARLIWKGEGAVVIKEGEDIKVVPRRKAKI
                     IKDYGERKTMDSEGSMEGVREANKQMEGDSDLQDQE"
     misc_feature    900..1301
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="gag gene protein p17 (matrix protein); Region:
                     Gag_p17; pfam00540"
                     /db_xref="CDD:249943"
     misc_feature    1347..1994
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="gag gene protein p24 (core nucleocapsid protein);
                     Region: Gag_p24; pfam00607"
                     /db_xref="CDD:279002"
     misc_feature    2067..2114
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="zinc finger; Region: ZnF_C2HC; smart00343"
                     /db_xref="CDD:197667"
     misc_feature    2127..2180
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Zinc knuckle; Region: zf-CCHC; pfam00098"
                     /db_xref="CDD:278525"
     misc_feature    2429..2710
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Cellular and retroviral pepsin-like aspartate
                     proteases; Region: pepsin_retropepsin_like; cl11403"
                     /db_xref="CDD:299705"
     misc_feature    order(2480..2482,2486..2488,2492..2494,2561..2569,
                     2669..2671)
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:133137"
     misc_feature    2480..2488
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:133137"
     misc_feature    2480..2482
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Catalytic residue [active]"
                     /db_xref="CDD:133137"
     misc_feature    order(2561..2572,2582..2593)
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Active site flap [active]"
                     /db_xref="CDD:133137"
     misc_feature    2774..3424
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="RT_like: Reverse transcriptase (RT, RNA-dependent
                     DNA polymerase)_like family. An RT gene is usually
                     indicative of a mobile element such as a retrotransposon
                     or retrovirus. RTs occur in a variety of mobile elements,
                     including retrotransposons; Region: RT_like; cl02808"
                     /db_xref="CDD:295487"
     misc_feature    2909..3424
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:278506"
     misc_feature    order(3050..3067,3173..3178,3269..3271,3275..3280,
                     3410..3415)
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="active site"
                     /db_xref="CDD:238185"
     misc_feature    order(3050..3067,3173..3175,3275..3277)
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238185"
     misc_feature    3176..3178
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
     misc_feature    3449..3613
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Reverse transcriptase thumb domain; Region:
                     RVT_thumb; pfam06817"
                     /db_xref="CDD:284283"
     misc_feature    3677..3979
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Reverse transcriptase connection domain; Region:
                     RVT_connect; pfam06815"
                     /db_xref="CDD:284281"
     misc_feature    4043..4393
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="RNase H; Region: RNase_H; pfam00075"
                     /db_xref="CDD:278503"
     misc_feature    order(4049..4060,4142..4147,4154..4156,4214..4216,
                     4325..4327,4379..4381)
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:259998"
     misc_feature    order(4049..4051,4214..4216)
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="active site"
                     /db_xref="CDD:259998"
     misc_feature    4424..4534
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Integrase Zinc binding domain; Region:
                     Integrase_Zn; pfam02022"
                     /db_xref="CDD:280240"
     misc_feature    4577..4882
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:279057"
     misc_feature    5066..5206
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Integrase DNA binding domain; Region: IN_DBD_C;
                     pfam00552"
                     /db_xref="CDD:278951"
     misc_feature    897..5314
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="pol protein"
     CDS             897..2438
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /codon_start=1
                     /product="gag protein"
                     /protein_id="NP_054369.1"
                     /db_xref="GeneID:1490009"
                     /translation="MGGGHSALSGRSLDTFEKIRLRPNGKKKYQIKHLIWAGKEMERF
                     GLHEKLLETKEGCQKIIEVLTPLEPTGSEGLKALFNLCCVIWCIHAEQKVKDTEEAVV
                     TVKQHYHLVDKNEKAAKKKNETTAPPGGESRNYPVVNQNNAWVHQPLSPRTLNAWVKC
                     VEEKRWGAEVVPMFQALSEGCLSYDVNQMLNVIGDHQGALQILKEVINEEAAEWDRTH
                     RPPAGPLPAGQLRDPTGSDIAGTTSSIQEQIEWTFNANPRIDVGAQYRKWVILGLQKV
                     VQMYNPQKVLDIRQGPKEPFQDYVDRFYKALRAEQAPQDVKNWMTQTLLIQNANPDCK
                     LILKGLGMNPTLEEMLIACQGVGGPQHKAKLMVEMMSNGQNMVQVGPQKKGPRGPLKC
                     FNCGKFGHMQRECKAPRQIKCFKCGKIGHMAKDCKNGQANFLGYGHWGGAKPRNFVQY
                     RGDTVGLEPTAPPMETAYDPAKKLLQQYAEKGQRLREEREQTRKQKEKEVEDVSLSSL
                     FGGDQ"
     misc_feature    900..1301
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="gag gene protein p17 (matrix protein); Region:
                     Gag_p17; pfam00540"
                     /db_xref="CDD:249943"
     misc_feature    1347..1994
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="gag gene protein p24 (core nucleocapsid protein);
                     Region: Gag_p24; pfam00607"
                     /db_xref="CDD:279002"
     misc_feature    2067..2114
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="zinc finger; Region: ZnF_C2HC; smart00343"
                     /db_xref="CDD:197667"
     misc_feature    2127..2180
                     /gene="gag-pol"
                     /locus_tag="SIVgp1"
                     /note="Zinc knuckle; Region: zf-CCHC; pfam00098"
                     /db_xref="CDD:278525"
     gene            5214..5873
                     /gene="vif"
                     /locus_tag="SIVgp2"
                     /db_xref="GeneID:1490005"
     CDS             5214..5873
                     /gene="vif"
                     /locus_tag="SIVgp2"
                     /codon_start=1
                     /product="vif protein"
                     /protein_id="NP_054370.1"
                     /db_xref="GeneID:1490005"
                     /translation="MEREKQWIVRVVWRVSERQISRWRGIVTYKIRNKQLPWEYRHHW
                     QVQWQFWTYSQFIIPLSKDDYIEVNIYHNLTPERGWLSSHGVGLSYYHQKGYKTEVDP
                     GTADRMIHLYYFNCFTDRAIQQAIRGEKYTWCTFKEGHKGQVQSLQLLALVAYTNGIR
                     KRSKRTFTRMAGNLGSRQGAMGRMATRHAQGSKRRSQKALWNEHANPSMELLCRGGKE
                     T"
     misc_feature    5223..>5675
                     /gene="vif"
                     /locus_tag="SIVgp2"
                     /note="Retroviral Vif (Viral infectivity) protein; Region:
                     Vif; pfam00559"
                     /db_xref="CDD:278957"
     gene            5683..6039
                     /gene="vpx"
                     /locus_tag="SIVgp3"
                     /db_xref="GeneID:1490006"
     CDS             5683..6039
                     /gene="vpx"
                     /locus_tag="SIVgp3"
                     /codon_start=1
                     /product="vpx protein"
                     /protein_id="NP_054371.1"
                     /db_xref="GeneID:1490006"
                     /translation="MASGRDPREPLPGWLEIWDLDREPWDEWLQDMLRDLNEEARRHF
                     GMNMLIRVWNYCVEEGRRHNTPWNEIGYKYYRIVQKSMFVHFRCGCRRRGPFSPYEER
                     RNGQGGGAPPPPPGLA"
     misc_feature    5704..5961
                     /gene="vpx"
                     /locus_tag="SIVgp3"
                     /note="VPR/VPX protein; Region: VPR; pfam00522"
                     /db_xref="CDD:278923"
     gene            5993..8449
                     /gene="tat"
                     /locus_tag="SIVgp4"
                     /pseudo
                     /db_xref="GeneID:1490004"
     misc_feature    5993..8449
                     /gene="tat"
                     /locus_tag="SIVgp4"
                     /note="tat protein"
                     /pseudo
     gene            6135..8750
                     /gene="rev1"
                     /locus_tag="SIVgp5"
                     /pseudo
                     /db_xref="GeneID:1490003"
     misc_feature    6135..8750
                     /gene="rev1"
                     /locus_tag="SIVgp5"
                     /note="rev protein"
                     /pseudo
     gene            6202..8766
                     /gene="env"
                     /locus_tag="SIVgp6"
                     /db_xref="GeneID:1490007"
     CDS             6202..8766
                     /gene="env"
                     /locus_tag="SIVgp6"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="NP_054372.1"
                     /db_xref="GeneID:1490007"
                     /translation="MGRLLIKILIIAIGISIGIGNLYVTVFYGIPVWKNSTVQAFCMT
                     PNTNMWATTNCIPDDHDNTEVPLNITEAFEAWDNPLVKQAESNIHLLFEQTMRPCVKL
                     SPICIKMSCVELNGTATTKATTTATTTMTTPCQNCSTEQIEGEMAEEPASNCTFAIAG
                     YQRDVKKNYSMTWYDQELVCNNKTGSEKGSKDCYMIHCNDSVIKEACDKTYWDTLRVR
                     YCAPAGYALLKCNDKDYRGFAPKCKNVSVVHCTRLINTTITTGIGLNGSRSENRTEIW
                     QKGGNDNDTVIIKLNKFYNLTVRCRRPGNKTVLPVTIMAGLVFHSQKYNTRLKQAWCH
                     FQGDWKGAWKEVREEVKKVKNLTEVSIENIHLRRIWGDPESANFWFNCQGEFFYCKMD
                     WFINYLNNRTEDAEGTNRTCDKGKPGPGPCVQRTYVACHIRQVVNDWYTVSKKVYAPP
                     REGHLECNSSVTALYVAIDYNNKSGPINVTLSPQVRSIWAYELGDYKLVEITPIGFAP
                     TDVRRYTGPTREKRVPFVLGFLGFLGAAGTAMGAAATTLTVQSRHLLAGILQQQKNLL
                     AAVEQQQQLLKLTIWGVKNLNARVTALEKYLEDQARLNSWGCAWKQVCHTTVPWKYNN
                     TPKWDNMTWLEWERQINALEGNITQLLEEAQNQESKNLDLYQKLDDWSGFWSWFSLST
                     WLGYVKIGFLVIVIILGLRFAWVLWGCIRNIRQGYNPLPQIHIHSSAERPDNGGGQDR
                     GGESSSSKLIRLQEESSTPSRINNWWLNFKSCSLRIRTWCYNICLTLLIFIRTAVGYL
                     QYGLQQLQEAATGLAQALARAAREAWGRLGAIVRSAYRAVINSPRRVRQGLEKVLG"
     misc_feature    6265..7767
                     /gene="env"
                     /locus_tag="SIVgp6"
                     /note="Envelope glycoprotein GP120; Region: GP120;
                     pfam00516"
                     /db_xref="CDD:278917"
     misc_feature    7846..8208
                     /gene="env"
                     /locus_tag="SIVgp6"
                     /note="heptad repeat 1-heptad repeat 2 region (ectodomain)
                     of the gp41 subunit of human immunodeficiency virus
                     (HIV-1), and related domains; Region: HIV-1-like_HR1-HR2;
                     cd09909"
                     /db_xref="CDD:197369"
     misc_feature    order(7846..7905,7912..8010)
                     /gene="env"
                     /locus_tag="SIVgp6"
                     /note="HR1; other site"
                     /db_xref="CDD:197369"
     misc_feature    order(7852..7854,7858..7866,7870..7887,7891..7905,
                     7912..7929,7933..7950,7954..7962,7966..7971,7975..7980,
                     7987..7992,7996..8004,8008..8037,8047..8049,8053..8055,
                     8059..8070,8083..8088,8095..8100,8107..8109,8116..8121,
                     8128..8133,8137..8142,8149..8154,8158..8163,8170..8175,
                     8191..8196,8203..8205)
                     /gene="env"
                     /locus_tag="SIVgp6"
                     /note="homotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:197369"
     misc_feature    order(8083..8142,8146..8181,8185..8208)
                     /gene="env"
                     /locus_tag="SIVgp6"
                     /note="HR2; other site"
                     /db_xref="CDD:197369"
     exon            8368..>8449
                     /gene="tat"
                     /locus_tag="SIVgp4"
                     /product="tat protein"
                     /pseudo
     gene            8600..9271
                     /gene="nef"
                     /locus_tag="SIVgp7"
                     /db_xref="GeneID:1490008"
     CDS             8600..9271
                     /gene="nef"
                     /locus_tag="SIVgp7"
                     /codon_start=1
                     /product="nef protein"
                     /protein_id="NP_054373.1"
                     /db_xref="GeneID:1490008"
                     /translation="MGSSNSKRQQQGLLKLWRGLRGKPGADWVLLSDPLIGQSSTVQE
                     ECGKALKKSWGKGKMTPDGRRLQEGDTFDEWDDDEEEVGFPVQPRVPLRQMTYKLAVD
                     FSHFLKSKGGLDGIYYSERREKILNLYALNEWGIIDDWQAYSPGPGIRYPRVFGFCFK
                     LVPVDLHEEARNCERHCLMHPAQMGEDPDGIDHGEVLVWKFDPKLAVEYRPDMFKDMH
                     EHAKR"
     misc_feature    8603..9256
                     /gene="nef"
                     /locus_tag="SIVgp7"
                     /note="Negative factor, (F-Protein) or Nef; Region:
                     F-protein; pfam00469"
                     /db_xref="CDD:249884"
     repeat_region   8937..9623
                     /note="3' LTR"
                     /rpt_type=long_terminal_repeat
     repeat_region   9407..9524
                     /note="R repeat 3' copy"
     regulatory      9506..9511
                     /regulatory_class="polyA_signal_sequence"
ORIGIN      
        1 tggatgggat atattactct gaaagaagag aaaagatcct gaatttgtat gccttgaacg
       61 agtggggaat aatagatgat tggcaagctt actcaccagg cccggggata aggtacccga
      121 gagtctttgg cttctgcttt aagctagtcc cagtggacct gcatgaggag gcacgcaact
      181 gtgagagaca ctgtctgatg catccagcac agatggggga agatcctgat ggaatagatc
      241 atggagaagt cttggtctgg aagtttgacc cgaagttggc ggtggagtac cgcccggaca
      301 tgtttaagga catgcacgaa catgcaaagc gctagtgtca gcactttgcg gttgggactt
      361 tccgccaggg actttccaca gtgggtggat cggaggcggt acaggggcgg tactgggagt
      421 ggctttcccc tcagagctgc ataaaagcag atgctcgctg gcttgtaact cagtctctta
      481 ctaggagacc agctagagcc tgggtgttcg ctggttagcc taacccggtt ggccaccggg
      541 ggtaaggact ccttggcttc atatagctca ataaacctgc tcgcttagtc gctatattgg
      601 agtcaagtgc tcattgctgc gccgagcctc tagaggtgaa cctctcttac tgggttctcc
      661 tgtacccagg tgggagaaac tccagcagtg gcgcccgaac agggacttga gaagaggcat
      721 cggcaccgac cgctgagttg ctgagcgtcg gagagggacg actcaggtag ggtgagagcc
      781 tacgagtttt ttgctaccta gtcagcgaga aaggctaggc cgcgacaggg gcgcgggtcc
      841 cattagtggc aaccaaccca gttggacgaa gggttggtag gggacgggtc ggagcaatgg
      901 gcgggggtca ctcagcactg tcagggagaa gcctcgacac gttcgagaag attaggctac
      961 gtccgaacgg gaaaaagaag taccaaatta aacatttaat atgggcagga aaagaaatgg
     1021 aacgatttgg gttacatgag aaacttttag aaacaaaaga aggctgtcaa aaaatcatag
     1081 aagttttaac cccgttggaa ccgacaggct ccgaggggct aaaagctctg tttaatttgt
     1141 gctgcgtcat ttggtgcatt cacgcagaac agaaagtgaa agacacagag gaagctgtag
     1201 taacagttaa gcaacactac catctagtgg acaaaaatga gaaagcagct aaaaagaaaa
     1261 atgagacaac agcgccacct ggtggcgaat caagaaatta cccagtagta aatcagaata
     1321 atgcctgggt acaccagcct ttgtctccgc gcacgttaaa tgcgtgggtc aaatgcgtgg
     1381 aggaaaaaag gtggggagca gaagtagtcc ccatgttcca agcactctca gagggatgtc
     1441 tctcctatga tgtaaatcag atgctcaatg taataggaga ccatcagggg gcattacaaa
     1501 ttcttaagga agtcattaat gaagaagcag cagagtggga caggacacac agaccaccag
     1561 ctggcccgtt accagcaggg cagctaagag acccgacagg gtcagatata gcaggaacta
     1621 ccagctcaat tcaggaacaa atagagtgga ccttcaatgc caatccaaga atagacgtag
     1681 gggcacaata cagaaaatgg gttattttgg gcttacaaaa ggtagtgcag atgtacaatc
     1741 cccaaaaggt cctagacatt cgacagggac ctaaagaacc cttccaggac tatgtagaca
     1801 gattctataa agccctgaga gcagaacaag caccacagga tgttaaaaat tggatgacac
     1861 aaactttgct tatccagaat gccaatccgg attgtaaatt gattctgaaa ggattgggaa
     1921 tgaatccaac cttggaggaa atgctaatag cttgccaggg agtaggaggg ccacaacata
     1981 aggctaagct aatggtagaa atgatgagta atggacagaa tatggtccaa gtgggacctc
     2041 agaaaaaggg cccccgaggg ccgctaaaat gctttaattg tggcaaattt ggacatatgc
     2101 aaagggaatg caaggcacca agacagatca aatgctttaa gtgcggcaaa attggccata
     2161 tggcaaaaga ctgcaagaat ggacaggcaa attttttagg gtatggccat tggggaggag
     2221 cgaaaccaag aaattttgtg caatacagag gagacacagt tggtctggaa ccaacagccc
     2281 ccccaatgga aacagcttac gatccagcaa agaagctcct ccagcagtat gcagagaagg
     2341 gacagcgcct gagagaggag agagaacaga caaggaaaca gaaggagaaa gaagtggagg
     2401 atgtttcctt gagctccctc tttggaggag accaatgaaa cgagtcatca tagaaggaac
     2461 gccagtgcaa gccttgttag atacaggagc agatgacact ataattcaag aaaaggactt
     2521 gcactttccc ccacataaac catggcgttc caaggtagta ggaggtatag gaggagggat
     2581 tcatgtcaaa gaatatcagg gggtacaagt acaattggag gataaaatca tcaccggctc
     2641 aattctaata ggaagtacac caatcaatat tataggaaga aatattttag ctcaggcagg
     2701 catgaaatta gttatgggag ttctatctag tcagattgag gaaacaaaag tacaactaaa
     2761 agaagggaaa gatggaccta aattgaaaca atggccctta tcaagagaaa aaattgaagc
     2821 tttaacagaa atatgcaaac aaatggaaga ggagggaaaa ttatctagga taggaggaga
     2881 aaatccttat aatacaccag tgtttgccat aaagaaaaag gataaaacac aatggagaat
     2941 gcttgtagat ttcagggaac taaacaaagc tactcaagac ttttttgagg ttcagctggg
     3001 aattcctcac ccagcgggcc ttcagaaaaa gaagcaaatc acagtaatag acatagggga
     3061 tgcctattat tcaataccat tatgcaagga attcagaaaa tatacagcat ttaccatccc
     3121 ctcagtaaat aatacagggc cagggataag gtatcagttc aattgtctgc ctcagggatg
     3181 gaaaggatct cctacaattt tccagaatac ggcagcaaac attttagagg agatcaaaag
     3241 gcacactcct gggttagaaa ttgtccaata catggacgat ttgtggttgg cgtcagacca
     3301 tgatgagact agacataatc aacaggtaga catagtaaga aagatgctgc tagaaaaagg
     3361 tctagaaacc ccagacaaga aagtccaaag agaaccgcca tgggaatgga tggggtataa
     3421 attgcatccg aataaatgga ccattaacaa aatagaatta ccccccttag aaggagaatg
     3481 gacagtaaac aaaatacaga aggtagtagg agttctaaat tgggcaagtc aaatttatcc
     3541 aggaattaaa accaaacata cctgtgccat gttgagaggg aaaaagaacc tcctagaaga
     3601 aatagtatgg acagaagagg cagaggcaga atataagaac aatcaaggga tagtgcagga
     3661 aacacaagaa ggaacatact atgaccctct caaagaatta atagcaacag ttcaaaagca
     3721 aggagaaggg caatggacat accaattcac ccaagaaggg gcagtattaa aggtgggaag
     3781 atatgccaag caaagagaaa ctcatactaa tgatctaagg actctagcac accttgtcca
     3841 aaaaatctgt aaggaagcac ttaccatttg gggaagactt ccacgagtac aactcccagt
     3901 agacaagaaa acatgggata tgtggtggca ggactattgg caagtatcct ggataccaga
     3961 atgggagttt gttagcacac cactcctagt aaaactgtgg tattccttag taaaagaacc
     4021 aatcaaagga gaagatgttt attatgtgga tggggcagca tccaaagtga ccaaattagg
     4081 taaggcagga tatctgtcag agagaggaaa aagtagaatt agggaattag aaaacaccac
     4141 taaccaacaa gcagaattaa cagcagttaa gatggcattg gaggacagtg gagaaaatgt
     4201 aaatatagtc acagattctc aatatgtaat gaacatcttg acagcatgtc cacaggaaag
     4261 taactcaccc ttagtggaac agataataca agccctaatg aaaaagaggc aggtctactt
     4321 acaatgggta ccagctcata aggggatagg aggcaataca gaaatagata aattagtaag
     4381 caaaggaata agacagatcc tcttcttaga tagaatagaa gaagcacaag atgaccatgc
     4441 aaagtaccat aacaattgga gaagtatggt acaggaattt ggattaccta atatagtagc
     4501 aaaagagata gtagcggcat gtcccaaatg ccaaataaga ggagaaccta agcatggaca
     4561 ggtagacgcc tccattgaaa cttggcagat ggactgcacc catttagaag gaaaagttat
     4621 aatagtagca gtacatgtag ccagtggatt catagaagca gaggtgatcc caagagaaac
     4681 tgggaaggag acagcacact ttctgctgaa actgttagca agatggccag tgaaacatct
     4741 acacactgat aatggcccaa actttacctc tcagaatgtg gcagcggtgt gctggtgggg
     4801 taatatagag cacaccactg gaatacctta taacccacag tcacagggta gtgtagaaag
     4861 catgaacaga cagctcaagg aaatcatctc tcaaataaga gatgattgtg agagattgga
     4921 gacagcagtg caaatggcta cgcatatcca caattttaaa agaaagggag gaataggggg
     4981 tatctctagt gcagaaagat tggttaatat gctaacaaca caactagaac taaatactct
     5041 acaaaaccaa atccaaaaaa ttttgaattt taaggtctac tacagagaag gtagagatcc
     5101 agtgtggaaa ggaccagcgc gactcatctg gaaaggagaa ggcgcggtgg taattaaaga
     5161 gggggaagac atcaaggtag tccccaggag aaaggctaag attatcaaag attatggaga
     5221 gagaaaaaca atggatagtg agggtagtat ggagggtgtc agagaggcaa ataagcagat
     5281 ggagggggat agtgacttac aagatcagga ataaacaatt gccttgggaa tacagacatc
     5341 attggcaggt gcaatggcag ttttggacct acagccagtt cattatcccc ttatcaaaag
     5401 atgattacat agaagtgaat atttatcaca acctcacccc agaaagagga tggctctcaa
     5461 gtcatggagt agggttatcc tattaccatc aaaagggata taagacagaa gtagatccag
     5521 gaacagcaga cagaatgata cacctatatt attttaactg ttttacagat agagccatcc
     5581 aacaggctat cagaggggag aagtatacgt ggtgcacatt caaggaagga cataaaggtc
     5641 aggtacaatc actgcaactt ttggcactag ttgcatatac aaatggcatc aggaagagat
     5701 ccaagagaac ctttaccagg atggctggaa atctgggatc tagacaggga gccatgggac
     5761 gaatggctac aagacatgct cagggatcta aacgaagaag ccagaaggca ctttggaatg
     5821 aacatgctaa tccgagtatg gaattactgt gtagaggagg gaaggagaca taatacccca
     5881 tggaatgaga taggctacaa gtactataga attgttcaaa agtctatgtt tgtacatttc
     5941 agatgtggtt gtagaaggag aggacctttt tccccttacg aagagaggag aaatggacaa
     6001 ggaggaggag ccccaccccc tcctccagga cttgcatagg ccattacaac catgtactaa
     6061 taaatgctat tgcaaaaaat gctgttatca ctgtgagctt tgcttcctgc agaagggctt
     6121 aggagtgcgt tatcatgtct ctaggaaaag aagaaaaaca agcactcaag ataatcaaga
     6181 ccctatacgg cagcagtaag tatggggaga ttgcttataa aaatactaat aatagcaata
     6241 gggataagta taggaatagg taacctgtat gtgacagtgt tttatggaat cccagtatgg
     6301 aaaaattcaa cagttcaggc attttgcatg acgcccaata ccaatatgtg ggcaaccacc
     6361 aactgcatac cagatgatca tgataataca gaggtgcctc taaacattac agaagctttc
     6421 gaggcttggg ataatccgct ggtaaaacaa gcagagagta atatacatct actctttgaa
     6481 caaacgatga ggccttgtgt taagctctcc cccatatgta ttaaaatgtc ctgtgtagag
     6541 ctgaatggta cagccacgac aaaggccacc actactgcaa ctacaacaat gactaccccc
     6601 tgtcagaatt gcagtacaga gcagatagaa ggagaaatgg cagaggaacc agcatccaac
     6661 tgcacttttg caattgcagg atatcaaaga gatgtaaaaa agaattatag catgacctgg
     6721 tatgatcagg agttagtctg caataataaa acaggaagtg aaaagggaag taaggattgt
     6781 tacatgatac attgtaatga ttcagtgata aaagaagctt gtgataaaac atattgggat
     6841 actttaagag taagatactg tgcaccagca gggtatgctt tgctaaaatg taatgataag
     6901 gattatagag gctttgctcc aaagtgcaag aatgtttcag tagtgcattg tactagatta
     6961 atcaatacta ctataactac agggatagga ttaaatggta gtagatcaga aaatagaaca
     7021 gagatatggc agaaaggagg aaatgataat gatacagtta taataaagtt gaataagttt
     7081 tacaacttga cagtgagatg ccgaagacct ggtaataaaa cagtgttgcc agtaacaatc
     7141 atggcagggt tagtatttca ctctcagaaa tataatacca ggttaaaaca agcgtggtgc
     7201 cacttccaag gagattggaa aggggcatgg aaagaagtca gagaagaagt aaagaaagtg
     7261 aaaaatctta cagaagtaag catagaaaat atacatctga gaaggatatg gggagatcca
     7321 gaatcagcga atttttggtt caattgtcaa ggtgaatttt tctattgtaa gatggactgg
     7381 tttatcaatt atctaaacaa tcgaacagaa gatgcagaag gtactaatag gacctgtgac
     7441 aaagggaagc caggaccagg accatgtgtt cagagaactt atgttgcctg ccatatacga
     7501 caagtagtaa atgattggta cactgtctct aaaaaggtat atgctccacc aagggaaggt
     7561 catttggagt gtaactcatc agtcacggca ctatacgtgg caatagatta taacaacaag
     7621 tctggcccaa taaatgtgac cctaagtcct caggtacgca gcatatgggc gtacgaactg
     7681 ggagactata aattagtaga gataacacca attggctttg ctcctacaga tgtaagaaga
     7741 tatactggcc ccacaagaga aaaaagggtg ccattcgtgc tagggtttct aggcttcttg
     7801 ggagctgctg gaactgcaat gggcgcagcg gcaacaacgc tgacagtcca gtctcggcat
     7861 ttgcttgctg ggatattgca gcagcagaag aacttgctgg cggctgtgga acagcaacaa
     7921 cagttgttga agctgaccat ttggggtgtg aaaaacctca atgcccgcgt cacagctctc
     7981 gagaagtacc tagaggatca ggcacggcta aattcatggg gatgtgcgtg gaaacaagta
     8041 tgtcacacca cagtgccatg gaagtataat aacactccta agtgggacaa tatgacttgg
     8101 ttggagtggg agagacaaat taatgccttg gaaggcaaca taactcaact attggaagaa
     8161 gcacaaaatc aggaatcaaa gaatctggat ctgtaccaga aattggatga ttggtcaggg
     8221 ttctggtcat ggttctcact gtcaacttgg ttaggctatg ttaaaatagg atttttagtg
     8281 atagtgatta ttctaggatt aagatttgca tgggtattat ggggatgtat cagaaatatt
     8341 aggcagggat ataatcctct cccccagatc catatccaca gttcagcgga acggccagac
     8401 aacggaggag ggcaagacag aggtggagaa agcagcagca gcaaattgat aagattgcag
     8461 gaagagtcct caacaccttc gaggatcaac aactggtggc tcaacttcaa gagctgcagc
     8521 ttgagaataa ggacttggtg ttacaacatc tgcctgaccc tcctcatatt catcaggaca
     8581 gcagtgggat acctgcagta tgggctccag caactccaag aggcagcaac agggcttgct
     8641 caagctctgg cgagggctgc gagggaagcc tggggcagac tgggtgctat tgtccgatcc
     8701 gcttatcggg cagtcatcaa cagtccaaga agagtgcggc aaggccttga aaaagtcctg
     8761 gggtaaaggt aaaatgactc cagacggccg ccgcctgcaa gaaggagaca cctttgatga
     8821 gtgggatgat gatgaagaag aagtaggctt ccctgtgcaa cctcgagtcc ccttaagaca
     8881 gatgacctat aaattagcag tggacttttc ccacttttta aaatcaaagg ggggactgga
     8941 tgggatatat tactctgaaa gaagagaaaa gatcctgaat ttgtatgcct tgaacgagtg
     9001 gggaataata gatgattggc aagcttactc accaggcccg gggataaggt acccgagagt
     9061 ctttggcttc tgctttaagc tagtcccagt ggacctgcat gaggaggcac gcaactgtga
     9121 gagacactgt ctgatgcatc cagcacagat gggggaagat cctgatggaa tagatcatgg
     9181 agaagtcttg gtctggaagt ttgacccgaa gttggcggtg gagtaccgcc cggacatgtt
     9241 taaggacatg cacgaacatg caaagcgcta gtgtcagcac tttgcggttg ggactttccg
     9301 ccagggactt tccacagtgg gtggatcgga ggcggtacag gggcggtact gggagtggct
     9361 ttcccctcag agctgcataa aagcagatgc tcgctggctt gtaactcagt ctcttactag
     9421 gagaccagct agagcctggg tgttcgctgg ttagcctaac ccggttggcc accgggggta
     9481 aggactcctt ggcttcatat agctcaataa acctgctcgc ttagtcgcta tattggagtc
     9541 aagtgctcat tgctgcgccg agcctctaga ggtgaacctc tcttactggg ttctcctgta
     9601 cccaggtggg agaaactcca gca
//
DBGET integrated database retrieval system