GenomeNet

Database: RefSeq
Entry: NC_001678
LinkDB: NC_001678
Original site: NC_001678 
LOCUS       NC_001678               8028 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Rhesus monkey papillomavirus, complete genome.
ACCESSION   NC_001678 NC_012640 NC_012652 NC_012653
VERSION     NC_001678.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Alphapapillomavirus 12
  ORGANISM  Alphapapillomavirus 12
            Viruses; Monodnaviria; Shotokuvirae; Cossaviricota;
            Papovaviricetes; Zurhausenvirales; Papillomaviridae;
            Firstpapillomavirinae; Alphapapillomavirus.
REFERENCE   1  (bases 1 to 8028)
  AUTHORS   Ostrow,R.S., Liu,Z., Schneider,J.F., McGlennen,R.C., Forslund,K.
            and Faras,A.J.
  TITLE     The products of the E5, E6, or E7 open reading frames of RhPV 1 can
            individually transform NIH 3T3 cells or in cotransfections with
            activated ras can transform primary rodent epithelial cells
  JOURNAL   Virology 196 (2), 861-867 (1993)
   PUBMED   8396814
REFERENCE   2  (bases 1 to 8028)
  AUTHORS   Ostrow,R.S., LaBresh,K.V. and Faras,A.J.
  TITLE     Characterization of the complete RhPV 1 genomic sequence and an
            integration locus from a metastatic tumor
  JOURNAL   Virology 181 (1), 424-429 (1991)
   PUBMED   1847267
REFERENCE   3  (bases 1 to 8028)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 8028)
  AUTHORS   Ostrow,R.S.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-FEB-1991) Ronald S. Ostrow, Inst. of Human Genetics,
            University of Minnesota, Minneapolis, MN 55455, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from M60184.
            On or before Jan 7, 2011 this sequence version replaced
            NC_012640.1, NC_012652.1, NC_012653.1.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..8028
                     /organism="Alphapapillomavirus 12"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10570"
     gene            22..597
                     /gene="E6"
                     /locus_tag="RmpVgp1"
                     /db_xref="GeneID:1489006"
     CDS             22..597
                     /gene="E6"
                     /locus_tag="RmpVgp1"
                     /codon_start=1
                     /product="E6 protein"
                     /protein_id="NP_043331.1"
                     /db_xref="GeneID:1489006"
                     /translation="MKKGVTENGATESGAYKKLLKLWFFVAMVDCPGEPNELPRTIHE
                     LCEQREETLHELQLECVYCLKELTRIEVYDFARWDLRLVHRQGKPYGVCPICLRFYSK
                     IRKYRRYEYSIYGCTLERRTRKQLVEVLIRCYCCQKPLCPIEKQRHVDQGQRFHRIAG
                     QWTGRCLMCWRPTVPETQPDTDQQGSSFLQA"
     misc_feature    139..558
                     /gene="E6"
                     /locus_tag="RmpVgp1"
                     /note="E6 protein; Provisional; Region: PHA02779"
                     /db_xref="CDD:222929"
     gene            594..935
                     /gene="E7"
                     /locus_tag="RmpVgp2"
                     /db_xref="GeneID:1489007"
     CDS             594..935
                     /gene="E7"
                     /locus_tag="RmpVgp2"
                     /codon_start=1
                     /product="E7 protein"
                     /protein_id="NP_043332.1"
                     /db_xref="GeneID:1489007"
                     /translation="MIGPKPTLEDIVLDLQPFPQPQPVDLMCYEQLSDSSEDEDEVDH
                     HHNNQQQHHQHARPEVPEDGDCYRIVSDCYSCGKPLRLVVVSSHEELRVLEDLLMGTL
                     DIVCPSCASRV"
     misc_feature    600..920
                     /gene="E7"
                     /locus_tag="RmpVgp2"
                     /note="E7 protein, Early protein; Region: E7; pfam00527"
                     /db_xref="CDD:278928"
     gene            941..2818
                     /gene="E1"
                     /locus_tag="RmpVgp3"
                     /db_xref="GeneID:1489008"
     CDS             941..2818
                     /gene="E1"
                     /locus_tag="RmpVgp3"
                     /codon_start=1
                     /product="E1 protein"
                     /protein_id="NP_043333.1"
                     /db_xref="GeneID:1489008"
                     /translation="MDPEGTPGEGVGCTGWFNVEAIVERKTGDVVSEDEDDTEDTGID
                     LVDFIDDTCGSVQTGDEAPGALLHAQETQAHAEAVQVLKRKFVGSPAVSPLGNYNPCV
                     DRDLSPRLNEISLNQGSGQAKRRLFLPDSGYGNTEVETSLLQVAGGGGQDVQAGGKEN
                     TRPDDGGGDATQLLRCSNLKATLLSKFKSVYGVSFSELVRSFKSDRTTCADWVVGAAG
                     VHHSVAEGLKQLIQPFCSYAHIQCLTCDWGVYLLLLARFKCGKNRLTVSKCMSTLLNV
                     QETHMLIEPPKLRSAAAALYWYRTGISNVSEVIGETPEWITRQTMFQHGLEDSIFDLS
                     EMVQWAYDHDFTDDSVIAYEYAQLAGIDSNAAAFLKSNAQAKYVKDCATMCRHYKRAE
                     RQQMTMSQWIKQRCEKTDDGGDWRPIVQFLRYQGVEFIAFLAALKLFLKGIPKKNCIV
                     LFGPPNTGKSYFGMSLIHFLQGSIISYVNSNSHFWLQPLADAKVAMLDDATPQCWSYI
                     DNYLRNALDGNPISVDRKHKNLVQMKCPPLLITSNTNAGQDDRWMYLHSRMVVFTFEQ
                     PFPFDQNGNPVYELNDKNWKSFFSRTWSRLDLQEEEETENDGSTCRAFKCVAGQNLRT
                     V"
     misc_feature    941..2815
                     /gene="E1"
                     /locus_tag="RmpVgp3"
                     /note="E1; Provisional; Region: PHA02774"
                     /db_xref="CDD:222927"
     misc_feature    944..1351
                     /gene="E1"
                     /locus_tag="RmpVgp3"
                     /note="E1 Protein, N terminal domain; Region: PPV_E1_N;
                     pfam00524"
                     /db_xref="CDD:278925"
     misc_feature    1496..2788
                     /gene="E1"
                     /locus_tag="RmpVgp3"
                     /note="Papillomavirus helicase; Region: PPV_E1_C;
                     pfam00519"
                     /db_xref="CDD:278920"
     gene            2757..3857
                     /gene="E2"
                     /locus_tag="RmpVgp4"
                     /db_xref="GeneID:1489009"
     CDS             2757..3857
                     /gene="E2"
                     /locus_tag="RmpVgp4"
                     /codon_start=1
                     /product="E2 protein"
                     /protein_id="NP_043334.1"
                     /db_xref="GeneID:1489009"
                     /translation="MMEALAERLSALQDRILELYEADSKDLKDQIEHWKCVRQECAVL
                     YKAREVGFSHLNHQVVPSLTVSRAKAHKAIEVQLALESLQNSEYNNEEWTLQDASLEM
                     WHTEPKGCFKKTGVPVTVLFDCDKDNTMEYVLWGHIYVWGDNGWVKTFGEADNWGLHY
                     TVAGEKVYYVQFYEDAKKYGHGNGNGDGYEWEVHVGGTVMHYSDSVSSATHCDKLPTV
                     EIVSGLQHINPSPPPANPSAKENVWSSPAKRVRRSDSGGDPVRALDGKSRSVLCGSAH
                     NNATGSSGDSDYTPIVHLKGESNCLKCLRFRLGKHKHLYINISSTWRWANHASEKAIV
                     TVTFANELQRQQFLNTVKIPSTVTLSQGVMTV"
     misc_feature    2760..3359
                     /gene="E2"
                     /locus_tag="RmpVgp4"
                     /note="E2 (early) protein, N terminal; Region: PPV_E2_N;
                     pfam00508"
                     /db_xref="CDD:278909"
     misc_feature    3624..3848
                     /gene="E2"
                     /locus_tag="RmpVgp4"
                     /note="E2 (early) protein, C terminal; Region: PPV_E2_C;
                     pfam00511"
                     /db_xref="CDD:278912"
     gene            4167..4295
                     /gene="E5a"
                     /locus_tag="RmpVgp5"
                     /db_xref="GeneID:1489010"
     CDS             4167..4295
                     /gene="E5a"
                     /locus_tag="RmpVgp5"
                     /note="ORF is thought to begin at nucleotide position
                     4044; first methionine codon is found at nucleotide
                     position 4167."
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_043335.1"
                     /db_xref="GeneID:1489010"
                     /translation="MLLFWVSIVNPFAAFGLCLFCFLTPLLLIHLHALSVVYSRMM"
     gene            4311..4445
                     /gene="E5b"
                     /locus_tag="RmpVgp6"
                     /db_xref="GeneID:1489011"
     CDS             4311..4445
                     /gene="E5b"
                     /locus_tag="RmpVgp6"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_043336.1"
                     /db_xref="GeneID:1489011"
                     /translation="MLLSVILLLLLLIFTLFWHYLLVLRLKPPAGRARKCKQLRRRRR
                     "
     gene            4469..5869
                     /gene="L2"
                     /locus_tag="RmpVgp7"
                     /db_xref="GeneID:1489012"
     CDS             4469..5869
                     /gene="L2"
                     /locus_tag="RmpVgp7"
                     /codon_start=1
                     /product="L2 protein"
                     /protein_id="NP_043337.1"
                     /db_xref="GeneID:1489012"
                     /translation="MKHAHLSRRKRAAPRPPGGRQKRASATQLYQTCKAAGTCPPDVI
                     PKVEGTTVADQILKYGSMGVYFGGLGIGSGAGTGGRSGYVPLGSRPASIPEPLPRPPV
                     TIEPVGPSDPSIVSLLEESRLIEAGVPAPTFPTHGGFEISTSEVSTPAVLDVSSGGSD
                     VHVSVTSFTNPTFTEPSVLRPPPPVEASGRLVISASSVSTHSYEEIPMDTFVITGDHN
                     YNTTSTPIPGSRAPARLGLYGRATQQVRVVDPAFITTPARLVTYDNPAYEGVDDATLQ
                     FSHSDIHQPPDPDFLDIVALHRPALTSRKGTVRFSRLGQRATLTTRSGKRIGAKVHFY
                     HDLSPIAPAESIELQPLSSQGELYDIYADVDGQEDAAAVANTPLNSNSSGIASPWNTT
                     VPLSAGADVTLQSGPDVSLDAPVAESPVHPGVPLRPSAHIILYGGDFYLHPSYLGIRR
                     KRKRMHNFFSDVYVAA"
     misc_feature    4526..5830
                     /gene="L2"
                     /locus_tag="RmpVgp7"
                     /note="Late Protein L2; Region: Late_protein_L2;
                     pfam00513"
                     /db_xref="CDD:278914"
     misc_feature    4526..5830
                     /gene="L2"
                     /locus_tag="RmpVgp7"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02777"
                     /db_xref="CDD:165142"
     gene            5850..7355
                     /gene="L1"
                     /locus_tag="RmpVgp8"
                     /db_xref="GeneID:1489013"
     CDS             5850..7355
                     /gene="L1"
                     /locus_tag="RmpVgp8"
                     /note="ORF is thought to begin at nucleotide position
                     5748; first methionine codon is found at nucleotide
                     position 5850."
                     /codon_start=1
                     /product="L1 protein"
                     /protein_id="NP_043338.1"
                     /db_xref="GeneID:1489013"
                     /translation="MSMWRPSDSKVYLPPVPVSKVVSTDEYVSRTSIYYHAGSSRLLA
                     VGHPYYAVKKGNNKVSVPKVSGLQYRVFRVRLPDPNKFGLPDANFYDPNTQRLVWACL
                     GVEVGRGQPLGVGTSGHPLLNKLDDTENGPKVAGGQGADNRECVSMDYKQTQLCMLGC
                     KPPVGEHWGKGNPCTTGAAGDCPALELVNSVIQDGDMVDTGYGAMDFNALQANKSDVP
                     IDICTSVCKYPDYLKMASDPYGDSLFFYLRREQMFVRHLFNRAGTMGDSVPDDLYIKG
                     SGSNVKLASHVFYPTPSGSMVTSDAQLFNKPYWLQKAQGHNNGICWGNQVFLTVVDTT
                     RSTNMTLCASTASTVTTPYNNESFKEYLRHVEEFDLQFIFQLCKVTLNTEVMAYIHSM
                     DASILEDWNFGLQPPPSGSLQDTYRFVTSAAITCQKPAPPKEKEDPLAKYTFWEVDLK
                     EKFSADLDQFPLGRKFLLQAGMRARPTLRAPKRTASSTSSSSPRKRKRTKR"
     misc_feature    5850..7352
                     /gene="L1"
                     /locus_tag="RmpVgp8"
                     /note="major capsid L1 protein; Provisional; Region:
                     PHA02778"
                     /db_xref="CDD:222928"
ORIGIN      
        1 tacttaacta tactcctgag tatgaaaaag ggtgtaaccg aaaacggtgc aaccgaaagc
       61 ggtgcatata aaaagctcct gaaactttgg ttttttgtgg caatggtaga ctgccctggc
      121 gagccaaacg aattgcccag gaccattcac gaactatgcg agcagcgtga ggagaccctg
      181 cacgagcttc aattggagtg cgtgtattgc ctgaaggaac taacacgcat tgaggtatat
      241 gattttgcac ggtgggattt aagattggtg catagacaag gcaagccata cggggtatgt
      301 cccatatgct tgaggtttta ctcaaaaatt cgaaaatata ggcgatacga gtattcaata
      361 tatgggtgta ctttagagcg tagaactaga aaacagttag tggaggtatt aataaggtgt
      421 tattgttgtc agaagcccct gtgtcccatt gaaaagcaaa gacacgtgga ccaaggacaa
      481 aggttccaca gaatagcggg acagtggacc ggaaggtgct tgatgtgctg gagaccaaca
      541 gtacctgaga cccagccaga cactgatcaa cagggcagta gtttcttgca agcatgattg
      601 ggcctaaacc taccctcgag gacattgtcc tagatttgca accatttcca caaccgcaac
      661 cggtcgacct tatgtgttat gagcaattat ctgacagctc agaggatgag gatgaagtag
      721 accatcatca caataatcag cagcagcatc atcagcacgc cagacctgaa gtaccagagg
      781 atggtgattg ttatagaatt gtgagcgatt gttacagctg tggcaagcca ctgaggctgg
      841 ttgtggttag tagccacgaa gagttacgtg tgctagagga cctgctgatg ggcacgcttg
      901 acattgtgtg tcccagctgt gccagcagag tgtaactgca atggaccctg aaggtacacc
      961 aggggaaggg gtggggtgta cggggtggtt taatgtggag gctatagtag aacgtaaaac
     1021 gggggatgtg gtgtcagagg acgaagacga cacagaggat acagggatag atttggtaga
     1081 ctttatagat gacacatgtg gaagtgtgca gacaggggac gaggcacctg gggcgttgtt
     1141 gcacgcacag gaaacacaag cgcatgcaga ggcagtgcag gttttaaaac gaaagtttgt
     1201 aggcagtccg gcagttagtc cgttgggaaa ctacaatccc tgtgtagaca gggatttaag
     1261 tcccagatta aatgaaataa gtttaaacca aggcagcgga caggcaaaac ggagactgtt
     1321 tttgccggac agcggttatg gcaatactga agtggaaacg tcgctattgc aggtagcagg
     1381 ggggggcggc caggatgtac aggcaggggg gaaggaaaac acacggccag atgacggggg
     1441 gggggatgcc acgcagctgc tccgttgcag caacttaaaa gccactttgc tgagtaaatt
     1501 taaatctgtg tatggagtta gcttttcaga gttggtgcga agctttaaaa gcgacaggac
     1561 cacgtgcgct gactgggtgg tgggggcagc gggggtccat catagcgtgg cagaggggtt
     1621 aaagcagctc attcagcctt tttgcagtta tgcacacatc cagtgcctta catgcgactg
     1681 gggggtgtac ctgctactgc tggcacggtt taagtgtggc aaaaacagac taacagtttc
     1741 taaatgcatg agcacgctgt taaatgtgca agaaacgcac atgctaattg aaccaccgaa
     1801 gctgcgtagc gcagcagcag ctctatactg gtacaggaca ggtatatcaa atgtaagtga
     1861 agtaataggg gaaacacctg agtggattac aagacagaca atgtttcaac atggcctgga
     1921 ggacagtata tttgatttgt ctgaaatggt gcagtgggca tacgaccacg actttacaga
     1981 tgacagtgtg atagcgtacg agtatgcaca gctggcaggg atagacagca acgctgctgc
     2041 atttttaaaa agtaatgcac aggccaaata tgtgaaggat tgtgccacta tgtgtaggca
     2101 ctacaaaaga gccgaaaggc aacagatgac tatgtcacag tggataaaac aaaggtgtga
     2161 aaaaactgat gatggagggg actggaggcc aatagtgcag tttttaaggt accaaggggt
     2221 ggagtttata gcatttttag cagctttaaa gctgtttttg aagggcattc caaaaaaaaa
     2281 ctgcatagtg ttatttggac cgccaaatac aggtaaatcc tactttggca tgagcttaat
     2341 acatttcttg caagggtcta tcatttcata tgtaaattcc aacagtcact tttggttgca
     2401 gcctctggca gatgctaagg tggccatgtt ggatgatgca actcctcagt gctggtccta
     2461 tatagataat tatttaagga acgcactgga cgggaacccc attagtgttg atagaaaaca
     2521 taaaaatctt gtacagatga agtgcccccc attgcttatt acctcaaaca ccaatgcagg
     2581 tcaggatgac aggtggatgt atttgcacag tagaatggtt gtgtttacat ttgaacagcc
     2641 atttccattt gatcagaacg gtaatccagt ttatgagtta aatgataaaa actggaaatc
     2701 ctttttctca aggacatggt ccagattaga tttacaagag gaagaggaga cggaaaatga
     2761 tggaagcact tgcagagcgt ttaagtgcgt tgcaggacag aatcttagaa ctgtatgaag
     2821 ctgatagcaa ggacttaaaa gaccaaatag agcactggaa atgtgtgcgc caagaatgtg
     2881 cagtgttgta taaggcacgg gaagtagggt tttcccacct gaaccatcag gtggtgccat
     2941 cattaactgt gtcacgggct aaagcccaca aagcaattga agtgcagctg gcattagaga
     3001 gtttacaaaa ttcggagtat aacaatgagg agtggacgct gcaagatgcc agcttggaga
     3061 tgtggcacac agaacctaag ggatgcttca aaaaaacagg tgttccagta acagttttgt
     3121 ttgactgtga caaagacaat accatggagt atgtgctgtg gggacacata tatgtgtggg
     3181 gggacaatgg atgggtgaag acattcggtg aggcggacaa ctggggtctg cactataccg
     3241 ttgctgggga aaaggtgtac tatgtgcagt tttatgagga tgctaaaaaa tatggacatg
     3301 gaaatggaaa tggagatggc tatgagtggg aggtgcatgt tggtgggacg gtaatgcatt
     3361 attctgactc tgtgtctagc gctacccact gcgacaaact acccactgtt gaaattgtta
     3421 gcggactgca acacatcaac ccatcacccc cccccgccaa ccccagcgcc aaggaaaacg
     3481 tgtggtcatc gcctgcaaag cgagtgcgtc ggtcagactc aggtggagat ccagtgcggg
     3541 ccttggacgg taaaagccgg tcagtccttt gtggatctgc acacaacaac gctacaggga
     3601 gttccggtga cagtgactat acgcctatag tgcacctaaa aggtgaatct aactgtttga
     3661 agtgtttgcg gttcagactg ggaaagcata agcacctgta tattaatata tcgtccacct
     3721 ggaggtgggc aaaccatgca agtgagaaag caattgtaac tgtgacattt gcaaatgagc
     3781 ttcaaagaca acagttttta aacactgtaa aaataccttc tactgtaact ctgtcacaag
     3841 gagtaatgac tgtgtagtgt gcattggcac acagggtttt gtattttttt ttttacaagt
     3901 actgtttgta attaattttg tatattgact gtatattgaa ttgtggtgtg cattggcaca
     3961 cagtggtctc atttcaagcc tgtacataca ttgaacagta tccaggtact gtgtaaagcc
     4021 aattgttgct gctacgcttg taaaccgcca ccattctgct gtttctggtt gtgtttttgc
     4081 tgctgttttt gcttggcctt gtgttttgtg cacttgttga gtcgctgctt ctgtgttttt
     4141 ccgtgtatgc ctcagtgttg ctgcttatgc tgttgttctg ggtgtccata gtgaacccgt
     4201 ttgcagcttt tggtctgtgt ttgttttgtt ttttaacccc gttgcttttg atacacctgc
     4261 atgccctcag tgtggtttac agcagaatga tgtaaatact gcacatagac atgttattat
     4321 cagttatttt gctattgttg ctgttaatat ttactttgtt ttggcactac ttgttggtgc
     4381 tgcgtttaaa gccaccagca gggcgcgcac gtaaatgtaa acagctgaga cggcggcgca
     4441 gataataaac gtcacacaat aaagcgtcat gaagcatgca cacttgtcgc ggcgcaagcg
     4501 agcagccccg cgcccacctg gtgggcggca aaagcgtgca tctgccacgc agctgtacca
     4561 aacctgcaag gcggcaggca catgcccccc cgatgttatc cctaaggtgg aaggcacaac
     4621 cgtagcagat caaattttaa agtatggcag catgggtgta tactttgggg gtttgggcat
     4681 tggctctggt gctggcacgg gcggaagaag cggctacgtg cccctaggtt cacgtcccgc
     4741 atccattccc gagccgttgc cacgaccacc agtaacaatt gagcctgtgg gcccttccga
     4801 tccctccatt gtgtcattgc tggaagagtc cagactaata gaggcaggtg ttccagcccc
     4861 cacattcccc actcatgggg ggtttgaaat tagcacatct gaagttagca cacccgctgt
     4921 cctggatgtg tctagcggtg gctctgatgt gcacgttagt gtgacctcct ttacaaaccc
     4981 tacctttact gagccatctg tgctgcgacc cccgcccccc gtagaggcgt ctggacgcct
     5041 ggtaatctct gcatcctctg tcagcacgca tagctacgaa gaaataccca tggacacatt
     5101 tgtaataact ggagaccaca actataacac aaccagcaca cccattcctg gttcacgtgc
     5161 ccctgcacga cttggtctat atggacgtgc tacccagcaa gtgcgggtgg tggatcctgc
     5221 atttataacc acccctgcgc gactggtgac atatgacaac cctgcatatg agggtgtgga
     5281 cgatgccacc ctgcaatttt cccactctga cattcaccag ccgccagatc ctgacttcct
     5341 tgacattgtg gcattgcaca ggcccgcctt gacctcacgt aagggcaccg tgcgctttag
     5401 ccgattaggc cagcgggcaa cactaaccac gcgcagtggt aagcgtattg gggccaaggt
     5461 gcatttctat catgacctca gtcccattgc ccctgcagaa agcatcgagt tgcagcccct
     5521 gtcatctcag ggagagctgt atgacatata tgcagatgta gacgggcaag aggacgctgc
     5581 agctgtggct aacaccccat taaacagcaa cagcagtggc attgcaagcc cctggaacac
     5641 cacagtgcca ctcagtgcag gggcggacgt gacgctgcag tccggccccg acgtgtccct
     5701 ggatgcacca gtggctgaat cgcctgtgca ccctggagtg cctctaaggc cttctgcaca
     5761 tattattctg tacgggggag acttttattt gcaccctagc tacctcggta ttcgcaggaa
     5821 acgtaaacgc atgcacaatt tcttttcaga tgtctatgtg gcggcctagt gactccaagg
     5881 tctacctacc acctgtccct gtgtctaagg tggtcagcac ggatgaatat gtctctcgca
     5941 caagcatata ctatcacgct ggcagttcca gacttctggc tgttggacat ccctactatg
     6001 ctgtaaagaa gggcaacaac aaagtgtcag tgcccaaggt ttctggttta caataccgag
     6061 tgtttcgagt gcgtttgcct gaccccaata agtttggcct tccagatgct aacttttatg
     6121 accctaacac acagcgcctt gtgtgggcct gtttaggcgt ggaggtgggg cgtggacagc
     6181 cactgggagt gggcaccagt ggtcatccac tgctgaacaa actagatgac acggaaaatg
     6241 gccctaaagt ggccggggga caaggagcag ataacaggga atgcgtgtca atggactaca
     6301 agcaaacaca gctgtgcatg ctaggatgca agccccctgt gggtgagcat tggggaaaag
     6361 gaaatccttg caccactggc gctgcaggtg actgccctgc acttgagctt gttaactcag
     6421 ttatacagga tggggacatg gttgatacag ggtatggcgc tatggacttt aatgcactgc
     6481 aggccaacaa atcagatgtt cctatagaca tatgcactag cgtgtgcaaa taccctgact
     6541 atttaaaaat ggcatcagat ccctatggcg acagcttgtt tttttacctg cgaagggagc
     6601 aaatgtttgt cagacacctg tttaacagag ctggcacaat gggtgacagt gtccctgatg
     6661 acttgtatat taaaggcagt ggaagcaatg tcaagcttgc cagccacgtg ttttacccca
     6721 cacctagtgg ctcaatggtg acatctgatg cccaattatt taacaagcca tactggttac
     6781 agaaagccca gggccataac aatggcatct gttggggcaa ccaagtgttc cttactgtag
     6841 ttgacaccac taggagcaca aacatgacac tgtgtgcatc cactgcctcc acagttacta
     6901 caccatataa taatgagagt tttaaagagt acctgcgaca tgtggaggag tttgatttgc
     6961 aatttatatt tcagctgtgc aaggtaaccc tgaacactga agtaatggcc tacatacaca
     7021 gcatggatgc cagcatactg gaggactgga actttggttt gcagcctcct ccgtctggct
     7081 ccttgcagga cacctatagg tttgtgacgt ctgccgccat cacctgtcaa aaacctgcac
     7141 cccccaaaga aaaggaagac ccgttggcta agtatacctt ttgggaggtg gatttaaagg
     7201 aaaagttttc tgcagattta gaccaatttc ccttaggccg caaatttttg ctgcaagctg
     7261 gcatgcgtgc acgccctacc ctgcgcgccc ccaaacgcac agcctcatct acctcatctt
     7321 ccagcccccg caaacgcaaa cgcaccaaac gctaacgttg cttatattta tgttgttgta
     7381 cccagtgtgc atgatttatg tatgtgtgca tgttgtacgt gattttgtat ttcctgtgtt
     7441 gtgcgtgtca ctgttttgtg ttgttgcgtg agtgtgttgc acttatgtgt ttattaaagt
     7501 atgcgtggtc gcacccgagt gagtaactgt gtgtgtccgg cgtgtagttt ctgtcacatg
     7561 catgcatgca cacccaaaca ctgttgccac tgcctttaac agcttgcctg ctgcacttcc
     7621 attttgaacc cttctccatt ttccctgcaa accctccatt ttatggtctc gaccggtttc
     7681 ggtcgcgctt ggcacgcatt ttgggcaaac aaaaccacaa cactgctaat cctctggctt
     7741 cctgcctctc ctactgctgc atacctgtgg ttgtgctttg gcgctccctg gtgactcact
     7801 gtctctgcaa acaaaaattt gcacacacac ttaatccaac cctctttgta caaaatgctt
     7861 ttggcagtac atttctaaga gttactcatg ctaattgcat agttggccac aatttcaggg
     7921 ttggattgcc aatactatgt ccttttaaat gtgattaatt ttcaaaatgt tcttgcaggt
     7981 gtgtgtgacc gggatcggtc aaactttcac aagcattttt tatagtaa
//
DBGET integrated database retrieval system