GenomeNet

Database: RefSeq
Entry: NC_001596
LinkDB: NC_001596
Original site: NC_001596 
LOCUS       NC_001596               7434 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Human papillomavirus type 9, complete genome.
ACCESSION   NC_001596
VERSION     NC_001596.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; E1 gene; E2 gene; E4 gene; E6 gene; E7 gene; early protein;
            L1 gene; L2 gene; late protein.
SOURCE      Human papillomavirus 9
  ORGANISM  Human papillomavirus 9
            Viruses; Monodnaviria; Shotokuvirae; Cossaviricota;
            Papovaviricetes; Zurhausenvirales; Papillomaviridae;
            Firstpapillomavirinae; Betapapillomavirus.
REFERENCE   1  (bases 1 to 7434)
  AUTHORS   Delius,H. and Hofmann,B.
  TITLE     Primer-directed sequencing of human papillomavirus types
  JOURNAL   Curr. Top. Microbiol. Immunol. 186, 13-31 (1994)
   PUBMED   8205838
REFERENCE   2  (bases 1 to 7434)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 7434)
  AUTHORS   Delius,H.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-1993) H. Delius, Deutsches
            Krebsforschungszentrum, Abteilung ATV, Im Neuenheimer Feld 506, W
            6900 Heidelberg, FRG
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to X74464.
            On or before Jan 7, 2011 this sequence version replaced
            NC_011279.1, NC_012746.1, NC_012748.1, NC_012750.1, NC_013586.1.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..7434
                     /organism="Human papillomavirus 9"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10621"
                     /clone="insert in BamHI site of pBR322"
     gene            200..646
                     /gene="E6"
                     /locus_tag="HpV9gp1"
                     /db_xref="GeneID:1489480"
     CDS             200..646
                     /gene="E6"
                     /locus_tag="HpV9gp1"
                     /note="alternative"
                     /codon_start=1
                     /product="early protein"
                     /protein_id="NP_041860.1"
                     /db_xref="GOA:P36801"
                     /db_xref="InterPro:IPR001334"
                     /db_xref="UniProtKB/Swiss-Prot:P36801"
                     /db_xref="GeneID:1489480"
                     /translation="MYLTEQIMDRPKPRTVKELADTLVIPLIDLLIPCKFCNRFLSYF
                     ELLNFDHKCLQLIWTEEDLVYGLCSSCAYASAQLEFTHFFQFAVVGKDIETVEGTAIG
                     NICIRCRYCFKLLDLVEKLATCYKFEQFYKVRNSWKGLCRHCGSVE"
     misc_feature    299..631
                     /gene="E6"
                     /locus_tag="HpV9gp1"
                     /note="Early Protein (E6); Region: E6; pfam00518"
                     /db_xref="CDD:278919"
     CDS             221..646
                     /gene="E6"
                     /locus_tag="HpV9gp1"
                     /codon_start=1
                     /product="early protein"
                     /protein_id="NP_041861.1"
                     /db_xref="GOA:P36801"
                     /db_xref="InterPro:IPR001334"
                     /db_xref="UniProtKB/Swiss-Prot:P36801"
                     /db_xref="GeneID:1489480"
                     /translation="MDRPKPRTVKELADTLVIPLIDLLIPCKFCNRFLSYFELLNFDH
                     KCLQLIWTEEDLVYGLCSSCAYASAQLEFTHFFQFAVVGKDIETVEGTAIGNICIRCR
                     YCFKLLDLVEKLATCYKFEQFYKVRNSWKGLCRHCGSVE"
     misc_feature    299..631
                     /gene="E6"
                     /locus_tag="HpV9gp1"
                     /note="Early Protein (E6); Region: E6; pfam00518"
                     /db_xref="CDD:278919"
     gene            643..924
                     /gene="E7"
                     /locus_tag="HpV9gp2"
                     /db_xref="GeneID:1489481"
     CDS             643..924
                     /gene="E7"
                     /locus_tag="HpV9gp2"
                     /codon_start=1
                     /product="early protein"
                     /protein_id="NP_041862.1"
                     /db_xref="GOA:P36817"
                     /db_xref="InterPro:IPR000148"
                     /db_xref="UniProtKB/Swiss-Prot:P36817"
                     /db_xref="GeneID:1489481"
                     /translation="MIGKEATIPEVVLELQELVQPTADLHCYEELTEEPAEEEQCLTP
                     YKIVAGCGCGARLRLYVLATNLGIRAQQELLLGDIQLVCPECRGRLRHE"
     misc_feature    649..900
                     /gene="E7"
                     /locus_tag="HpV9gp2"
                     /note="E7 protein, Early protein; Region: E7; cl02891"
                     /db_xref="CDD:295537"
     gene            917..2734
                     /gene="E1"
                     /locus_tag="HpV9gp3"
                     /db_xref="GeneID:1489478"
     CDS             917..2734
                     /gene="E1"
                     /locus_tag="HpV9gp3"
                     /codon_start=1
                     /product="early protein"
                     /protein_id="NP_041863.1"
                     /db_xref="GOA:Q05111"
                     /db_xref="InterPro:IPR001177"
                     /db_xref="InterPro:IPR014000"
                     /db_xref="InterPro:IPR014015"
                     /db_xref="InterPro:IPR016393"
                     /db_xref="UniProtKB/Swiss-Prot:Q05111"
                     /db_xref="GeneID:1489478"
                     /translation="MSDNKGTKLDPKECCSAWLSLEAECSDSSLDGDLEKLFDEGTDS
                     DISDLIDDGDAVQGNSRELFCQQESEESEQQTQLLKRKYISPQAVLQLSPQLESISLS
                     PQHKPKRRLFEQDSGLECSVNEAEDLSETQVEEVPANPPTTAQGTKGLGIVKDLLKHS
                     NVKAVLMAKFKEAFGVGFAELTRQYKSNKTCCRDWVIAVYAVNDDLIESSKQLLLQHC
                     AYIWLHYMPPMCLYLLCFNVGKSRETVCRLLSTLLQVSEVQLLSEPPKLRSVCAALFW
                     YKGSMNPNVYAHGAYPEWILTQTLINHQSANATQFDLSTMIQFAYDHEYFDEATIAYQ
                     YAKLAETDANARAFLQSNSQARLVKECATMVRHYMRGEMKEMSMSTWIHRKLLTVESN
                     GQWSDIVRFIRYQDINFIEFLTVFKAFLQNKPKQNCLLFHGPPDTGKSMFTMSLISVL
                     KGKVLSFANCKSTFWLQPIADTKLALIDDVTHVCWEYIDQYLRNGLDGNYVCLDMKHR
                     APCQMKFPPLMLTSNIDITKDQKYKYLHSRVKSFAFNNKFPLDANHKPQFELTDQSWK
                     SFFKRLWTQLDLSDQEDEGEDGNSQRTFQCTARDFNGPV"
     misc_feature    917..2731
                     /gene="E1"
                     /locus_tag="HpV9gp3"
                     /note="E1; Provisional; Region: PHA02774"
                     /db_xref="CDD:222927"
     misc_feature    917..1279
                     /gene="E1"
                     /locus_tag="HpV9gp3"
                     /note="E1 Protein, N terminal domain; Region: PPV_E1_N;
                     pfam00524"
                     /db_xref="CDD:278925"
     misc_feature    1421..2704
                     /gene="E1"
                     /locus_tag="HpV9gp3"
                     /note="Parvovirus non-structural protein NS1; Region:
                     Parvo_NS1; cl24009"
                     /db_xref="CDD:305166"
     gene            2676..4061
                     /gene="E2"
                     /locus_tag="HpV9gp4"
                     /db_xref="GeneID:1489479"
     CDS             2676..4061
                     /gene="E2"
                     /locus_tag="HpV9gp4"
                     /codon_start=1
                     /product="early protein"
                     /protein_id="NP_041864.1"
                     /db_xref="GOA:P36780"
                     /db_xref="InterPro:IPR000427"
                     /db_xref="InterPro:IPR001866"
                     /db_xref="InterPro:IPR009021"
                     /db_xref="InterPro:IPR012677"
                     /db_xref="UniProtKB/Swiss-Prot:P36780"
                     /db_xref="GeneID:1489479"
                     /translation="METLSARFNALQETLMDLYESGREDLQSQIDHWQTLRQEQILLH
                     YARKNGVMRLGYQPVPPLATSEQKAKDAIGMVLLLQSLQRSAYGQEPWTLAQTSLEAV
                     RSPPAYAFKKGPQNIEVVYDGDPDNVMSYTIWNFIYYQTVNDTWEKVQGHVDYFGAYY
                     FEGTVKTYYINFDKDAARYGRTGVWEVHVNKDIVFAPVTSSSPPTGDGGETSKHTLSR
                     SGSPTTSRLPATTVPTGGSRTSSRRYQRKASSPTTRKKRQRQGEGEGEGEGEETNYRR
                     QRSRSKGRTETERGGERRRRGRSSSADSTTPTDRRRGRGGGRGPTTRSQSRSRSRSHS
                     RSRSRGGTASRVGVSPDEVGTRVRSVGAGHHGRLARLLAEAKDPPLMLLRGDANVLKC
                     YRFRERKKKRGLVKYYSTTWSWVGEDSCDRVGRARMILAFDTYEHRQQFIRTMKLPPT
                     VDWSLGNVDDL"
     misc_feature    2676..3263
                     /gene="E2"
                     /locus_tag="HpV9gp4"
                     /note="E2 (early) protein, N terminal; Region: PPV_E2_N;
                     pfam00508"
                     /db_xref="CDD:278909"
     misc_feature    3810..4046
                     /gene="E2"
                     /locus_tag="HpV9gp4"
                     /note="E2 (early) protein, C terminal; Region: PPV_E2_C;
                     pfam00511"
                     /db_xref="CDD:278912"
     gene            4129..5730
                     /gene="L2"
                     /locus_tag="HpV9gp5"
                     /db_xref="GeneID:1489483"
     CDS             4129..5730
                     /gene="L2"
                     /locus_tag="HpV9gp5"
                     /codon_start=1
                     /product="late protein"
                     /protein_id="NP_041865.1"
                     /db_xref="GOA:P36746"
                     /db_xref="InterPro:IPR000784"
                     /db_xref="UniProtKB/Swiss-Prot:P36746"
                     /db_xref="GeneID:1489483"
                     /translation="MVRAKRTKRASVTDIYRGCKAAGTCPPDVINKVEHTTIADKILQ
                     YGSAGVFFGGLGISTGRGTGGATGYVPLGEGPGVRVGGTPTIVRPGVIPEIIGPTDLI
                     PLDTVRPIDPTAPSIVTGTDSTVDLLPGEIESIAEIHPVPVDNAVVDTPVVTEGRRGS
                     SAILEVADPSPPMRTRVARTQYHNPAFQIISESTPMSGESSLADHIIVFEGSGGQLVG
                     GPRESYTASSENIELQEFPSRYSFEIDEGTPPRTSTPVQRAVQSLSSLRRALYNRRLT
                     EQVAVTDPLFLSRPSRLVQFQFDNPAFEDEVTQIFERDLSTVEEPPDRQFLDVQRLSR
                     PLYTETPQGYVRVSRLGRRATIRTRSGAQVGAQVHFYRDLSTINTEEPIEMQLLGEHS
                     GDSTIVQGPVESSIVDVNIDEPDGLEVGRQETPSVEDVDFNSEDLLLDEGVEDFSGSQ
                     LVVGTRRSTNTLTVPRFETPRDTSFYIQDIQGYTVSYPESRQTTDIIFPHPDTPTVVI
                     HINDTSGDYYLHPSLQRKKRKRKYL"
     misc_feature    4129..5727
                     /gene="L2"
                     /locus_tag="HpV9gp5"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02777"
                     /db_xref="CDD:165142"
     misc_feature    4141..5718
                     /gene="L2"
                     /locus_tag="HpV9gp5"
                     /note="Late Protein L2; Region: Late_protein_L2;
                     pfam00513"
                     /db_xref="CDD:278914"
     gene            5745..7268
                     /gene="L1"
                     /locus_tag="HpV9gp6"
                     /db_xref="GeneID:1489482"
     CDS             5745..7268
                     /gene="L1"
                     /locus_tag="HpV9gp6"
                     /codon_start=1
                     /product="late protein"
                     /protein_id="NP_041866.1"
                     /db_xref="GOA:Q02480"
                     /db_xref="InterPro:IPR002210"
                     /db_xref="InterPro:IPR011222"
                     /db_xref="UniProtKB/Swiss-Prot:Q02480"
                     /db_xref="GeneID:1489482"
                     /translation="MSLWLPASGKVYLPPATPVARVQSTDEYVERTNIFYHAISDRLL
                     TVGHPYYDVRSGDGQRIEVPKVSGNQYRAFRISLPDPNRFALADMSVYNPDKERLVWA
                     CRGIEIGRGQPLGVGTSGHPLFNKVRDTENSSNYQGTTMDDRQNTSFDPKQVQMFIIG
                     CIPCLGEHWDKAKVCEKDANNQLGLCPPIELRNTVIEDGDMFDIGFGNINNKELSFNK
                     SDVSLDIVDETCKYPDFLTMANDVYGDACFFFARREQCYARHYYVRGGSVGDAVPDGA
                     VNQDHNFFLPAKSDQQQRTIANSTYYPTVSGSLVTSDAQLFNRPFWLQRAQGHNNGIL
                     WGNQIFVTVADNTRNTNFTISVSTEAAQTEEYNANNIREYLRHVEEYQISLILQLCKV
                     PLVAEVLSQINAMNSGILEDWQLGFVPTPENAVHDIYRYIDSKATKCPDAVEPTEKED
                     PFAKYSFWKVDLTERLSLDLDQYPLGRKFLFQAGLQTRKRPIKTSVKTSKNAKRRRT"
     misc_feature    5745..7265
                     /gene="L1"
                     /locus_tag="HpV9gp6"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02778"
                     /db_xref="CDD:222928"
ORIGIN      
        1 ccgcaggcaa ccgccaattt cactgccaag gttcgttggc agaccgtcct ggcttcaaaa
       61 cgaccgataa cggtaagtct tggcacgtag gtggttattt gatcgttggg atgattgtgg
      121 ttaacaacaa tctacataca cattttcata tgaccgcctt cgttaataag cttatataga
      181 cataaatata taaggtgcca tgtatttaac agagcagatt atggacaggc caaaacctag
      241 aacagtaaag gaactagcag acactcttgt gattccttta atagatttgt tgataccttg
      301 taaattttgc aatagatttt tatcttattt tgagctactt aattttgatc acaagtgttt
      361 acagcttatt tggacagagg aggatttggt gtatggactc tgtagtagct gtgcttatgc
      421 gtctgcacag ttagaattta cacatttttt tcaatttgct gtagttggaa aagatataga
      481 aactgtagaa ggaacagcta ttggaaatat ttgtattagg tgtcgctact gttttaagtt
      541 attagactta gtggagaagt tagctacatg ctataagttt gagcagtttt ataaggtcag
      601 aaacagctgg aaaggattgt gcagacactg tgggtcggta gaatgattgg gaaagaagct
      661 actataccag aggtggttct agaactgcaa gagcttgtcc aacccactgc tgacctgcat
      721 tgttacgaag aattgacaga agaacctgca gaggaggagc agtgtctcac tccctacaag
      781 atcgtagctg gctgtggttg cggtgcaaga cttcgtttat acgtgcttgc tacaaattta
      841 ggaattcgag cgcaacagga acttttgctg ggtgatatac aactggtgtg tccggagtgc
      901 cgaggcagac ttcgccatga gtgacaataa aggtactaaa ttagatccta aagaatgctg
      961 tagtgcttgg ttatcgttag aagcagaatg ctctgattct agtttagatg gtgatttgga
     1021 aaaattattt gacgaaggga cagactctga tatttcagac ctaatagatg atggagatgc
     1081 tgtacaggga aactcccgcg aactgttttg ccagcaagag agtgaggaaa gcgagcaaca
     1141 aacacaattg ctaaaacgaa agtatatcag tccccaagct gttttgcagc ttagccctca
     1201 actggagtct atctctttgt cgcctcagca taaacctaaa aggagattat ttgaacaaga
     1261 cagcggacta gaatgttctg taaatgaagc tgaagatctt tctgaaacac aggtggaaga
     1321 ggtaccggcc aatccaccaa caacagctca gggaactaag ggcttgggaa ttgttaaaga
     1381 tttacttaaa catagcaatg tgaaagctgt attaatggct aagtttaaag aggcgtttgg
     1441 tgtggggttt gctgagctaa caagacaata taaaagtaac aaaacatgct gtagagattg
     1501 ggtaattgct gtgtatgctg tgaatgatga cttaattgaa agctctaaac aattgttatt
     1561 gcagcattgt gcttatattt ggctacatta tatgccacca atgtgtttat atttattatg
     1621 ttttaacgta ggcaaaagta gagaaactgt atgtagacta ttaagcactt tgctgcaagt
     1681 atctgaagtg caattattaa gtgagcctcc aaagttgcga agtgtgtgtg ctgcattatt
     1741 ttggtataaa ggaagtatga accctaatgt atacgcacat ggtgcgtatc ctgaatggat
     1801 acttacacaa acactaatta atcaccaatc tgcaaatgct acacaatttg acttatcgac
     1861 aatgatacaa tttgcctatg atcatgaata ttttgatgaa gctaccattg catatcaata
     1921 tgcaaagctg gctgaaacag atgctaatgc cagggctttt ttacaaagta acagtcaagc
     1981 cagactagta aaagaatgtg caaccatggt gagacattac atgaggggag agatgaaaga
     2041 aatgagtatg tccacatgga tacatagaaa actgcttaca gtggaaagca atgggcaatg
     2101 gtcagatata gtacggttta ttagatacca ggatattaat tttattgaat ttctaacagt
     2161 atttaaagca tttctgcaaa acaaaccaaa gcaaaactgt ttattatttc atggaccacc
     2221 tgacacggga aaatcaatgt ttacaatgtc actaatatct gtgttaaaag gaaaggtact
     2281 gtcatttgcc aattgcaaaa gtactttttg gctacaacct atagctgata ctaaacttgc
     2341 tttaattgat gatgtaacac atgtgtgttg ggaatatata gatcagtact taaggaatgg
     2401 attggatggc aattatgtat gtttagatat gaaacataga gcaccttgtc aaatgaaatt
     2461 tccacccctt atgttaacgt ctaacataga tattactaaa gaccaaaagt acaaatattt
     2521 gcacagcaga gttaaatcct ttgctttcaa taacaaattt ccacttgatg ctaatcacaa
     2581 accacaattt gaacttactg accaaagctg gaaatctttt tttaaaaggc tttggacaca
     2641 gttagatctg agtgatcaag aagacgaggg agaggatgga aactctcagc gcacgtttca
     2701 atgcactgca agagacttta atggacctgt atgaatcagg tcgagaggat ctacaaagtc
     2761 agattgacca ctggcagact ttaagacaag agcaaatact tttgcattat gccaggaaaa
     2821 atggagttat gcgattgggg taccaacctg tacctccgtt ggctaccagt gaacagaaag
     2881 ctaaagatgc tattggcatg gttttactat tgcaaagcct tcaaagatca gcttatggac
     2941 aggaaccttg gacactggca caaactagtc ttgaggcggt acgcagtcca cctgcatatg
     3001 cctttaaaaa gggtccacaa aatattgaag tagtttatga tggagatcct gataatgtta
     3061 tgagctatac tatatggaac tttatatatt atcagactgt taatgatact tgggaaaaag
     3121 ttcaaggtca cgtggattat tttggagcct attactttga agggactgta aaaacatatt
     3181 atattaactt tgacaaagat gcagccaggt atggcagaac tggcgtttgg gaagtgcatg
     3241 ttaacaagga cattgtgttt gcccctgtta ctagctcttc gccaccaact ggagacgggg
     3301 gagagacctc caagcacacc ctttccaggt cggggtcgcc aacaacatcg cgactccctg
     3361 ccaccaccgt gcccaccgga ggatccagga catcatcccg acgataccaa cgaaaagcct
     3421 ctagccccac caccaggaag aaaagacaga gacaaggaga aggagaagga gaaggagaag
     3481 gagaagaaac caactacagg agacaaaggt ccagatccaa gggtcgaaca gaaaccgaaa
     3541 ggggagggga gcgacggaga cgaggaaggt cctcctccgc agactccact acccccaccg
     3601 acaggcgaag gggaagggga ggtggaaggg ggcccacgac caggtcccag tcccgttccc
     3661 gttcccgctc ccactcccgg tcgcggtccc gaggagggac tgcttccagg gttggcgtct
     3721 cgcctgatga agtgggaaca cgagttcgat cagttggtgc aggacatcac gggagacttg
     3781 cacgattact ggctgaggct aaagaccccc cattaatgct gttgcgtggc gacgccaatg
     3841 tgcttaagtg ctatcgcttt cgggaacgca aaaaaaaaag aggcttagta aaatattata
     3901 gtactacgtg gtcatgggta ggggaagaca gttgtgatag agttggaaga gcgcgaatga
     3961 ttttagcctt tgacacatat gagcacagac aacaattcat taggactatg aaattaccac
     4021 ctacagtaga ttggtcttta ggaaatgttg atgatctgta agctttacta acgctaacgc
     4081 tggcattgct actaacccat actaactaac aaacccatac taactaacat ggttcgtgca
     4141 aaacgtacta aacgtgcctc tgttacagat atatacagag gctgcaaagc tgctggtaca
     4201 tgtccaccag atgtaattaa taaagtggag cacacaacta ttgctgataa aattttgcaa
     4261 tatggaagtg ctggtgtgtt tttcgggggc ttgggaataa gtacaggccg tggcactggt
     4321 ggtgccactg gctatgttcc attaggggaa gggccaggag tccgtgtagg tggcaccccc
     4381 actatagttc gccctggggt gatacctgaa ataattggcc caactgatct aattccttta
     4441 gacacagtca gaccaattga ccccacagca cccagtattg tcacaggcac tgacagcact
     4501 gttgaccttt tacctggtga aatagaatca attgctgaga tacacccagt accagtggac
     4561 aatgctgtag tagatactcc agttgtaaca gaaggtagaa gaggctcgtc tgccatttta
     4621 gaggtggctg acccaagccc tcctatgcga acccgtgttg cacgaactca ataccataat
     4681 ccagcttttc aaattatttc tgagtctaca cctatgtcag gtgaatcttc cttagcagat
     4741 catattatag tttttgaagg atctgggggc cagctagtag gtggtcctag ggaatcatac
     4801 acagcatctt ctgaaaacat agaattacaa gaatttccta gtagatatag ttttgaaata
     4861 gatgaaggaa cacctcctcg gactagtaca cctgtccaaa gagcagtaca atcattatct
     4921 agtctgcgta gagctctata taacagacgt cttacagaac aagtggctgt gacagatcca
     4981 ttatttttaa gtaggccttc tcgtttagtt caatttcagt ttgataatcc agcatttgaa
     5041 gatgaggtca cacaaatatt tgaaagagat ctaagtactg ttgaggagcc tccagatagg
     5101 caatttttag atgtacaacg ccttagtagg cctttatata cagaaacacc tcagggatat
     5161 gttcgggtta gtagactagg ccgaagagca acaatccgca cacgtagtgg tgcacaggtg
     5221 ggcgcacagg ttcatttcta cagggactta agcaccatta acacagaaga acctatagaa
     5281 atgcaattat tgggggaaca ctcaggtgac agtaccatag tacaaggccc agttgaaagt
     5341 tcaattgttg atgttaatat tgatgaacct gatggtttgg aggtgggaag acaggaaacc
     5401 ccttctgttg aagatgtgga ttttaattct gaagacttac tgttagatga gggtgtagaa
     5461 gattttagtg ggtctcagct agtcgttggc acacgccgca gtacaaatac attaacagtg
     5521 ccacgctttg aaactccaag ggacactagt ttttatattc aggatataca aggctacaca
     5581 gtgtcctatc ccgagtctag acaaaccaca gatataattt ttccacatcc tgacaccccc
     5641 acagtagtaa tccacatcaa tgatacatca ggagattatt atttacaccc aagtctccaa
     5701 aggaaaaaac gcaaacgcaa atatttataa ttttgttttt gcagatgtca ttgtggcttc
     5761 cagcaagtgg taaggtatat ttgccaccag caacaccagt ggcgagagtt caaagcaccg
     5821 atgaatatgt ggaaagaaca aatatttttt atcatgcaat tagtgaccgt ttgctaacag
     5881 tgggtcatcc atattatgat gtccgctcag gcgacggaca aaggattgaa gtccctaaag
     5941 tgtctggtaa tcagtatcgg gcctttagaa ttagcttacc tgatccaaat aggtttgctt
     6001 tagcagatat gtcagtttat aatcctgata aggaacgtct agtttgggcc tgtagaggta
     6061 ttgaaatagg cagaggacaa cctttagggg ttggaacatc aggtcaccca ttatttaata
     6121 aggttagaga cacagaaaac tctagcaatt atcaaggcac aacaatggat gacaggcaaa
     6181 acacatcttt tgaccccaaa caggtacaaa tgttcattat aggatgtatt ccatgcttag
     6241 gagaacactg ggataaagcc aaagtgtgtg aaaaggatgc taataatcaa ctaggcttat
     6301 gtcctcctat agaattaaga aacacagtaa ttgaggatgg ggacatgttt gatattggat
     6361 ttggaaatat caacaataag gaactgtcct ttaataagtc tgatgtaagc ttagatattg
     6421 ttgatgaaac ctgcaaatat ccagactttc taacaatggc aaatgatgtt tatggagatg
     6481 catgtttctt ttttgcaaga agagaacaat gttatgccag gcattattat gttagaggag
     6541 gttcagttgg tgacgctgtt cctgatggtg cagtaaacca ggatcataat ttctttttgc
     6601 cagcaaaaag tgatcaacaa caacgaacaa tagctaattc cacctactat cctacagtaa
     6661 gtgggtcatt agtaacttca gatgctcaat tgtttaatag gccattttgg ctccaaagag
     6721 cacaaggtca caacaatggc attttatggg gtaatcagat atttgttaca gtggcagaca
     6781 atacacgtaa caccaatttt accattagtg tgtctacaga ggcagctcaa acagaagaat
     6841 ataatgccaa taatattaga gaatatttaa gacatgttga agaatatcag atttcattaa
     6901 tcttacagtt gtgtaaagtg cctttagtag ctgaagtatt atcccagata aatgcaatga
     6961 actcaggtat tttagaggat tggcaattag ggtttgttcc aactcctgaa aatgctgttc
     7021 atgatatcta cagatatatt gattcaaaag ccacaaaatg cccagatgct gttgagccta
     7081 cagaaaaaga agatcccttt gccaaatact cattttggaa agtggatcta actgaaagat
     7141 tatcgttgga tcttgatcaa tatcctttag gtagaaaatt tctttttcaa gctggtttgc
     7201 aaacacgaaa acgtcctatt aaaacatctg ttaaaacatc taaaaatgct aagagaaggc
     7261 gaacctaacc gatatcggtt tccaataaaa tttaagttat ccaatttggt atgtgaagca
     7321 ttttttaacc atcttcgtga ctaaaccgta caagtcaaca cagagcgacc gcacccggtt
     7381 tatctgatta taaagtgcac ctggtgcaat ttgaacaata ctatcgtgga atca
//
DBGET integrated database retrieval system