GenomeNet

Database: RefSeq
Entry: NC_001815
LinkDB: NC_001815
Original site: NC_001815 
LOCUS       NC_001815               8855 bp ss-RNA     linear   VRL 13-AUG-2018
DEFINITION  Simian T-lymphotropic virus 2, complete genome.
ACCESSION   NC_001815
VERSION     NC_001815.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; core proteins; env gene; gag gene; gag protein; gag-pro-pol
            polyprotein; LTR; ORFI; ORFII; ORFV'; pol gene; pol protein;
            protease; rex gene; rex protein; surface glycoprotein; tax gene;
            tax protein; transmembrane glycoprotein.
SOURCE      Simian T-lymphotropic virus 2
  ORGANISM  Simian T-lymphotropic virus 2
            Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes;
            Ortervirales; Retroviridae; Orthoretrovirinae; Deltaretrovirus.
REFERENCE   1
  AUTHORS   Van Brussel,M., Salemi,M., Liu,H.F., Gabriels,J., Goubau,P.,
            Desmyter,J. and Vandamme,A.M.
  TITLE     The simian T-lymphotropic virus STLV-PP1664 from Pan paniscus is
            distinctly related to HTLV-2 but differs in genomic organization
  JOURNAL   Virology 243 (2), 366-379 (1998)
   PUBMED   9568035
REFERENCE   2  (bases 1 to 8855)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (01-AUG-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 8855)
  AUTHORS   Van Brussel,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (11-AUG-1997) M. Van Brussel, Rega Institute for Medical
            Research, Minderbroederstraat 12, 3000 Leuven, BELGIUM
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. The reference sequence was derived from Y14570.
FEATURES             Location/Qualifiers
     source          1..8855
                     /organism="Simian T-lymphotropic virus 2"
                     /proviral
                     /mol_type="genomic RNA"
                     /strain="PP1664"
                     /isolate="STLV-2PP1664"
                     /db_xref="taxon:33748"
                     /cell_line="PP1664"
                     /cell_type="T-lymphocyte"
                     /lab_host="Pan paniscus"
     repeat_region   1..712
                     /rpt_type=long_terminal_repeat
     exon            1..415
                     /number=1
     gene            756..5160
                     /locus_tag="STLV2gp01"
                     /db_xref="GeneID:1724974"
     CDS             join(756..2030,2030..2562,2562..5160)
                     /locus_tag="STLV2gp01"
                     /note="ribosomal frameshift, -1 at 2030;
                     ribosomal frameshift, -1 at 2562"
                     /codon_start=1
                     /product="gag-pro-pol polyprotein"
                     /protein_id="NP_056907.1"
                     /db_xref="UniProtKB/TrEMBL:O70641"
                     /db_xref="GeneID:1724974"
                     /translation="MGQTYGLSSSPIPKAPRGLSTHHWLNFLQAAYRLQPGPSDFDFQ
                     QLRRFLKLALKTPIWLNPIDYSLLASLIPKGYPGRTIEIINVLIKNQTSPTPPPAPSL
                     PEPANPPPLQQPSAPPEPHTPPPYIKPPATHCLPILHPHGAPSAHSPWQMKDLQAIKQ
                     EVSTSAPGSPQFMQTVRLAIQQFDPTAKDLQDLLQYLCSSLVVSLHHQQFHTLITEAE
                     TRGMTGYNPMAGPLRMQANNPAQQGLRREYQNLWLAAFSALPGNTRDPSWAAILQGLE
                     EPYCAFVERLNVALDNGLPEGTPKEPILRSLAYSNANKDCQKLLQARGHTNSPLGDML
                     RACQAWTPKDKARVLVVQPRKPPPTQPCFRCGKTGHWSRDCTLPRPPPGPCPLCKDPS
                     HWKRDCPQFKPPPTEEEPLLLDLPSDAIATEEKKLPGGGDVISPQQISMLPVIPLEQQ
                     HQPLLDVQVSIAGAPPRPTQALLDTGADLTVLPQALAPESVSVSDTTVLGAGGQTSSQ
                     FKLLQSPLCVYLPFRRAPVTLPSCLVDTNSKWAIIGRDILQKCQSVLYLPEDNLCKGT
                     PRLPDGITPPRLLPVTTPNVIGLEHFPPPPQIDQFPFKPERLQALTDLVSKALEASYI
                     EPYSGPGNNPVFPVKKPNGKWRFIHDLRATNAITTTLASPSPGPPDLTSLSTALPYLQ
                     TIDLTDAFFQIPLPKQFQPYFAFTIPQPCNYGPGARYAWTVLPQGFKNSPTLFEQQLA
                     AVLSPIRKTFPMSTIIQYMDDILLASPTQEELQQLSKMTLQALVTHGLPVSQEKTQQT
                     PGQIRFLGQVISPNHITYETTPTIPIKSQWTLTELQTVLGEIQWVSKGTPILRKHLQC
                     LYSALRGYQDPRAHLLLQKQQLHALHAIQQALQHNCRSRLNPALPILGLISLSSSGTT
                     SVLFQARQRWPLVWLHTPHPPTSLCPWGHLLACTILTLDKYSLQHYGQLCQSFHHNMS
                     NTALHDFVKNSPHPSVGILIHHMGRFHNLGSQPSGPWRTLLHLPALLQEPRLLRPLFT
                     LSPVVLTTAPCLFSDGSSQKAAYVLWDQTILHHDSVTLPPHGSNSAQKGELLALLSGI
                     RAAKSWPSLNIFLDSKYLIKYLHSLAIGAFLGTSTHQSLYAHLPTLLHNKVIYLHHIR
                     SHTNLPDPISTLNEYTDSLIIAPLIPLTPQDLHKLTHCNSRALVSSGATPQQAKSLLQ
                     TCYTCNIINSQHHMPQGHIRRGLMPNHIWQGDVTHYKYKRNRYCLHVWVDTFSNAVSI
                     TCKTKETSSETVSALLHAITILGKPLSINTDNGSAFLSQEFQAFCASWHIKHSTHVPY
                     NSTSSGLVERTNGIVKALLNKYLLDSPNLPLDNAISKALWTLNQLNVMSSQWKTRWQL
                     HHGPRLRPIPETPRPSRAPTNWYYYKLPGLTNQRWKGPLQSLQEAAGAALLSIDGSPQ
                     WIPWRLLKKTVCPRPDGSELVAHAATDHQHHG"
     mat_peptide     join(756..2030,2030..2050)
                     /locus_tag="STLV2gp01"
                     /product="gag protein"
                     /protein_id="YP_567048.1"
     misc_feature    756..1028
                     /locus_tag="STLV2gp01"
                     /note="Major core protein p19; Region: Gag_p19; pfam02228"
                     /db_xref="CDD:280404"
     misc_feature    1209..1802
                     /locus_tag="STLV2gp01"
                     /note="gag gene protein p24 (core nucleocapsid protein);
                     Region: Gag_p24; pfam00607"
                     /db_xref="CDD:279002"
     mat_peptide     join(1737..2030,2030..2562,2562..2583)
                     /locus_tag="STLV2gp01"
                     /product="protease"
                     /protein_id="YP_567049.1"
     misc_feature    1839..1883
                     /locus_tag="STLV2gp01"
                     /note="zinc finger; Region: ZnF_C2HC; smart00343"
                     /db_xref="CDD:197667"
     misc_feature    2108..2422
                     /locus_tag="STLV2gp01"
                     /note="Cellular and retroviral pepsin-like aspartate
                     proteases; Region: pepsin_retropepsin_like; cl11403"
                     /db_xref="CDD:299705"
     misc_feature    order(2174..2176,2180..2182,2186..2188,2249..2251,
                     2252..2254,2378..2380)
                     /locus_tag="STLV2gp01"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:133137"
     misc_feature    2174..2182
                     /locus_tag="STLV2gp01"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:133137"
     misc_feature    2174..2176
                     /locus_tag="STLV2gp01"
                     /note="Catalytic residue [active]"
                     /db_xref="CDD:133137"
     misc_feature    order(2249..2251,2252..2257,2276..2287)
                     /locus_tag="STLV2gp01"
                     /note="Active site flap [active]"
                     /db_xref="CDD:133137"
     mat_peptide     join(2522..2562,2562..5157)
                     /locus_tag="STLV2gp01"
                     /product="pol protein"
                     /protein_id="YP_567050.1"
     misc_feature    join(2537..2562,2562..3180)
                     /locus_tag="STLV2gp01"
                     /note="RT_like: Reverse transcriptase (RT, RNA-dependent
                     DNA polymerase)_like family. An RT gene is usually
                     indicative of a mobile element such as a retrotransposon
                     or retrovirus. RTs occur in a variety of mobile elements,
                     including retrotransposons; Region: RT_like; cl02808"
                     /db_xref="CDD:295487"
     misc_feature    2668..3180
                     /locus_tag="STLV2gp01"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:278506"
     misc_feature    order(2806..2823,2929..2934,3025..3027,3031..3036,
                     3166..3171)
                     /locus_tag="STLV2gp01"
                     /note="active site"
                     /db_xref="CDD:238185"
     misc_feature    order(2806..2823,2929..2931,3031..3033)
                     /locus_tag="STLV2gp01"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238185"
     misc_feature    2932..2934
                     /locus_tag="STLV2gp01"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
     misc_feature    3877..4242
                     /locus_tag="STLV2gp01"
                     /note="Ribonuclease H-like superfamily, including RNase H,
                     HI, HII, HIII, and RNase-like domain IV of spliceosomal
                     protein Prp8; Region: RNase_H_like; cl14782"
                     /db_xref="CDD:301345"
     misc_feature    order(3886..3897,3979..3984,3991..3993,4057..4059,
                     4183..4185)
                     /locus_tag="STLV2gp01"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:259998"
     misc_feature    order(3886..3888,4057..4059)
                     /locus_tag="STLV2gp01"
                     /note="active site"
                     /db_xref="CDD:259998"
     misc_feature    4276..4383
                     /locus_tag="STLV2gp01"
                     /note="Integrase Zinc binding domain; Region:
                     Integrase_Zn; pfam02022"
                     /db_xref="CDD:280240"
     misc_feature    4438..4764
                     /locus_tag="STLV2gp01"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:279057"
     misc_feature    4951..5088
                     /locus_tag="STLV2gp01"
                     /note="Integrase DNA binding domain; Region: IN_DBD_C;
                     pfam00552"
                     /db_xref="CDD:278951"
     gene            756..2051
                     /gene="gag"
                     /locus_tag="STLV2gp02"
                     /db_xref="GeneID:1497210"
     gene            1739..2584
                     /gene="pro"
                     /locus_tag="STLV2gp03"
                     /db_xref="GeneID:1497212"
     gene            2524..5157
                     /gene="pol"
                     /locus_tag="STLV2gp04"
                     /db_xref="GeneID:1497211"
     exon            5016..5156
                     /gene="pol"
                     /locus_tag="STLV2gp04"
                     /note="gene product deduced from splicing pattern"
                     /citation=[1]
                     /number=2
     gene            5094..7617
                     /locus_tag="STLV2gp05"
                     /db_xref="GeneID:1724971"
     CDS             join(5094..5156,7168..7617)
                     /locus_tag="STLV2gp05"
                     /codon_start=1
                     /product="rex protein"
                     /protein_id="NP_056908.1"
                     /db_xref="UniProtKB/TrEMBL:O70642"
                     /db_xref="GeneID:1724971"
                     /translation="MPKARRQRTRRTRSNRPPTPWPTFQVSDRASSMDTQSTCLAIVF
                     KPIGVPFQVGFVPPACTGMPFSPPARSTSSPGTPSMDALSALLSNTLSLGSPPSPPRE
                     PPRPSRSSLPLPLLSPPRFHPPFSNPCVNSPPTGTGAYTQLSETSSPPLPSPTPVSGP
                     KTSTPPGEEP"
     mat_peptide     7168..7614
                     /gene="rex"
                     /locus_tag="STLV2gp12"
                     /product="Rex protein (short variant)"
                     /protein_id="NP_954570.1"
     gene            5094..7036
                     /locus_tag="STLV2gp06"
                     /db_xref="GeneID:1724969"
     CDS             join(5094..5156,6917..7036)
                     /locus_tag="STLV2gp06"
                     /note="ORFI"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_056909.1"
                     /db_xref="UniProtKB/TrEMBL:O70645"
                     /db_xref="GeneID:1724969"
                     /translation="MPKARRQRTRRTRSNRPPTPWPLPSALLLLLALFQNFHDFLLLF
                     RQRPPATIPYILSDRP"
     gene            5153..8207
                     /locus_tag="STLV2gp07"
                     /db_xref="GeneID:1724972"
     CDS             join(5153..5155,7167..8207)
                     /locus_tag="STLV2gp07"
                     /codon_start=1
                     /product="tax protein"
                     /protein_id="NP_056910.1"
                     /db_xref="UniProtKB/TrEMBL:O70643"
                     /db_xref="GeneID:1724972"
                     /translation="MAHFPGFGQSLLYGYPVYVFGDCVQADWCPVSGGLCSTRLHRHA
                     LLATCPEHQLTWDPIDGRVVGSPLQYLIPRLPSFPTQRTSKTLKVLTPPTTPVSPKIP
                     PAFFQSMRKLSPYRNGCLYPTLGDQLPSLAFPDPGLRPQNIYTTWGRTVVCLYLYQLS
                     PPMTWPLIPHVIFCHPKQLGTFLTNVPLKRLEELLYKIFLHTGAIIVLPEDTLPTTLF
                     QPVRAPCVQTAWDTGLLPYHSLITTPGLIWTFNDGSPMISGPCPKPGQPSLVVQSSLL
                     IFEKFQTKAFHPSYLLSHQLIQYSSFHNLHLLFEEYTNIPXSYLFNEKEADDSDSDPG
                     PSNLGAAQGESSA"
     mat_peptide     7167..8204
                     /gene="tax"
                     /locus_tag="STLV2gp11"
                     /product="tax protein (short variant)"
                     /protein_id="NP_954571.1"
     misc_feature    7170..7835
                     /locus_tag="STLV2gp07"
                     /note="HTLV Tax; Region: Tax; pfam02959"
                     /db_xref="CDD:281024"
     gene            5153..7134
                     /locus_tag="STLV2gp08"
                     /db_xref="GeneID:1724973"
     CDS             join(5153..5155,6991..7134)
                     /locus_tag="STLV2gp08"
                     /note="ORFV'"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_056911.1"
                     /db_xref="UniProtKB/TrEMBL:O70646"
                     /db_xref="GeneID:1724973"
                     /translation="MAPSGDHPVHPLRPTLILRVAPVLSFSGLLQNTIHQSPPPQDPP
                     MAAF"
     gene            5153..6613
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /db_xref="GeneID:1497209"
     CDS             5153..6613
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_056912.1"
                     /db_xref="UniProtKB/TrEMBL:O70644"
                     /db_xref="GeneID:1497209"
                     /translation="MGKIIAFLLFHLTCITITKQSRCTLTVGVSSYHSSPCSLAQPIC
                     TWDLDLHSLTTDQRLYPPCPNLVSYSNFHKSYSLYLFPHWVKKPNRQGLGYYSASYSD
                     PCSLQCPYLGSQSWTCPYTGPISSPSWRFHRDVNFTQEVNHVTLRLHFSRCGSSMTLL
                     IDAPGYDPLWFISSEPTQPPPTSPPLVRDSDLEHILTPSSSWATRMLTLIQLTLQSTN
                     YSCMVCIDRTSLSSWHVLYTPNISASPGGDSLPILYPSLALPAPQPQPFSWSHCYQPH
                     LQAVTTANCNNSIVLPPFSLTPVPSPGTRSRRAIPVAVWLVSALAAGTGIAGGITGSL
                     SLASSRSLLFEVDKDISHLTQAIVKNHQNILRVAQYAAQNRRGLDLLFWEQGGLCKAI
                     QEQCCFLNISNTHVSVLQERPPLEKRVITGWGLNWDLGLSQWAREALQTGITILALLL
                     LVILFGPCILRQLQSLPHRLQNRHNQYSLINQETTL"
     misc_feature    5201..6556
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="ENV polyprotein (coat polyprotein); Region:
                     TLV_coat; pfam00429"
                     /db_xref="CDD:278837"
     misc_feature    6185..6388
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="heptad repeat 1-heptad repeat 2 region (ectodomain)
                     of the transmembrane subunit of human T-cell leukemia
                     virus type 1 (HTLV-1), and related domains; Region:
                     HTLV-1-like_HR1-HR2; cd09851"
                     /db_xref="CDD:197368"
     misc_feature    order(6185..6193,6197..6202,6206..6211,6215..6223,
                     6227..6235,6239..6244,6248..6256,6260..6286,6290..6298,
                     6323..6328,6335..6337,6344..6352,6365..6367,6374..6379,
                     6386..6388)
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="homotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:197368"
     misc_feature    6185..6292
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="HR1; other site"
                     /db_xref="CDD:197368"
     misc_feature    6266..6316
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="immunosuppressive region; other site"
                     /db_xref="CDD:197368"
     misc_feature    6272..6274
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="Cl binding site [ion binding]; other site"
                     /db_xref="CDD:197368"
     misc_feature    6317..6340
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="CX(6)C motif; other site"
                     /db_xref="CDD:197368"
     misc_feature    6359..6388
                     /gene="env"
                     /locus_tag="STLV2gp09"
                     /note="HR2; other site"
                     /db_xref="CDD:197368"
     exon            6916..8855
                     /note="gene product deduced from splicing pattern"
                     /citation=[1]
                     /number=3
     exon            6991..8855
                     /note="gene product deduced from splicing pattern"
                     /citation=[1]
                     /number=4
     exon            7069..8855
                     /note="gene product deduced from splicing pattern"
                     /citation=[1]
                     /number=5
     gene            7154..7495
                     /locus_tag="STLV2gp10"
                     /db_xref="GeneID:1724970"
     CDS             7154..7495
                     /locus_tag="STLV2gp10"
                     /note="ORFII"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_056913.1"
                     /db_xref="UniProtKB/TrEMBL:O70647"
                     /db_xref="GeneID:1724970"
                     /translation="MPFFSPLSRFRTEPPLWIPSLRVWRLCSSRLVSRFRWALFHPPA
                     PACPSRHLPGAPAHLGPHRWTRCRLSSPIPYPSAPLLPHPENLQDPQGPHSPYHSCLP
                     QDSTRLFPIHA"
     misc_feature    7154..7414
                     /locus_tag="STLV2gp10"
                     /note="Deltaretrovirus Tax protein; Region:
                     Deltaretro_Tax; pfam05599"
                     /db_xref="CDD:191311"
     exon            7167..8855
                     /note="gene product deduced from splicing pattern"
                     /citation=[1]
                     /number=6
     gene            7167..8204
                     /gene="tax"
                     /locus_tag="STLV2gp11"
                     /db_xref="GeneID:1497214"
     gene            7168..7614
                     /gene="rex"
                     /locus_tag="STLV2gp12"
                     /db_xref="GeneID:1497213"
ORIGIN      
        1 tgacagtgac tctgaccctg ggccttctaa cctcggggcc gcccagggcg agtcatcagc
       61 ttaaaaggtc acgctgtctc acacaaacaa tcccgggaac aggctctgac gtttccccct
      121 gcagaccatt tgaggaacca ggaactactc tccagaaaaa taacctcgcc cttacccact
      181 tccccttgcc ttgaaaaaca aggctctgac gactaccccc ctcacccata aaatttgcct
      241 actcaataaa aacccaggcc tataaaagcg caaggacggt tcaggagggg gtcatctctt
      301 tccacctgcc cgctgtgcct accttggaga tccattccgc ccgggcggct cggtcgagac
      361 gtctcgttga gctctgtctc ccgttccagg cacctcctga accgcgcctt tcagggtaag
      421 tctcccccca ggttgagcta ggctacgact cccgtagtcg ctcccgcagg gtcggtcgag
      481 gctccctgac cctccggccg cgcacggtta ggctctggtt tgcaacccaa cttccgcgtt
      541 cttgtcttat tctccgccga aatcgaaagc acagtgcccc tccctgcacc actggcccgg
      601 ggccagcatc ctgccaggga cgcgcgcctg ctaaacccga gggtgttttg ggcctctccg
      661 ggaggggtac ccagccactt cgggtccttg ttctctccgg gagagacaaa caagtggggg
      721 ctcgtccggg atacctaccc ctgccctctc gcattatggg acaaacctac ggcctctcgt
      781 ccagcccaat ccccaaggcc cccagggggt tatcaaccca ccattggtta aacttcctcc
      841 aagccgccta ccggctacaa cctgggccct ccgactttga ttttcagcaa ctacggcgtt
      901 tcctgaagct ggctcttaaa acacctattt ggttaaatcc aatcgattac tccctcctag
      961 ccagcctcat ccccaagggt taccccgggc ggacaatcga aatcattaat gtgttaatta
     1021 aaaatcaaac gtcccccacc ccgcctcctg ccccgtctct acccgaacca gctaacccac
     1081 cgcccctcca acagccctcg gctcctccgg aaccccatac accccccccc tatataaagc
     1141 ctcccgctac ccattgcctt cccatactac acccacatgg ggccccctcg gctcacagcc
     1201 cttggcaaat gaaagacctg caggccatca agcaggaggt cagcacctca gcccccggga
     1261 gtccccagtt catgcaaaca gtccggctcg caattcagca attcgacccc acggccaaag
     1321 acttacaaga tctcttgcag tacctctgct cctccctagt cgtctccctt caccatcaac
     1381 aattccatac cctgattacc gaagctgaaa cccggggaat gacaggttat aaccccatgg
     1441 ccgggcccct aaggatgcag gccaacaacc ccgcccagca gggactccgg agggaatacc
     1501 aaaacctctg gctggcggcc ttttcagctc tgccagggaa cacccgcgac ccatcctggg
     1561 cagcaatctt gcaagggcta gaggaaccct actgcgcttt cgtagaacgc cttaatgttg
     1621 cccttgacaa cggcctcccc gaaggaaccc ccaaagagcc catcttgcgc tccctggcct
     1681 actccaacgc taataaagat tgccaaaaat tgctgcaggc ccggggccat actaatagcc
     1741 ccctagggga catgctccga gcctgccaag catggacacc caaggacaaa gcccgggtcc
     1801 tcgtcgtcca accacgaaag cccccgccca cgcagccctg cttccgctgc gggaaaacag
     1861 ggcattggag ccgagactgc accctcccac gccccccccc tggtccgtgt cccttgtgca
     1921 aggacccttc ccattggaaa cgagattgtc cacagttcaa acccccccca acggaggagg
     1981 aacccctcct gctggacctg ccctcggatg ccattgccac cgaggaaaaa aactccctgg
     2041 ggggggagat gtaatctccc cccaacaaat ctcaatgctc cctgtcattc cgttagagca
     2101 acagcaccag ccccttctag acgttcaagt ctccattgca ggcgcccccc ctcgacctac
     2161 ccaggcactc ttagacacgg gggctgatct caccgtcctg ccccaggccc ttgcccccga
     2221 gtcagtaagt gtttctgata caacggttct gggcgctggc ggacagacca gctcccagtt
     2281 caaactcctt caatcccccc tgtgcgtcta cctacccttc cggagggccc ctgttaccct
     2341 cccatcatgc cttgtagaca ccaatagcaa atgggccatt attggccgtg atatcctcca
     2401 gaaatgccag agtgtcctgt accttccgga ggacaatctg tgcaagggta ccccccggct
     2461 ccccgatgga ataactcctc cccgattatt acccgtgacc acccccaatg tcattggcct
     2521 tgagcacttc ccaccacccc cacagataga tcagttccct ttaaacctga gcgcctccag
     2581 gccttgactg acctggtctc caaggccctg gaggctagct acattgaacc ttactctgga
     2641 ccaggtaata accccgtctt tccagtcaaa aaaccaaacg gcaaatggag atttattcat
     2701 gacctaaggg ccaccaatgc catcacgacc accttggcct ccccgtcccc cggacctccc
     2761 gatctcacca gcttatcaac agccctccca tacctgcaaa ctatagacct tactgacgcc
     2821 ttcttccaaa tcccccttcc aaaacagttc cagccatact tcgccttcac catcccccag
     2881 ccatgtaatt atggccctgg ggctcggtat gcctggactg tccttccaca gggatttaaa
     2941 aacagcccca ccctgttcga acaacagctg gccgccgtcc tttcccccat caggaaaacc
     3001 ttccctatgt ctactatcat ccaatatatg gatgatatac tcttggccag tcctacacaa
     3061 gaggaactgc aacaactctc caagatgacc ctccaagcgc tagtcaccca cggccttcca
     3121 gtctctcagg agaaaaccca acaaacccct gggcaaatac gtttcctggg tcaagttata
     3181 tctcccaacc atattaccta tgaaaccacc cccaccattc ccatcaaatc ccaatggact
     3241 ctcactgaac tacagactgt actaggagag attcaatggg tctcaaaagg aacccccatt
     3301 ctccgcaaac acctgcagtg cttatactcc gccctccgcg gatatcagga ccccagggca
     3361 cacctcctcc tccagaagca acagctccat gccctccatg ccatccaaca ggccttacaa
     3421 cacaattgcc gcagccgtct caatcctgct ttgcccatcc tggggcttat ctccttgagc
     3481 tcgtctggca caacctccgt cctcttccaa gcccgacagc gatggcccct ggtttggctg
     3541 cacacccccc atcccccaac cagcctgtgc ccctggggtc acttgctggc ctgcactatc
     3601 ctgaccttgg acaaatactc cctccagcac tatggccagc tgtgccagtc cttccaccat
     3661 aacatgtcca acacagctct ccacgatttt gtaaaaaact ccccccaccc gagcgtaggc
     3721 atccttatcc accacatggg ccgctttcac aacctcggca gtcaaccatc tggtccttgg
     3781 aggactctct tacaccttcc tgccctcctc caggagccac ggctcctccg acccctcttc
     3841 acgctatctc ccgtggtttt aacgacagca ccctgtctct tctccgacgg gtcttctcaa
     3901 aaggcggctt acgtgctttg ggaccagacc atcctccacc atgactctgt cacgttgccc
     3961 ccccatggca gcaactcagc tcaaaaagga gagcttctcg ccctcctttc gggaatccgg
     4021 gcggccaagt catggccatc cctgaatatt tttcttgact ccaaatactt aattaaatat
     4081 ctccattccc ttgccattgg agcctttctt gggacttcaa ctcaccagtc actctatgcc
     4141 catttgccta ccttgttaca taacaaggtt atttacctcc accatattcg tagccacacc
     4201 aatctccccg accccatctc cactcttaac gaatacacag actcactcat tatagcccct
     4261 ctcattcccc taacacctca ggatctgcat aaacttaccc attgcaactc cagggccctt
     4321 gtttcctcag gggccacccc acagcaagcc aagtcactct tacaaacttg ttacacctgc
     4381 aacatcataa actcacaaca tcacatgcct caagggcaca tccgtcgagg gttgatgccc
     4441 aatcacatat ggcaaggaga tgtaacccat tacaaataca agcggaaccg atattgcctg
     4501 cacgtctggg ttgatacctt ctccaacgca gtctccatta cctgcaagac aaaagagact
     4561 agttctgaaa ctgtcagcgc cctcctgcac gctatcacta tcttaggcaa gcccctttct
     4621 ataaacactg acaatggttc tgccttccta tctcaagaat tccaggcctt ttgcgcctca
     4681 tggcacatca aacattccac ccatgtgcct tacaactcta ccagctccgg gctagtagaa
     4741 aggaccaatg gcattgttaa ggccctcctc aacaaatatc ttttagacag cccaaacctc
     4801 cccctagaca atgccatcag taaagcccta tggaccctaa accaactcaa tgtcatgtcg
     4861 tcccagtgga aaacccgatg gcaactccat catggccccc ggttgcgccc catccctgaa
     4921 acacctcggc cttctagggc acccacgaat tggtactatt acaaactccc tggtcttacc
     4981 aatcagcggt ggaaaggacc tttgcaatct ctccaggaag ctgcaggagc agccttactc
     5041 tcgatagacg gctcccctca gtggatcccg tggcggctcc tgaaaaagac tgtatgccca
     5101 aggccagacg gcagcgaact cgtcgcacac gcagcaacag accaccaaca ccatgggtaa
     5161 gataattgct ttccttttat tccatcttac atgtatcaca atcactaaac agagccggtg
     5221 cacgcttacg gtaggtgtct cctcgtatca ctctagtccc tgcagtcttg cccaacctat
     5281 ctgcacctgg gatctcgacc ttcattcctt aactacagac caacgtctgt accctccatg
     5341 ccccaatcta gtttcttact ctaacttcca caagtcctac tccttatatt tgttcccgca
     5401 ctgggtaaaa aagccaaata gacaaggcct gggatactat tctgcatcct acagcgaccc
     5461 ctgctcgctc cagtgccctt atttaggaag ccagtcttgg acatgccctt acaccggccc
     5521 catctccagc ccgtcttgga ggttccaccg agatgttaac ttcacccaag aggtcaacca
     5581 tgtaaccctc cggctacact tctcccgatg tggctcttct atgaccctcc tcatagacgc
     5641 cccaggctac gaccccctgt ggttcatctc ttcggaaccc actcagcccc cccccacttc
     5701 cccaccatta gtccgcgact ctgaccttga acatatctta accccctcct cctcctgggc
     5761 tactaggatg ctaaccctca tccaactaac tctacaaagt accaattatt cttgcatggt
     5821 ttgtatagac agaaccagct tgtcgtcctg gcacgtactc tataccccta atatctctgc
     5881 ctcacctggg ggcgactcct tgcctatact ttatccctcc ttggccctac cggcccccca
     5941 accccagccg ttttcctggt ctcactgtta ccagccccac ctacaggcag taactacagc
     6001 caattgcaac aattccattg tcctgccccc attctctctc accccggtgc cttcccctgg
     6061 gacaagaagc cgccgggcta ttccagtggc tgtatggctc gtctcagccc tagcggccgg
     6121 gactggtatt gcagggggaa taaccggatc cctgtcccta gcatcaagcc gcagcctgct
     6181 ttttgaagtt gacaaagata tttcccacct cacacaagcc atcgttaaaa accatcaaaa
     6241 catcctccgc gtagcacaat atgcagccca aaatagaaga ggactagacc tcctgttttg
     6301 ggaacaagga ggcctctgca aagccataca agagcaatgt tgcttcctta acatcagcaa
     6361 cacccatgtg tccgtccttc aggagcgccc ccccctggaa aagagagtca tcacaggatg
     6421 gggtctcaac tgggacctag ggctatccca atgggcacgg gaagcactcc aaactggtat
     6481 aaccatccta gccttgctcc tccttgtcat actgttcggt ccttgtatcc ttcgccaact
     6541 ccaatcactt ccccaccggc tacagaacag gcacaaccaa tactctctta ttaaccagga
     6601 aaccacacta taacagccca gctaattgct gcaggaggtc tccatggcac ttccccctac
     6661 cgtttatcca cccacactcc ccaattccag aggaatctcc ccctatatcc agacccgatt
     6721 caaactgatt tagtaaatca aaaagctcct ctaactcctg ctcacattcc tcccataaac
     6781 acgtccgctc cccctccaag acactgatat atccctctaa catctcacaa tacccttcaa
     6841 accccagcaa ccctatacac tctaactgtt gatgtctctt ttcgcgctct cgacgctttt
     6901 cttccttctc ccgcagccgc tcccttctgc gctgctcctt ctcctcgcgt tgtttcagaa
     6961 tttccatgat ttccttctgc tcttccgcca gcgccctccg gcgaccatcc cgtacatcct
     7021 ctccgaccga ccctgatcct aagggtcgcc cccgtgttgt ctttctcagg cctcctccag
     7081 aacacgatac accagtcacc accacctcag gatcccccaa tggcagcctt ctgaaatact
     7141 ctaaacaaaa tacatgcctt tcttcagccc actttccagg tttcggacag agcctcctct
     7201 atggataccc agtctacgtg tttggcgatt gtgttcaagc cgattggtgt cccgtttcag
     7261 gtgggctttg ttccacccgc ctgcaccggc atgcccttct cgccacctgc ccggagcacc
     7321 agctcacctg ggaccccatc gatggacgcg ttgtcggctc tcctctccaa taccttatcc
     7381 ctcggctccc ctccttcccc acccagagaa cctccaagac cctcaaggtc ctcactcccc
     7441 ctaccactcc tgtctccccc aagattccac ccgccttttt ccaatccatg cgtaaactct
     7501 ccccctaccg gaacgggtgc ctatacccaa ctctcggaga ccagctcccc tcccttgcct
     7561 tccccgaccc cggtctccgg ccccaaaaca tctacaccac ctggggaaga accgtagttt
     7621 gcttgtacct ctaccaacta tctcccccga tgacctggcc cttaatacct cacgtcatat
     7681 tttgccatcc caagcagtta gggaccttcc tgaccaacgt acctctaaaa cgcttggaag
     7741 aattactata caaaatattc ttgcataccg gggccattat agtactcccc gaagacaccc
     7801 tccctactac attgttccaa cctgttagag ccccctgcgt ccagacggct tgggacacgg
     7861 ggcttttacc ctaccactct ctcataacta ctccaggcct aatatggacg ttcaatgacg
     7921 gttcgcccat gatttccggc ccctgcccca aaccggggca gccatctttg gtggtacaat
     7981 cctccctgtt aatctttgaa aaattccaga ccaaagcttt tcatccttcc tacctactgt
     8041 cccatcaact catccagtac tcctcgttcc ataacctcca ccttctcttc gaggagtata
     8101 ctaacattcc agnttcctat ttgtttaacg aaaaagaggc agatgacagt gactctgacc
     8161 ctgggccttc taacctcggg gccgcccagg gcgagtcatc agcttaaaag gtcacgctgt
     8221 ctcacacaaa caatcccggg aacaggctct gacgtttccc cctgcagacc atttgaggaa
     8281 ccaggaacta ctctccagaa aaataacctc gcccttaccc acttcccctt gccttgaaaa
     8341 acaaggctct gacgactacc cccctcaccc ataaaatttg cctactcaat aaaaacccag
     8401 gcctataaaa gcgcaaggac ggttcaggag ggggtcatct ctttccacct gcccgctgtg
     8461 cctaccttgg agatccattc cgcccgggcg gctcggtcga gacgtctcgt tgagctctgt
     8521 ctcccgttcc aggcacctcc tgaaccgcgc ctttcagggt aagtctcccc ccaggttgag
     8581 ctaggctacg actcccgtag tcgctcccgc agggtcggtc gaggctccct gaccctccgg
     8641 ccgcgcacgg ttaggctctg gtttgcaacc caacttccgc gttcttgtct tattctccgc
     8701 cgaaatcgaa agcacagtgc ccctccctgc accactggcc cggggccagc atcctgccag
     8761 ggacgcgcgc ctgctaaacc cgagggtgtt ttgggcctct ccgggagggg tacccagcca
     8821 cttcgggtcc ttgttctctc cgggagagac aaaca
//
DBGET integrated database retrieval system