GenomeNet

Database: RefSeq
Entry: NC_001993
LinkDB: NC_001993
Original site: NC_001993 
LOCUS       NC_001993             236120 bp    DNA     linear   VRL 20-DEC-2020
DEFINITION  Melanoplus sanguinipes entomopoxvirus, complete genome.
ACCESSION   NC_001993
VERSION     NC_001993.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Melanoplus sanguinipes entomopoxvirus
  ORGANISM  Melanoplus sanguinipes entomopoxvirus
            Viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota;
            Pokkesviricetes; Chitovirales; Poxviridae; Entomopoxvirinae;
            Deltaentomopoxvirus.
REFERENCE   1  (bases 1 to 236120)
  AUTHORS   Afonso,C.L., Tulman,E.R., Lu,Z., Oma,E., Kutish,G.F. and Rock,D.L.
  TITLE     The genome of Melanoplus sanguinipes entomopoxvirus
  JOURNAL   J. Virol. 73 (1), 533-552 (1999)
   PUBMED   9847359
REFERENCE   2  (bases 1 to 236120)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 236120)
  AUTHORS   Afonso,C.L., Tulman,E.R., Lu,Z., Oma,E., Kutish,G.F. and Rock,D.L.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-MAY-1998) Microbiology, Plum Island Animal Disease
            Center, U.S. Dept. Agriculture, Agricultural Research Service, P.O.
            Box 848, Greenport, NY 11944-0848, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AF063866.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..236120
                     /organism="Melanoplus sanguinipes entomopoxvirus"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:83191"
     repeat_region   1..7201
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="left inverted terminal repeat"
                     /rpt_type=inverted
     gene            complement(2443..2631)
                     /gene="MSV001"
                     /locus_tag="MseVgp001"
                     /db_xref="GeneID:1449861"
     CDS             complement(2443..2631)
                     /gene="MSV001"
                     /locus_tag="MseVgp001"
                     /codon_start=1
                     /product="ORF MSV001 62 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048072.1"
                     /db_xref="GeneID:1449861"
                     /translation="MFLYLISQNINNVSKISISNTQSMFLYLISQNINNVSKISISNT
                     QSMFLYLISQNINNVSKI"
     gene            complement(6051..6320)
                     /gene="MSV002"
                     /locus_tag="MseVgp002"
                     /db_xref="GeneID:1449862"
     CDS             complement(6051..6320)
                     /gene="MSV002"
                     /locus_tag="MseVgp002"
                     /codon_start=1
                     /product="ORF MSV002 89 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048073.1"
                     /db_xref="GeneID:1449862"
                     /translation="MAEKRNVKVKLVEPDVNKSLSTIIEALQNEIQKSIQDQSNILKQ
                     NLSEDIMNEVEKFESQVTELTNMLKNYVISTIEEKIDNYVNSLIS"
     gene            complement(6347..6814)
                     /gene="MSV004"
                     /locus_tag="MseVgp003"
                     /db_xref="GeneID:1449863"
     CDS             complement(6347..6814)
                     /gene="MSV004"
                     /locus_tag="MseVgp003"
                     /codon_start=1
                     /product="ORF MSV004 155 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048074.1"
                     /db_xref="GeneID:1449863"
                     /translation="MYSCKMEIDLECVVLCKNCNVSSYQYTDGICINCDFPINIKLDI
                     CNKCNKINFVHDGVCGECYANKIVCNGDNTKSTCYIIIINDQKVIEEGVVESSKDIFI
                     SDKFTYNIINVVIISNNKILQINNIDKKYEKVFNRYLIFNYDHVILTQQIDEI"
     misc_feature    complement(6422..>6712)
                     /gene="MSV004"
                     /locus_tag="MseVgp003"
                     /note="TcdA/TcdB pore forming domain; Region:
                     TcdA_TcdB_pore; pfam12920"
                     /db_xref="CDD:257403"
     gene            complement(6574..6756)
                     /gene="MSV003"
                     /locus_tag="MseVgp004"
                     /db_xref="GeneID:1449864"
     CDS             complement(6574..6756)
                     /gene="MSV003"
                     /locus_tag="MseVgp004"
                     /codon_start=1
                     /product="ORF MSV003 60 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048075.1"
                     /db_xref="GeneID:1449864"
                     /translation="MYHLINIQMVYALIVIFLLILNLIYVINVTKLILFMMEYAVNVM
                     LTKLYVMVIIQNLHVI"
     gene            complement(7431..8171)
                     /gene="MSV005"
                     /locus_tag="MseVgp005"
                     /db_xref="GeneID:1449855"
     CDS             complement(7431..8171)
                     /gene="MSV005"
                     /locus_tag="MseVgp005"
                     /codon_start=1
                     /product="ORF MSV005 hypothetical protein"
                     /protein_id="NP_048076.1"
                     /db_xref="GeneID:1449855"
                     /translation="MKMKILFKDYNTKIIYEYIKSLDCGYNLKKKLNIDDKLSKSIIK
                     LTCYNPNISECVLPISIIKFIYTLSEIIILILLLNYYIKMQLNIKRAKHNMNYKKKYC
                     KECELITFQNQFEICEICYKNKVFMYCSHCTDITEVDELNGKCKNCNFINKSYYAYIG
                     VLMYKKYRIKCIICGNYDYISNICSEECKYKYLFKRLFTKRCIQCNMFIDSELNTKFC
                     HYCYFYYYCYWYGYYWYIYPLIFDNYNG"
     gene            8831..9058
                     /gene="MSV006"
                     /locus_tag="MseVgp006"
                     /db_xref="GeneID:1449871"
     CDS             8831..9058
                     /gene="MSV006"
                     /locus_tag="MseVgp006"
                     /codon_start=1
                     /product="ORF MSV006 hypothetical protein"
                     /protein_id="NP_048077.1"
                     /db_xref="GeneID:1449871"
                     /translation="MFESLFSDMCNILRLINDSKNVKFLILQEIHFNSINDISNVHSY
                     IFEFLLPDTSNILILINGSKNLKSIISQSLQ"
     gene            complement(9825..11327)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /db_xref="GeneID:1449854"
     CDS             complement(9825..11327)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /codon_start=1
                     /product="ORF MSV008 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048078.1"
                     /db_xref="GeneID:1449854"
                     /translation="MNNINLYCYKNILKYLDNDDKNNLGIIYELFKYYNCILKVPIYY
                     KYFTYYNLEYIKNLNCSDCNITDFKFLESLINLEILDISYNKNSNIYKCKLSSLLKNL
                     NCNECKIIDFKFLESLINLEILDISYNKNSNIYKCKLSSLLKNLNCNECKIIDFKFLE
                     SLINLEILDVSYNKNSNIYECTLPISLIELKCISCKIIDFKFLESLINLEILDVSSNE
                     YSNISDCKLPVSLIKLNCEFCYIYDFKFLETLNNIKILNISYNKNSNISDCKKLPVSL
                     IKLNCGYCYIYDFKFLEPLINLQKLNISSNSYSNISKCKLPISLIKFKSEYCDITNFK
                     FLERLINLETLTIYMNSRSNISICKLPTSLINLNFIEYDIKNIKFIEKLINLKSLALS
                     SRSSRNISQCILPTSLIVLDLYSCHIKNFKFLEPLINLKKLNISDNGDSNISKCKLPI
                     SLIELYCSKCNIKNFNFLQPLINLQKLDISVNDFYSFNILNHFNYPPFIN"
     misc_feature    complement(11100..11165)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(10968..11099)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(10920..10967)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(10836..10901)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(10770..10835)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(10704..10769)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(10638..10703)
                     /gene="MSV008"
                     /locus_tag="MseVgp007"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            10282..10476
                     /gene="MSV007"
                     /locus_tag="MseVgp008"
                     /db_xref="GeneID:1449872"
     CDS             10282..10476
                     /gene="MSV007"
                     /locus_tag="MseVgp008"
                     /codon_start=1
                     /product="ORF MSV007 hypothetical protein"
                     /protein_id="NP_048079.1"
                     /db_xref="GeneID:1449872"
                     /translation="MYIVNVSKLINRSKNLKFVISQYSDLNLINDIGNLHFDIFEYEL
                     ELIFNFCKLINGSKNLKSYI"
     gene            complement(11374..12138)
                     /gene="MSV009"
                     /locus_tag="MseVgp009"
                     /db_xref="GeneID:1449853"
     CDS             complement(11374..12138)
                     /gene="MSV009"
                     /locus_tag="MseVgp009"
                     /codon_start=1
                     /product="ORF MSV009 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048080.1"
                     /db_xref="GeneID:1449853"
                     /translation="MNNLTYYKEKLKKLNNDLNKIHKLAARNKLYRKYNSILNIPLHE
                     NHIKYYNPKHVRKLQCSGKIPNNLEKLINLECLTICCASKIESKLPISLKKIVFFNCK
                     ITDFKFLENLYNLEKLFIINNKKSNISDCKLPISIIEFCCNKCEITDFKFLEDLYNLK
                     KLYISGNKNSNISHCNLPIKLTELECSYCNILDFKFLKNLYNLKKLFITGNNNSNISN
                     CELPFKLIKFVCINCNITDFNFLKSSNNLRIITISN"
     gene            complement(12364..14199)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /db_xref="GeneID:1449852"
     CDS             complement(12364..14199)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /codon_start=1
                     /product="ORF MSV010 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048081.1"
                     /db_xref="GeneID:1449852"
                     /translation="MNNINLYCYENLIKYLKDSDIHNLASICELFQYYNYQLNICVNH
                     YYKNYYKPKYIRNFNSSDRFGLTITDFTFLEELNNLEILDISNNEKLNISKCKLPNKI
                     KKFICVRCDITDFKFLEPLINLEVLDISYNINSNISNYKLSKQLKEFICEKCNITDFT
                     FLKKLNNLKVLDISENYISNISKCKLPKTIKKFICDRCDITDFTFLEELINLEILDIS
                     NNIISNISNYKLSKTIKKFICARCAITDFTFLEELINLEILDVSYNHKLNISECELPI
                     SLKKLYCNNCFIKNNTLLKKLINLTILNISFNKITDFKFLENLTNLEILDISENKNSN
                     ISKCKLSKTIKKFICSRCAITDFKFLEHLTNLEILDVSYNYEANISEFKLSISLKELN
                     CSDCYKTKDFKFLERLINLQKLNISYTFSSNISTCELTSTLVELNCSTCKINNFTFIE
                     KLYNLKILDINNNPNSNISECKLSTALIELDCTICNITDFKFLEPLINLQKLNICGNH
                     DSNISICKLPLSLIELNCMYCYISDFKFLEPLKSLKILNICKNGSSNIIYCNLSPTLE
                     TIFYAKHDIDFEYINNSLHKLVYDFTSDSDSDSDSDSDSDSGIYD"
     misc_feature    complement(13699..13830)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(13063..>13812)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     misc_feature    complement(13633..13698)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(13567..13632)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(13435..13566)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(13369..13434)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(13303..13368)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(12625..>13338)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     misc_feature    complement(13192..13305)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="Leucine Rich repeats (2 copies); Region: LRR_4;
                     pfam12799"
                     /db_xref="CDD:289563"
     misc_feature    complement(13237..13302)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(13105..13236)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(12904..12969)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(12838..12903)
                     /gene="MSV010"
                     /locus_tag="MseVgp010"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            14293..15810
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /db_xref="GeneID:1449873"
     CDS             14293..15810
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /codon_start=1
                     /product="ORF MSV011 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048082.1"
                     /db_xref="GeneID:1449873"
                     /translation="MNNINLYCYENLLKYLDDKNKHKLAKVSKIFQYYNYQLNIPIHY
                     SYFSHYKSKYIKILNCEKCNIKDFKFLEKLSNLEILNISDNKNSNISKCNLPNKIKKF
                     ICVRCDIKDFNFLERLFRLQMLDISYNYIKSNISKCKLPISLIELYCKNCTNNNFYFL
                     NDLPRLEILDISCNNKIININNIRLSKKLIKLNCSNNNISDIKFLEHLSNLEILNISY
                     NKISYIYNYKLPNNLIELNCKYNNIKNFKFIERLHNLKKLNISNNKKSNISKCKLPQT
                     IINLNIKACDITDFSFLEPLNNLEKLNITEENYDNETNLSKCKLPVSLRVLKSTDFNV
                     CNYLFLERLINLEILYINDFFDFESILIRSLPISLKEINLSSCCYIDDIKFLEPLINL
                     KKLNISDNRNLKITECKLPISLIELDCSSCDITDFKFLEPLINLKKLNISDSRNLKII
                     ECKLPISLIELDCSLCDINDFKFLEPLTNLKTLTISFNTNILECNLPSNLKIINK"
     misc_feature    14521..14652
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    <14629..>15210
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     misc_feature    14653..14721
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    14722..14787
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    14851..14964
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="Leucine Rich repeats (2 copies); Region: LRR_4;
                     pfam12799"
                     /db_xref="CDD:289563"
     misc_feature    14857..14922
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    14923..14988
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    14989..15054
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    15055..15096
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    15121..15186
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    15187..15261
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    15262..15327
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    15328..15396
                     /gene="MSV011"
                     /locus_tag="MseVgp011"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            15855..16247
                     /gene="MSV012"
                     /locus_tag="MseVgp012"
                     /db_xref="GeneID:1449874"
     CDS             15855..16247
                     /gene="MSV012"
                     /locus_tag="MseVgp012"
                     /codon_start=1
                     /product="ORF MSV012 hypothetical protein"
                     /protein_id="NP_048083.1"
                     /db_xref="GeneID:1449874"
                     /translation="MNNINLYCYEISNICKFFSFSKNLKLVILELLHLNSINLFGNLH
                     SDIFEFSLQNIFNIFRLHKDSKNLKSIISLIIQSNSINDIGNLQLDIFEFLLYDIINF
                     FKLCNFSKNVKSIILQDEQSNILIDEGI"
     gene            complement(16436..16654)
                     /gene="MSV013"
                     /locus_tag="MseVgp013"
                     /db_xref="GeneID:1449851"
     CDS             complement(16436..16654)
                     /gene="MSV013"
                     /locus_tag="MseVgp013"
                     /codon_start=1
                     /product="ORF MSV013 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048084.1"
                     /db_xref="GeneID:1449851"
                     /translation="MNNITLDCYENILKYLNDENKHKLAKVSKIFQYYNYQLNIPIYY
                     SYFLHYKYQYIKFLNCEKCNILDFSFLK"
     gene            complement(16728..17462)
                     /gene="MSV014"
                     /locus_tag="MseVgp014"
                     /db_xref="GeneID:1449850"
     CDS             complement(16728..17462)
                     /gene="MSV014"
                     /locus_tag="MseVgp014"
                     /codon_start=1
                     /product="ORF MSV014 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048085.1"
                     /db_xref="GeneID:1449850"
                     /translation="MDYINYEDIEKYNPEYIKKLNCSNRNITDFKFLEKFINLEVLDV
                     SKNPNSNIADCDLSKKLIELNLSKCYLNDLKFIEPLTNLKQLNISYNYNISQKINKII
                     FPISITLFNCSSCFIKDFSFLEKLINLKILIIRENSFSNIIYCNLPTTIVTFDCSKCN
                     IKDFTFLEELNNLHTLNIEKNNNSNISTRILPASLIVLLCRYCNIEDFSFLECLPNLK
                     LLDPGYIHNSNLNECRLPEFLNIINN"
     misc_feature    complement(17349..17414)
                     /gene="MSV014"
                     /locus_tag="MseVgp014"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(17283..17348)
                     /gene="MSV014"
                     /locus_tag="MseVgp014"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(17217..17282)
                     /gene="MSV014"
                     /locus_tag="MseVgp014"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     gene            complement(17532..18692)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /db_xref="GeneID:1449849"
     CDS             complement(17532..18692)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /codon_start=1
                     /product="ORF MSV015 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048086.1"
                     /db_xref="GeneID:1449849"
                     /translation="MVNLNCYKLILKYLNNDLDKIHELSEQCETFREFNELLNIPLYD
                     KHLKYYNPEDVTRLHIKNNNIKDFKFLEQYTNLEILDISGIKDSNISDCNLPSSIIRL
                     KCSSCGITDFKFLEKLPNLQILDISNNKDSNISECKLPVSLKGLECRCCYITNFNFLE
                     PLINLQILDISHNKDSNISFCKLPVSLRYLVLYICNITNFKFLEPLINLEKLNVSYNY
                     KNNLSECKLPVSLIKLNCEFCGITDFKFLEDLVNLEILNISYNNDLKLSTYYLTDKLI
                     EFYCESCDIKDFTFLEYLINLKKLNISKNADSNISECKLPISIIALNCSNCDIINFKF
                     LEPLNNLQILNIYKNNYSEIHLCKLPSSLIELKYDKKDIYNINFLNSLELNK"
     misc_feature    complement(18051..>18542)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     misc_feature    complement(18399..18464)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(18267..18332)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(18201..18266)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(18135..18200)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(18069..18134)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(18003..18068)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(17937..18002)
                     /gene="MSV015"
                     /locus_tag="MseVgp015"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            complement(18933..20651)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /db_xref="GeneID:1449848"
     CDS             complement(18933..20651)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /codon_start=1
                     /product="ORF MSV016 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048087.1"
                     /db_xref="GeneID:1449848"
                     /translation="MINIYCYKNIIQYLDINDIHKFCEISTVYRDYNIELQIPINYDN
                     IKYYDDESIINLDCSKKKDIILDFKFLEKLINLQILNLCFNDPLYIDNIKLSTTLTSL
                     NISKCNKSDLGFLSKLINLKSLDMSYNKKPKIHNDELPTSLTTLNVSNCCIRKFKFLE
                     KLHNLESLNISYNVRSNISKCKLTPRLKNFICKSCNIMDFRFLENLHNLEILNISGNY
                     DPNIYNYISSTKLINFNCLSCGILNFKFLEKLSLLESLKIGDISNSNIYECNLSNTIK
                     YLYYSCYYINDFKNLSKLINLKILNISVRSSNDLIYELPTSLNSISMHVYENFNFNNS
                     NFKNLINLQTLDIRFSKNINIQIYDLPISIVKLDCSHSSILDFAFLENLVNLKKLNIS
                     RNRNANISNYILPISLIELDCTSCNIKDFKFLESLESLKKLYISYNENSNISECILPK
                     SLIRLECKNCNIKDFKFVEPLQSLKDLYISYNKDSNISNCILPKSLIRLECKNCNIKD
                     FKFVEPLSILKYLYMNNNKSSFIYKCNLPISLIELECILCGVRKDSLKFTDRLINLKY
                     FKYKKK"
     misc_feature    complement(20358..20423)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(20292..20357)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(20226..20291)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(20160..20225)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(20028..20159)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(19563..19628)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(19431..19496)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(19365..19430)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(19233..19364)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(19191..19232)
                     /gene="MSV016"
                     /locus_tag="MseVgp016"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     gene            complement(20698..21717)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /db_xref="GeneID:1449847"
     CDS             complement(20698..21717)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /codon_start=1
                     /product="ORF MSV018 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048088.1"
                     /db_xref="GeneID:1449847"
                     /translation="MFYVKYEDIEKFKPEEVKSLDCSHRKIKDFKFLDKFVNLEILDI
                     SNNNDSNISEYIPKSIKELYCKECNISDFKFLEHLFNLEILDISKNINSNIYECNLPK
                     SLKQLYCIQCNISDFKFLEMLSNLEILDISENINSNICDCELPQSLKKLYCKECNISN
                     IKFIENLFNLELLNIFLNNITDLSNIKLSDKLIDFNCSCNIIKDFKFLEKLNNLIKLD
                     IGHNDINSNIDKCNLPVSIVVLDCICNNITNFKFLENLINLKELDVSFNFIYVNNDYD
                     ISNFTKCNLPLSLTKIRCVYFNIEDYSFLTRLVNLEVFITDPHYKEICKYVPPSVSII
                     YSLIK"
     misc_feature    complement(21607..21669)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    complement(21541..21603)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(21475..21540)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(<20917..>21483)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     misc_feature    complement(21409..21474)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(21343..21408)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(21277..21342)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(21211..21276)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(21145..21210)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(21079..21144)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    complement(20944..21078)
                     /gene="MSV018"
                     /locus_tag="MseVgp017"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            20990..21433
                     /gene="MSV017"
                     /locus_tag="MseVgp018"
                     /db_xref="GeneID:1449875"
     CDS             20990..21433
                     /gene="MSV017"
                     /locus_tag="MseVgp018"
                     /codon_start=1
                     /product="ORF MSV017 hypothetical protein"
                     /protein_id="NP_048089.1"
                     /db_xref="GeneID:1449875"
                     /translation="MQSNTTIDTGRLHLSMFEFMSLCPISNLIKLFNFSKNLKSLIIL
                     HEQLKSISLSDNLILDKSVILLRNIFNNSKLNKFSINLIFDILHSLQYNFFNDCGNSQ
                     SQILELIFSDISNISRLDNISKNLKSEMLHCIQYNCFNDFGKLHS"
     gene            complement(21761..23074)
                     /gene="MSV019"
                     /locus_tag="MseVgp019"
                     /db_xref="GeneID:1449846"
     CDS             complement(21761..23074)
                     /gene="MSV019"
                     /locus_tag="MseVgp019"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048090.1"
                     /db_xref="GeneID:1449846"
                     /translation="MYDDFVELMYNEKFSLLTNKMVNDIITDYIFNNMNANFRLLYNL
                     YNVLKNIFYKDKLIVKGGIASQLITQIDNYNIRGDLDISINIEPNKFNKIILDNIKNK
                     NKKTYKITDIFEYINDEKLINDISQIMENYKIEFEQISDNIDFNNMVPISSKYNNNIY
                     IAGAYNKVYNVISNIKYGKFNNNLKFNVNIVDNKFILIRFYYTIKFACNLKKHYDTFV
                     IEKDKYKCKFLFLDISITPLKTNNINNIEINTFLLDNKYNVINDQIQTLFHSFLLKHK
                     IKKRVNRFIILFNKYKNELTQNSNQNRRYIDNKILYSRIKYIFNDENILYNYYFFKDL
                     ISNDKLIYLINNISVFELKDVNIINVKPKKYIRKQLRKAIKIIDAIINSNLQAGNNDK
                     EYEYDENILHLIANEFNLSNNECENIKYNKDLYKSYVKLYHNIYI"
     misc_feature    complement(21764..23074)
                     /gene="MSV019"
                     /locus_tag="MseVgp019"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03016"
                     /db_xref="CDD:165315"
     gene            23121..23648
                     /gene="MSV020"
                     /locus_tag="MseVgp020"
                     /db_xref="GeneID:1449876"
     CDS             23121..23648
                     /gene="MSV020"
                     /locus_tag="MseVgp020"
                     /codon_start=1
                     /product="ORF MSV020 hypothetical protein"
                     /protein_id="NP_048091.1"
                     /db_xref="GeneID:1449876"
                     /translation="MENYNVSHITNMFNLLKTPINYKRLEKYFIKNENFSKHQFKELF
                     NFMQKYIYKIHNIKELYLFNDCIDTSNIKCEYIDYKHITTIIKLLEYPINYKSLEYYF
                     IKNENFSKYQFKLLFTHMRKYILILNNINTLYSLKRNVKLEDIIKQKILKEHENLDNQ
                     TLQELKNIIDNPIYD"
     gene            complement(23656..24438)
                     /gene="MSV021"
                     /locus_tag="MseVgp021"
                     /db_xref="GeneID:1449845"
     CDS             complement(23656..24438)
                     /gene="MSV021"
                     /locus_tag="MseVgp021"
                     /codon_start=1
                     /product="ORF MSV021 MTG motif gene family protein"
                     /protein_id="NP_048092.1"
                     /db_xref="GeneID:1449845"
                     /translation="MMNIFEFIHHNNYNINLGIWFNDFWLNLLNKSEIVITLNTLQFL
                     HYGLKCDLAIKSGYMYIATNLIYKEKNIYKIGYTNDVVGKLVKMNSNRLKFEQFYYVK
                     IYKVNNIFSIQNYIYKKLYPYILNYPYLNCDLNVITNAMENIDKSLLSNNLYTEYQNL
                     KDNFETILTTNRIKFKKLKYHEMSDENREMLNSEVIKLSMSELANTTWCILKTSDFKN
                     LILQINTLPVEEIREYYLLIEKILLNYIKYSLTTIDKSISKK"
     misc_feature    complement(24004..24270)
                     /gene="MSV021"
                     /locus_tag="MseVgp021"
                     /note="T5orf172 domain; Region: T5orf172; pfam10544"
                     /db_xref="CDD:287509"
     misc_feature    complement(23713..>23973)
                     /gene="MSV021"
                     /locus_tag="MseVgp021"
                     /note="MSV199 domain; Region: MSV199; pfam10553"
                     /db_xref="CDD:287517"
     gene            complement(24475..24696)
                     /gene="MSV022"
                     /locus_tag="MseVgp022"
                     /db_xref="GeneID:1449844"
     CDS             complement(24475..24696)
                     /gene="MSV022"
                     /locus_tag="MseVgp022"
                     /codon_start=1
                     /product="ORF MSV022 hypothetical protein"
                     /protein_id="NP_048093.1"
                     /db_xref="GeneID:1449844"
                     /translation="MDYIYKLSYLPDACYNCRSKISIDSYGNCNICGYSVTYDNKYIY
                     RCYSCNKMSYREYKSNDICVKCGLKLIKK"
     misc_feature    complement(24478..>24606)
                     /gene="MSV022"
                     /locus_tag="MseVgp022"
                     /note="Protein of unknown function DUF45; Region: DUF45;
                     cl19237"
                     /db_xref="CDD:302795"
     gene            complement(24753..25850)
                     /gene="MSV023"
                     /locus_tag="MseVgp023"
                     /db_xref="GeneID:1449843"
     CDS             complement(24753..25850)
                     /gene="MSV023"
                     /locus_tag="MseVgp023"
                     /codon_start=1
                     /product="ORF MSV023 ALI motif gene family protein"
                     /protein_id="NP_048094.1"
                     /db_xref="GeneID:1449843"
                     /translation="MDLISKINIITYNNCSYYKAKDIADILNYKSVDYFIKKYVKNEH
                     KINYESTIYVNNSGLYYIMFKSKKHEAEKFQNWIKEENLPEIENNKIEKITTKFQNLL
                     YLKEQIQKQLNQEKEQLKKEKEQLCKQLNKEKEQLEQEKQLKEQYKEYCNRLQKLEKN
                     EIIYVLTNNTDLSNNIFKIGKTNINSIKNRLSTYNTGASDPYYYVFYKNVYDGNKIEK
                     EFNYLMNRYNVLLNNNKINVELYKLYFPDLEYVLNAVIDSNDVLINIIKQKHEEFYIN
                     SINKKSIVNPIIFENNRPNNIFDNLSSNEKKKLIKEAFIKYNKSLIKRKDFEKYFKET
                     FNYKINKKINFWNEMKNNCPIGYKLYYSNKL"
     misc_feature    complement(25599..25826)
                     /gene="MSV023"
                     /locus_tag="MseVgp023"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:280632"
     misc_feature    complement(25083..25367)
                     /gene="MSV023"
                     /locus_tag="MseVgp023"
                     /note="T5orf172 domain; Region: T5orf172; pfam10544"
                     /db_xref="CDD:287509"
     gene            complement(25872..26483)
                     /gene="MSV024"
                     /locus_tag="MseVgp024"
                     /db_xref="GeneID:1449842"
     CDS             complement(25872..26483)
                     /gene="MSV024"
                     /locus_tag="MseVgp024"
                     /codon_start=1
                     /product="ORF MSV024 ALI motif gene family protein"
                     /protein_id="NP_048095.1"
                     /db_xref="GeneID:1449842"
                     /translation="MDLMQGIHVINYNDNLYFKAIDIAKLLKHKNIYRAIKYKISDCN
                     KTLYKNISNTNLSYKKNKMVYINKLGLIELIKESTTIVSPMVINGLINKFNLNLDLPI
                     KFIENNYIDKIIYCFKHHNYKINYKVSQYYIDLYFLDFNIAVDSDKKDKNSQLLIQQY
                     LNCKFIRFNPNSKKNNIYKIINKIHIAILTYTKSKNFYKSLTL"
     misc_feature    complement(<26250..26462)
                     /gene="MSV024"
                     /locus_tag="MseVgp024"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:280632"
     gene            complement(26523..27095)
                     /gene="MSV026"
                     /locus_tag="MseVgp025"
                     /db_xref="GeneID:1449841"
     CDS             complement(26523..27095)
                     /gene="MSV026"
                     /locus_tag="MseVgp025"
                     /codon_start=1
                     /product="ORF MSV026 ALI motif gene family protein"
                     /protein_id="NP_048096.1"
                     /db_xref="GeneID:1449841"
                     /translation="MDIISNIKTINVNNCLYFKGEDCAKILKYKNTYGAIRNNVSKNN
                     KIKFEKNNDIYINKLGLSELIIKHKSIVSTNTINTLIHNFNLNLDLFEKKKYIDIIIS
                     CFRNHRYKENYIIDEFCIDLYFIDHNIAVEYCNDNHINENKLYYNYRYHIINKYLNCI
                     FIKFNPKSVDFNIYYVINQIHNNILNNILH"
     misc_feature    complement(26886..27080)
                     /gene="MSV026"
                     /locus_tag="MseVgp025"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:280632"
     gene            26794..27000
                     /gene="MSV025"
                     /locus_tag="MseVgp026"
                     /db_xref="GeneID:1449877"
     CDS             26794..27000
                     /gene="MSV025"
                     /locus_tag="MseVgp026"
                     /codon_start=1
                     /product="ORF MSV025 hypothetical protein"
                     /protein_id="NP_048097.1"
                     /db_xref="GeneID:1449877"
                     /translation="MIISIYFFFSNKSKFKLKLCINVLIVLVDTIDLCFIINSDNPNL
                     LIYISLFFSNFILLFLDTLFLIAP"
     gene            complement(27086..27979)
                     /gene="MSV027"
                     /locus_tag="MseVgp027"
                     /db_xref="GeneID:1449840"
     CDS             complement(27086..27979)
                     /gene="MSV027"
                     /locus_tag="MseVgp027"
                     /codon_start=1
                     /product="ORF MSV027 tryptophan repeat gene family
                     protein"
                     /protein_id="NP_048098.1"
                     /db_xref="GeneID:1449840"
                     /translation="MENYWNNISKYKFLSEEYIDENKDKLNWYIISRYQNLSEKLIEK
                     YKNKLDWYVISKYQILSENFIEKYKDNLDWYNISRYQSLSESFINKIKDRLDWLYISK
                     HIKLSEKLIEKNKKYVKWNYISKNQKLNEEFIEKFKNKIDWVYISQYQSLSEKFIEKY
                     KDKIDWYNISKYQKLSENFIEKHKNNIHWGVISKYQKLSELFIEKYENKLDWNNISKY
                     QNLSLPFIKLFLHKLNYKKILNKYYIKFNESVICPICLINNKSIFVKTLCNHIFHKHC
                     INIWLMNNSTCPMCRFTLKWT"
     misc_feature    complement(27107..27226)
                     /gene="MSV027"
                     /locus_tag="MseVgp027"
                     /note="Ring finger domain; Region: zf-RING_2; pfam13639"
                     /db_xref="CDD:290367"
     misc_feature    complement(27107..>27226)
                     /gene="MSV027"
                     /locus_tag="MseVgp027"
                     /note="RING-H2 zinc finger; Region: zf-rbx1; pfam12678"
                     /db_xref="CDD:289448"
     misc_feature    complement(order(27110..27112,27119..27121,27152..27154,
                     27161..27163,27170..27172,27176..27178,27215..27217,
                     27224..27226))
                     /gene="MSV027"
                     /locus_tag="MseVgp027"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:238093"
     gene            complement(28169..28594)
                     /gene="MSV028"
                     /locus_tag="MseVgp028"
                     /db_xref="GeneID:1449839"
     CDS             complement(28169..28594)
                     /gene="MSV028"
                     /locus_tag="MseVgp028"
                     /codon_start=1
                     /product="ORF MSV028 hypothetical protein"
                     /protein_id="NP_048099.1"
                     /db_xref="GeneID:1449839"
                     /translation="MNPSFEKLLSLVKYEDKCIFSKTKYKYNYKNISNNDIFITSKGV
                     QTMIYYKKKFDIINYIEKYYKKFNIKRNYIISNYKIDLYFIDYNIGINCDDYESYDQY
                     KKHNYLKIALDDKYINFNHESEFFNLDNLINDINLLIQK"
     gene            complement(28878..29846)
                     /gene="MSV029"
                     /locus_tag="MseVgp029"
                     /db_xref="GeneID:1449838"
     CDS             complement(28878..29846)
                     /gene="MSV029"
                     /locus_tag="MseVgp029"
                     /codon_start=1
                     /product="ORF MSV029 tryptophan repeat gene family
                     protein"
                     /protein_id="NP_048100.1"
                     /db_xref="GeneID:1449838"
                     /translation="MNCINYDYYSCSKIHDVFCNSNNNENIKKYILYNFSIKDWENIS
                     KLKLESKFIKEFADNLFWEYLSPNLSFNDIIEFKKYIHIDKINYNVLPEDFIISNIKI
                     LDIDKISELTLSNKIIKKLSNKLNWKILTYNKIINTKNEYDIYKFINNNEKKVDWEII
                     SKYLNMTIKFATKYKKKLIWDCVSQQPYLDINFLNNFKNDVNWEIVSKYHFLDYETCN
                     VFNENLNWDIISTRKDLSYSFIYQYRFNLDLCCILQNIELPNEFILSVFGCRKPNFNI
                     NNILSECQYNKYVVTRCYHFVHVSYIIESIYTDQKCPICNNKLLIK"
     gene            complement(30078..30674)
                     /gene="MSV030"
                     /locus_tag="MseVgp030"
                     /db_xref="GeneID:1449837"
     CDS             complement(30078..30674)
                     /gene="MSV030"
                     /locus_tag="MseVgp030"
                     /codon_start=1
                     /product="ORF MSV030 hypothetical protein"
                     /protein_id="NP_048101.1"
                     /db_xref="GeneID:1449837"
                     /translation="MSSYKVMSTNKPYKKKDDKIEKFKTLLGVISFVDESKNLIKFKI
                     ESNNDKKIHLTLYIQKAIVKVKLLITQNDVPIGIYQNIVDSNSKIIYVERNNTLPADF
                     LPDDLLEDPENPKSITFENTSKIKNVHGNNYSQIEFYIAPMAPKRIEFDGPAYNTKNN
                     ENRPNVVVSESTSRYQFVGYNSVIVDQSIKIIIDSVIQ"
     gene            complement(30687..31112)
                     /gene="MSV031"
                     /locus_tag="MseVgp031"
                     /db_xref="GeneID:1449836"
     CDS             complement(30687..31112)
                     /gene="MSV031"
                     /locus_tag="MseVgp031"
                     /codon_start=1
                     /product="ORF MSV031 hypothetical protein"
                     /protein_id="NP_048102.1"
                     /db_xref="GeneID:1449836"
                     /translation="MIPVLDNNHNNENFIRIYKKYKKYIKSKKMLKYLKLFKESYIMD
                     NNNNDLAYYSTILLKLKYELIKEIDIYSIIGIIALIIHILSIYFNTNINMYNIINYSI
                     NEQTDFTYFNEFKLMLIAKIDEILEKNKCTIKYEIILNK"
     gene            complement(31109..31309)
                     /gene="MSV033"
                     /locus_tag="MseVgp032"
                     /db_xref="GeneID:1449835"
     CDS             complement(31109..31309)
                     /gene="MSV033"
                     /locus_tag="MseVgp032"
                     /codon_start=1
                     /product="ORF MSV033 hypothetical protein"
                     /protein_id="NP_048103.1"
                     /db_xref="GeneID:1449835"
                     /translation="MSSLNVILLLKFTGPTISNDSAFGIIIDVLIASSSITFISRPSE
                     LANCTKYDVACFIFIIKKRSYK"
     gene            31140..31898
                     /gene="MSV032"
                     /locus_tag="MseVgp033"
                     /db_xref="GeneID:1449878"
     CDS             31140..31898
                     /gene="MSV032"
                     /locus_tag="MseVgp033"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="NP_048104.1"
                     /db_xref="GeneID:1449878"
                     /translation="MKQATSYLVQLANSLGREIKVIDEDAMSTSIIIPKAESLDIVGP
                     VNFKRSITFNDDITFKNDVRFDGSVTFGGDATFNFLRANKIETLEEPSHIKITPDNNE
                     SVQEFVDEEKKINSFTIGPDVTEKFNNISILENNLPNDGFKFSNNVLFYQNDTTDIKD
                     LKNSFLMIDTSIVDKYCIYHIVFTINNGETYIYYKFYFKPTSKVPFKILQQESINDND
                     NKISIKEEDRNLKINYSLERNINNISIRAYYSTM"
     gene            complement(31922..32866)
                     /gene="MSV034"
                     /locus_tag="MseVgp034"
                     /db_xref="GeneID:1449834"
     CDS             complement(31922..32866)
                     /gene="MSV034"
                     /locus_tag="MseVgp034"
                     /codon_start=1
                     /product="ORF MSV034 tryptophan repeat gene family
                     protein"
                     /protein_id="NP_048105.1"
                     /db_xref="GeneID:1449834"
                     /translation="MEEIIVKSYSEKLNDNDILKILNKVFNIDKLIIDQNILHKLIYN
                     KINNKIKINWTKISKIKNLSESFIETYKNYVDWDIISKDQCELSENFIINNYDKLKWK
                     KVTLFQKNLTDNIINIFHDLICWDYNRIYKENIIKEDTICKFNDKVNWDAISLYYPLS
                     LNLIKKYKKKINFEYLLKNKYLKYDLLFEFDNINNWDDISNISYNKYFIEKYKDNLNW
                     DIVTKNLSPLFDEFIEKYKDYVNWTYISQNQPLSIDFIEKYKDNLNWDELSSRNDLTE
                     TIIETYIDKINWLNIYDNYPLSSSFIIKYQKKFKNFNV"
     gene            complement(32879..34198)
                     /gene="MSV035"
                     /locus_tag="MseVgp035"
                     /db_xref="GeneID:1449833"
     CDS             complement(32879..34198)
                     /gene="MSV035"
                     /locus_tag="MseVgp035"
                     /codon_start=1
                     /product="ORF MSV035 hypothetical protein"
                     /protein_id="NP_048106.1"
                     /db_xref="GeneID:1449833"
                     /translation="MKFKYILHFLDICEVFLDKCNNYRDILSIYKVFKSKRINDNIIY
                     YILKNKKYFENNDLIELLNNLTLSYSNINNLLYKYKNHEKIILFIITRFLIPNSIINL
                     HSDVICYILSCYNIKSTIYKNIYKKYKNTLLCNKLTNSVIQHNININKILPFVKLNDE
                     QINLILNNNIYKHVLIKMLLYNDISSDIINKNKYNILNALLLINKVYFSHHKIKKILL
                     NIISNDIEYTKILIFNFNLNEYYISNILNIHNDKNILSLMLQTQNISNHIIDKYYDEI
                     IELINCNNVSSISIYFYFNSIKNHPIYKNIINEYINNNDINRLLYIINIIQLPINTIY
                     VIFEKYKNEYNIILNLLLYQNIIPKMFNKYYKYIYEIFLKNIDNECIINILYNKYKNY
                     KIFNNILKYILENINTYVKLYTLIMNVNLKQKHYEYILKIYKNENLY"
     gene            complement(34251..37490)
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /db_xref="GeneID:1449832"
     CDS             complement(34251..37490)
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="DNA polymerase; catalyzes the replication of the
                     viral genome; The poxviridae are enveloped unsegmented
                     dsDNA viruses; unlike many dsDNA viruses that replicate in
                     the host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins"
                     /codon_start=1
                     /product="DNA polymerase"
                     /protein_id="NP_048107.1"
                     /db_xref="GeneID:1449832"
                     /translation="MSVFNNKIFKSTLSTDEYIDSDHAIHYIKKRTYDESIFKELTND
                     IENIRIHIINWYQYNYSKLERYIVCKCKNIDTDELIFFIFDFYHYFLCSKELVNNNND
                     LKDLINIIDEYKIGEYEILENLKILDVDLIPKDYYNFEETDINIAKYRNLYLFKTIFK
                     IQLESEFNHSFLDYRWFYVLNNIDPSACYNIDITSDNCKIFVTNIHFKFKTYYVSNPK
                     KLFMNKIDPLPCKISRLSFDIECKQTGSFPDPKYMPISHICVECFYDDPKKNKILILT
                     NCNLYEKNAKKNKKVYDMNECEKILNMNSSVIKIYTSEKNILIIFQCLLFHEFDYILS
                     FNGHEFDIPYINTRMDIYNLLKLRMLNPFGFPNLNVIKGDASSRYTHIEYSSILFDLY
                     VYTKKTYVLPEYKLETVCKTKFNINAIAELIENTNNVKIIPKDTKNKLKIFYSVIRTA
                     NYCFINDIAYQINKNDIIDNMQKLYDKDAINQSIGVPFIVKNCNITGNIVVALSKDDI
                     DIGDKSTYENYTIEKANEIGNYCIHDTVLCNKLFETDLIHEVITGYSSQYLLPQNQVF
                     NFTSSNTATGQLLYTLLQEKQMFKKYITEKDEYEGAYVFDPKVKKKYITEPIILEDYT
                     SLYPTIMRQINASPEKIIKVITSNDNIMNAKIDNYIFNTYNYPEYMYIDITNSNKLTT
                     FIITDCRKDGIIPLMLKQGMEKRSFYKKKMNDAKKANDDILYNVYNSMQYTTKIFINS
                     IYGLMASETFMFNSKYCAQFCTALGRKCIKYTADILNNSYNINGIFTVNNVINIFTKT
                     HIQTKYNSNIQECFTLEIVYGDTDSVFIIVHFKNKSLNDTYMLRLCKDIGIFISNTIS
                     NTGIFPKLFNLEFGGVKKWMLFIEKKKYISYDIINYDTLEAKIESKGTSLIKRDYSNF
                     HKHHYKTIIEIIQKSIENKNNNSKNVVIKYIDELIKNLVDNLDKLNYMDFAVTKRYSG
                     KYVSIDNIIELTVNKFNAKYPDYKIRKGDRFLYIYGIYMKPIDKSWNISYIKDISKKM
                     IIIPSNLNNFNISEIRICIESYVIKLITDVSQLLDDKEITEKLSKYKKK"
     misc_feature    complement(34266..37349)
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="DNA polymerase; Provisional; Region: PHA03036"
                     /db_xref="CDD:222962"
     misc_feature    complement(<36261..36788)
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:299142"
     misc_feature    complement(order(36468..36476,36483..36488,36768..36779))
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="active site"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(36471..36476,36483..36488,36768..36776))
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176647"
     misc_feature    complement(35787..36260)
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="DNA polymerase family B viral insert; Region:
                     DNA_pol_B_3; pfam08408"
                     /db_xref="CDD:285593"
     misc_feature    complement(<34713..35699)
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="DNA polymerase type-B family catalytic domain.
                     DNA-directed DNA polymerases elongate DNA by adding
                     nucleotide triphosphate (dNTP) residues to the 5'-end of
                     the growing chain of DNA. DNA-directed DNA polymerases are
                     multifunctional with both synthetic...; Region: POLBc;
                     cl10023"
                     /db_xref="CDD:271693"
     misc_feature    complement(order(35025..35027,35274..35276,35286..35288,
                     35376..35378,35610..35618,35625..35627))
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    complement(order(35022..35027,35031..35033))
                     /gene="MSV036"
                     /locus_tag="MseVgp036"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            complement(37941..38330)
                     /gene="MSV037"
                     /locus_tag="MseVgp037"
                     /db_xref="GeneID:1449831"
     CDS             complement(37941..38330)
                     /gene="MSV037"
                     /locus_tag="MseVgp037"
                     /codon_start=1
                     /product="ORF MSV037 hypothetical protein"
                     /protein_id="NP_048108.1"
                     /db_xref="GeneID:1449831"
                     /translation="MDESFDDFKNYIDSLIIETIESNKVKNFRKLFKIFNNKYIIKHV
                     ISKYQLSKKLLEYIIDTYDEKINLDTIKLFSSLVEYQNFENNLDLLDYFYNNLKIKID
                     NTKDLQICIQLKYILFMIDQKKNKLTM"
     gene            38456..38824
                     /gene="MSV038"
                     /locus_tag="MseVgp038"
                     /db_xref="GeneID:1449879"
     CDS             38456..38824
                     /gene="MSV038"
                     /locus_tag="MseVgp038"
                     /codon_start=1
                     /product="ORF MSV038 hypothetical protein"
                     /protein_id="NP_048109.1"
                     /db_xref="GeneID:1449879"
                     /translation="MHYLFTFGSYYDCKNEFMSFIGFIPNMKPVFIFEKQTFIQDLEE
                     CYPCVTIGIITIVPDIEYEKLKYNNPNGFYYIDVIDVNNNIYTCKYLKNINIKNIKFI
                     FNELIIKNYMYKYYYESLKR"
     gene            complement(38827..39408)
                     /gene="MSV039"
                     /locus_tag="MseVgp039"
                     /db_xref="GeneID:1449830"
     CDS             complement(38827..39408)
                     /gene="MSV039"
                     /locus_tag="MseVgp039"
                     /codon_start=1
                     /product="ORF MSV039 putative Molluscum contagiosum MCV062
                     homolog (vaccinia G6R), similar to GB:U60315"
                     /protein_id="NP_048110.1"
                     /db_xref="GeneID:1449830"
                     /translation="MNDILYPGSVLHTVNHNTYEYYIAPSNFKHGCIYFGKGLKTFLD
                     NSILKHINTSNINDEYEYVINCDGKQTKPEILSIFLKNRNEVRIYNFYNDNVLRKDVM
                     YYASRYSCKYIGTAFSFRNRGKYCFQIIVESFKAAMLKYNLNNLYFNIIIIGGKQFYN
                     SKSISNHINFYLVYKQNNEKKKIYYDNNCIIKL"
     gene            complement(39409..40359)
                     /gene="MSV040"
                     /locus_tag="MseVgp040"
                     /db_xref="GeneID:1449829"
     CDS             complement(39409..40359)
                     /gene="MSV040"
                     /locus_tag="MseVgp040"
                     /codon_start=1
                     /product="ORF MSV040 hypothetical protein"
                     /protein_id="NP_048111.1"
                     /db_xref="GeneID:1449829"
                     /translation="MNNNIFFLHNLIVKDALSIFKTYLPKPIYTIIYEYEKNKKPSSL
                     SKKNSYTLVEHLCKTANGLNMHMIKYDMKIYNVYKTQKLPGNLNIFQFIGLFHDIGKP
                     FTDTNCFLGHSEIGAKIVFDTFKSIIPIDVLHIICWNINFHMCIHTNVNIINILSKSI
                     TDFTKNYKILSMLKRADFEARLINNKFHKYRLIYYKPKIIDNFDGIIIYSSNTFIKRY
                     ETLLKKNFNAIELNLNNCDNILNKTKLIIVSDYKLYRKYIYLKSPNLLKIIFYDNSIK
                     PVKLLSELCTSDKSYNNKAIFHIAYTVIDLMWYTLKDYCL"
     misc_feature    complement(39874..40110)
                     /gene="MSV040"
                     /locus_tag="MseVgp040"
                     /note="HD domain; Region: HD; pfam01966"
                     /db_xref="CDD:280193"
     gene            complement(40406..41293)
                     /gene="MSV041"
                     /locus_tag="MseVgp041"
                     /db_xref="GeneID:1449828"
     CDS             complement(40406..41293)
                     /gene="MSV041"
                     /locus_tag="MseVgp041"
                     /codon_start=1
                     /product="ORF MSV041 putative poly(A) polymerase small
                     subunit PAP-S homolog (vaccinia J3R), similar to
                     GB:L22579"
                     /protein_id="NP_048112.1"
                     /db_xref="GeneID:1449828"
                     /translation="MSIYMKINDFKKPNVLIFDNINNQLKYKPNNVSNKHPGQLKLLM
                     TELQFFNNCNIDALNSKDRPIYVLYIGSGRGYHLIKLLDLYKDYNIKWYFYDPSGHCI
                     SLERMSQYVSINNDYFTEKNINEFKNKKPLLFISDIRSTDGSEPRTKNLIDDYKIQNN
                     IVLNLRPLYSLLKFRYPFPDDFPPEIENEVYVDGIKFLQPFCGPQSTEMRIFVSEQNI
                     ILKNFSKEESILFEEKMYYYNKNYRIINKNDILIAGFILKSTNKFDNMKYIDIIKSLE
                     NSINNQIREDISFNKLDIK"
     misc_feature    complement(40565..41248)
                     /gene="MSV041"
                     /locus_tag="MseVgp041"
                     /note="Poly A polymerase regulatory subunit; Region:
                     PARP_regulatory; cl03179"
                     /db_xref="CDD:295716"
     gene            complement(41321..45280)
                     /gene="MSV043"
                     /locus_tag="MseVgp042"
                     /db_xref="GeneID:1449827"
     CDS             complement(41321..45280)
                     /gene="MSV043"
                     /locus_tag="MseVgp042"
                     /codon_start=1
                     /product="ORF MSV043 putative RNA polymerase largest
                     subunit RPO147 homolog (vaccinia J6R), similar to
                     SW:P20504"
                     /protein_id="NP_048113.1"
                     /db_xref="GeneID:1449827"
                     /translation="MAKVNTEILFSMIPNSIIDSIPIIINSISNDADNNVKSTKLGGT
                     KFNVCSTCRLTKDNGDLGHPGRTPLKKMAIIKPAFIKSVLDTLNALKICSNCKMFRDN
                     EALYKILKKYNIDVQDNKIDPPTELKKEILTLIKLNKQSASKCNNINCQLPIATYKYN
                     TIKAQFYIKVIKDKVISNEQIYKMLIGIPHIVYKCIKSPLSIGNFTPYEAFYTNNILI
                     MVNPARPPNHYDNKDSHIMTTKLNQLVGSIIKEKEIEDIQKIYNDIDHVKPKSPYSRG
                     TLFDTLNTEVAGNKKEGILRSYILARRSDNTGRGVAGPIIAKIGYLGIPEIVASTLTE
                     SIYYNRFTEQKVRDLIYNSPDVKFIVLYNYEALKPATILEVRPEAKINNLLKIKYGDR
                     IEIPLQNYSMILFSRQPSLHKFNIQCAFCLIHKAQTFSTPTAIANSMNLDYDGDELNI
                     YKPKSPSSIEACFLMLSSAILKNNYNFSPAFGLIQDQLIAIHMLYNIKEISLNDAIYI
                     LGEYSYFIRDINKKSYTGVELLSLIFPHNITYNNVIQNGKLILPMIDSRYLVSQSYNA
                     LANLMSQLKNNVFGVHLIDILLYIARNVIKLYGFSVSLHDVIPKLNYIEDMYKFVNNC
                     CKIAHYKLLKYYNSNQLNNNNILLSYDELENIRIDNSKIIINEVIKRIGNVFKDDYLN
                     SIITMKNTRYKINDNELATIIGCTGQQGLDSNEIPKPSVMGRIFDFNVPGNIDMESLG
                     FIKSSTLKGLSFAEMCAHAKYNSIKKILKITCETSSAGSTGRKLVKFMEGIKIDHYNR
                     AVLNNYVIWQNPNYYRMIGGDMSRINILLPNNKMHNYNEIMEIYNIIKIYLVGESFTS
                     ITKETVFPINIQAEIQSYIIDNDNSQELSNDELINIINEYVEKVKVESFFYTQKMDIF
                     KYVLMTYLDRYTVESYNKKLTSLLVSYIFDKINIKLLCSMSPGYAIGFEYAHTIQEKF
                     TQQALSAFHTSKKSGAVAIQLGFTEFKDTVELSKKNKPDIVIANSLHYKKLEIIKMQL
                     EFVCLKYFDPVITILKEINKDNPYLDINVRINKNYINNKISIYQYINMYNNFLNNCNI
                     ISSYWITQNFNDPYIDVIIGVKFKEPTEINSLYFIESLPGAVGKGNFNNKNLKIVPIK
                     MYDFDLNEQDGYSLQFYINSITELSRFDTRDVYIRMNQWFAYELFGIQYAEYVIRNRL
                     VESTNERSMEICYNLLAKLMCETADMVSIKKLRDGKNSIIKHAIHGNQDAIVNAAYNN
                     ILDPAKDSYSSLFLNKQPELGASYYKPYLNLNRYDSIKIELKEEEEVNIKSPIIEDF"
     misc_feature    complement(43805..44656)
                     /gene="MSV043"
                     /locus_tag="MseVgp042"
                     /note="RNA polymerase I subunit A N-terminus; Region:
                     RPOLA_N; smart00663"
                     /db_xref="CDD:214767"
     misc_feature    complement(43004..>44410)
                     /gene="MSV043"
                     /locus_tag="MseVgp042"
                     /note="Largest subunit of RNA polymerase (RNAP),
                     N-terminal domain; Region: RNAP_largest_subunit_N;
                     cl19114"
                     /db_xref="CDD:302765"
     misc_feature    complement(order(43943..43945,43949..43951,43955..43957,
                     44054..44062,44354..44356,44372..44374,44393..44395,
                     44408..44410))
                     /gene="MSV043"
                     /locus_tag="MseVgp042"
                     /note="active site region [active]"
                     /db_xref="CDD:259843"
     misc_feature    complement(order(43943..43945,43949..43951,43955..43957))
                     /gene="MSV043"
                     /locus_tag="MseVgp042"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259843"
     gene            43777..44040
                     /gene="MSV042"
                     /locus_tag="MseVgp043"
                     /db_xref="GeneID:1449880"
     CDS             43777..44040
                     /gene="MSV042"
                     /locus_tag="MseVgp043"
                     /codon_start=1
                     /product="ORF MSV042 hypothetical protein"
                     /protein_id="NP_048114.1"
                     /db_xref="GeneID:1449880"
                     /translation="MIFLLYYITYELQLTDLELIQRQVKNYNYFLKLQMITLENMLRC
                     LMVILAYKYLIHHRHNLNSLNLLLRLVLRMFVLYELNKMHIEY"
     gene            complement(45273..45770)
                     /gene="MSV044"
                     /locus_tag="MseVgp044"
                     /db_xref="GeneID:1449826"
     CDS             complement(45273..45770)
                     /gene="MSV044"
                     /locus_tag="MseVgp044"
                     /note="hypothetical protein; contains a gamma-glutamyl
                     cyclotransferase domain, that can catalyse the formation
                     of 5-oxoproline (2-pyrrolidone-5-carboxylic acid,
                     pyroglutamic acid) from gamma-glutamyl dipeptides; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins; the
                     Entomopoxvirinae are a sub-family of the Poxviridae that
                     infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048115.1"
                     /db_xref="GeneID:1449826"
                     /translation="MYNYFGYGANVNTNYLRHMHKLKISNNSISIGLLVGYSFYLTYS
                     NIIDSVVASIKKDDNGIVFGILYNFNNSIMNKINKQEFVHKNLYSLAKVNVLDLLSNK
                     IISTQAYILNDKNQYFYDAPNRNIYKNIIISGLIENNIPSWYIRHIYNLFVIYEKKML
                     IINNG"
     misc_feature    complement(45300..45770)
                     /gene="MSV044"
                     /locus_tag="MseVgp044"
                     /note="GGCT-like domains, also called AIG2-like family.
                     Gamma-glutamyl cyclotransferase (GGCT) catalyzes the
                     formation of pyroglutamic acid (5-oxoproline) from
                     dipeptides containing gamma-glutamyl, and is a dimeric
                     protein. In Homo sapiens, the protein is...; Region:
                     GGCT_like; cl22886"
                     /db_xref="CDD:304619"
     misc_feature    complement(order(45438..45440,45507..45509,45528..45533,
                     45741..45746,45750..45752,45759..45761))
                     /gene="MSV044"
                     /locus_tag="MseVgp044"
                     /note="putative active site pocket [active]"
                     /db_xref="CDD:119400"
     misc_feature    complement(order(45441..45443,45450..45452,45489..45491,
                     45495..45509,45597..45599,45603..45608))
                     /gene="MSV044"
                     /locus_tag="MseVgp044"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119400"
     misc_feature    complement(45528..45530)
                     /gene="MSV044"
                     /locus_tag="MseVgp044"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:119400"
     gene            45881..46582
                     /gene="MSV045"
                     /locus_tag="MseVgp045"
                     /db_xref="GeneID:1449881"
     CDS             45881..46582
                     /gene="MSV045"
                     /locus_tag="MseVgp045"
                     /codon_start=1
                     /product="ORF MSV045 hypothetical protein"
                     /protein_id="NP_048116.1"
                     /db_xref="GeneID:1449881"
                     /translation="MHHIFNFVILDCVFFLLLARYFLILEFHFLVLAVDCLFDLMYIM
                     YIFFVHLAFPLESIIVHLAFHLESIIVHFAFHLESIIVYFVFHLNFVHFAFHLESIIV
                     HFVFHLNFVHFAFHLESIIVHFVFHLNFVHFAFHLESIIVHFVFHLNFVHFAFHLETL
                     IVHLAFSLETIIVHFAFFLETLIVHFVFSLETIVYFAVPLLFFHFAFSILIVYVVNLL
                     IFLVILVFHLLYCFH"
     gene            complement(45894..47237)
                     /gene="MSV046"
                     /locus_tag="MseVgp046"
                     /db_xref="GeneID:1449825"
     CDS             complement(45894..47237)
                     /gene="MSV046"
                     /locus_tag="MseVgp046"
                     /codon_start=1
                     /product="ORF MSV046 hypothetical protein"
                     /protein_id="NP_048117.1"
                     /db_xref="GeneID:1449825"
                     /translation="MDSETDYIAKAIKEYKKQYEYRMEIYNILLIVLSVLILLFAVLC
                     VLLYVTKKKSIARKCFDVESSGKELQYMNDTIQYTSLKVEDDNYTTVELRSKNSDKKS
                     NIILTTENERNFQHQSNCETPIRSNSNDEKTKARIALIKELQRRKRSQSFKKNTNYDS
                     PKSITYENSDQIFHKRVNTKSSKIMKNRKPIPHKRNKPTNKNNTKDEELEILLEKNNS
                     PNENNTTDEKPKLPEKSINLQHIQLKLKKQNEKIIKELQNKLLSQEKIQNEQLMSQEK
                     MQNEQLLFQEKMQDEQLMSQDEMQNEQNLNEIQNEQLLIQDEMQNEQNLNEIQNEQLL
                     IQDEMQNEQNLNEIQNEQLLIQDEMQNEQNLNEIQNKQLLILDEMQNEQLLILDEMQD
                     EQLLILEEMQDEQKRYTLYTLDQIDNQLQELKNEIQELENNVQEVEKRHSQELQN"
     misc_feature    complement(<45909..46142)
                     /gene="MSV046"
                     /locus_tag="MseVgp046"
                     /note="V-type ATPase 116kDa subunit family; Region:
                     V_ATPase_I; pfam01496"
                     /db_xref="CDD:279793"
     gene            complement(47301..48296)
                     /gene="MSV047"
                     /locus_tag="MseVgp047"
                     /db_xref="GeneID:1449824"
     CDS             complement(47301..48296)
                     /gene="MSV047"
                     /locus_tag="MseVgp047"
                     /codon_start=1
                     /product="ORF MSV047 hypothetical protein"
                     /protein_id="NP_048118.1"
                     /db_xref="GeneID:1449824"
                     /translation="MINIKLIYLSLLISCVYTDKNIVVFNNEIKNVKINDIYGIVIRN
                     YSLNIFDFKLLSEIVNDTYYLEISNNNVNELQNSNLLSENVKVLNLEKSNINYFNLSC
                     FNNIFSIILSYNKINYLYTIDSLKIEYIYMDNIIIYNFTSIIENINKLQYLKKISLRF
                     NHLFKFDKNINCNKCIVDLSDNYIHTIEYFVNTENIIYLYNNCIYEYTRIDKDIYISK
                     CDKNDTFDKCINVYGNKNYTSGIYCINEENKISYTCVNYLVNLETYNNSEYIDFCELN
                     INKIEILWNTLKPIVYYTLKIIGYVILYIIIITIISVEIWIIIKNRNYVILRNQA"
     gene            complement(48322..49188)
                     /gene="MSV048"
                     /locus_tag="MseVgp048"
                     /db_xref="GeneID:1449823"
     CDS             complement(48322..49188)
                     /gene="MSV048"
                     /locus_tag="MseVgp048"
                     /codon_start=1
                     /product="ORF MSV048 putative lipase, similar to Rhizopus
                     niveus lipase GB:D12680"
                     /protein_id="NP_048119.1"
                     /db_xref="GeneID:1449823"
                     /translation="MYTTSFIFWIIVVVILICIAFFIIILNIKRTIYETLSRDVNIEY
                     SEELIYPSNFNIDNFNIEIYKYLINLLINFNKEISNESYIMNGNIYYLYFGNKKIGKM
                     ILDNNNYLWFVIRGTLTYNEFEYDLKISQVNINETIKCHQGFYEIYSNIKSDMIDIIS
                     YISPKKIFCLGHSLGGGILTIASYDLFKLFNKNNICIFIVGTPRVCNENLSNYVNEFK
                     FFNIQNISDIYVNIIPAILPFYHNVSYDKSGEIILFNHNTNNVILNHTLEIYLLNIHN
                     YKKLKPLIENNI"
     misc_feature    complement(48376..>48876)
                     /gene="MSV048"
                     /locus_tag="MseVgp048"
                     /note="alpha/beta hydrolases; Region: Abhydrolase;
                     cl21494"
                     /db_xref="CDD:304388"
     misc_feature    complement(48664..48678)
                     /gene="MSV048"
                     /locus_tag="MseVgp048"
                     /note="nucleophilic elbow; other site"
                     /db_xref="CDD:238382"
     misc_feature    complement(order(48394..48396,48670..48672))
                     /gene="MSV048"
                     /locus_tag="MseVgp048"
                     /note="catalytic triad; other site"
                     /db_xref="CDD:238382"
     gene            complement(49215..49565)
                     /gene="MSV049"
                     /locus_tag="MseVgp049"
                     /db_xref="GeneID:1449822"
     CDS             complement(49215..49565)
                     /gene="MSV049"
                     /locus_tag="MseVgp049"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048120.1"
                     /db_xref="GeneID:1449822"
                     /translation="MVIKFVVQVIIIVAFVISLIIIYFPLSIYELVSKSYTYDPSNDI
                     NQKYNDNKLKIITLFMSNNTIYKAQGNITFDVIKNTITFKFSGNTYTFDIINDIDKYI
                     AMYILANSKENINI"
     misc_feature    complement(49239..49565)
                     /gene="MSV049"
                     /locus_tag="MseVgp049"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03013"
                     /db_xref="CDD:165313"
     gene            49581..50720
                     /gene="MSV050"
                     /locus_tag="MseVgp050"
                     /db_xref="GeneID:1449882"
     CDS             49581..50720
                     /gene="MSV050"
                     /locus_tag="MseVgp050"
                     /codon_start=1
                     /product="ORF MSV050 hypothetical protein"
                     /protein_id="NP_048121.1"
                     /db_xref="GeneID:1449882"
                     /translation="MKPSLSLIIITIIYIITVIIFCIIAFYKKKEPPISPINENVKYI
                     MNDNDNDISIMSSNNLSIALYVATNTTVYTSMQNINTAITPRPDIVFISEANYNNEAA
                     ELKFNSVRIDVPRSNIDNHNLYAQTEIPGYISYSNLNNNHSYIGVNSDSIFSYHDKAK
                     SELYDKICDNNGALLSFPVKIISGTFKDKLLRLIHISQPKGTNGYENMESFKIIYYLF
                     NYIMEKFKDDLVIIAGNCNIRNELIDLAMKKTGLNKKCKLYPPNNYITTNYVNNVVNI
                     NAIIVDYKLILDKHVTISTHSPWLYENRYHYILLLTIHNFKDKNYLRNKEYYRTKWAI
                     TKNGLKANNWSIPKKFIDLEKPDEKHIRDNVKLTDIVDNTKLLQR"
     gene            complement(49658..49855)
                     /gene="MSV051"
                     /locus_tag="MseVgp051"
                     /db_xref="GeneID:1449821"
     CDS             complement(49658..49855)
                     /gene="MSV051"
                     /locus_tag="MseVgp051"
                     /codon_start=1
                     /product="ORF MSV051 hypothetical protein"
                     /protein_id="NP_048122.1"
                     /db_xref="GeneID:1449821"
                     /translation="MKTISGLGVIAVFIFCIEVYTVVLVATYNAIDKLFDDIIDISLS
                     LSFIIYLTFSLIGDIGGSFFL"
     gene            complement(50894..51931)
                     /gene="MSV052"
                     /locus_tag="MseVgp052"
                     /db_xref="GeneID:1449820"
     CDS             complement(50894..51931)
                     /gene="MSV052"
                     /locus_tag="MseVgp052"
                     /codon_start=1
                     /product="ORF MSV052 putative vaccina A23R homolog,
                     similar to SW:P20998"
                     /protein_id="NP_048123.1"
                     /db_xref="GeneID:1449820"
                     /translation="MNELYEIKDIAYKNSMKRTIINYIFSIDGKKQYNLFNNIKKDIL
                     ENNIYDNLKLNKINYIDEIKSCIIDKNCNKIFMFININNLTPILYKGKPKNVKINIIN
                     EGYNSKKIEYHILNNETSFDQYILKKKNKKGFRIKLLNEQCTENYKKMYKNTYYEIEN
                     TYDNITKNLITHYKLILQLDNDKIITEGRLLLPNSISISLKNRSRIIIYANHIQVIVS
                     KQKNETLDTFNNQIKDIMLYFKIIYELYCLENIYLDDIFNLRLYCDFHLFDSSLIYPI
                     NTNNKQIRFFGKGKLNIQSIHNVNDIINIVNEIKIIKNKSITIYKKLMNIDPFNSNIE
                     DIYDLIDKEIL"
     gene            complement(51959..53902)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /db_xref="GeneID:1449819"
     CDS             complement(51959..53902)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /codon_start=1
                     /product="ORF MSV053 putative nucleoside triphosphate
                     phosphohydrolase, Choristoneura biennis entomopox virus
                     NPH-1 (vaccinia D11L) homolog, similar to SW:P24486"
                     /protein_id="NP_048124.1"
                     /db_xref="GeneID:1449819"
                     /translation="MHSIEHIVARHFNYALEKTKDLPKSINNEITNEIIILKDYQYLV
                     SRIFIGLSELNSLLLFWDTGYGKTLTSVYIMKHLKLVFPQWFFVIFIKKSLYVDPWLN
                     TLSKLGMKGQNIKFVLYDSSSSLKQFNVLYRTIISSINTKNRILIIIDEVHQVISRTI
                     EKSSSTQRNFLSIFNKIVKLANSENNKLLCMSATPITNNVLEFKYLINLLRPKIIEFK
                     EDFIVNNTLKNHEQLKNGLISITSYQKISEADSFTNTSYTEGFASKNIFYHNVTMTPE
                     QSNIFNIADKHDKKSALGGLKTMRRLVSSFAFYDIKIKGSMSQIEYNKMVSEKLNEFK
                     SIIGNFKFSNEFIDIFRNNDSFSNAKSSEIEIFDKIKQYSCKYIEACKIILNSNGKVL
                     LYEPLVSFEGISTLKIYFNIFNISYVEYSSKTESTRDYNIDIFNKYDNLYGNKIKVCI
                     FSAAGSEGISFSSINDIIILDLPWKESDIKQIIGRSIRLNSHEELPIEKRYVNVHFII
                     ASTIDGKSVDKEIFDLIKSKQDKINVLNSFMKVISIEQIHSKYKYAEPVENEYIFNNI
                     RHTKIDDVNENNVITKIIVSPIYYCSEDNLNIIYNGYLDKKTGIIYSNNIPIAKLILD
                     ENNIYKFFIKDDKLVYITKSIYE"
     misc_feature    complement(53219..53809)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    complement(53318..53719)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(53699..53713)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(53444..53455)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(52433..52783)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /note="Helicase conserved C-terminal domain; Region:
                     Helicase_C; pfam00271"
                     /db_xref="CDD:278689"
     misc_feature    complement(order(52541..52549,52640..52645,52706..52717))
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(51980..52429)
                     /gene="MSV053"
                     /locus_tag="MseVgp053"
                     /note="Nucleoside triphosphatase I C-terminal; Region:
                     NPHI_C; pfam08469"
                     /db_xref="CDD:285643"
     gene            complement(53915..54163)
                     /gene="MSV054"
                     /locus_tag="MseVgp054"
                     /db_xref="GeneID:1449818"
     CDS             complement(53915..54163)
                     /gene="MSV054"
                     /locus_tag="MseVgp054"
                     /codon_start=1
                     /product="ORF MSV054 hypothetical protein"
                     /protein_id="NP_048125.1"
                     /db_xref="GeneID:1449818"
                     /translation="MSKYNQSFIERSMSSIEKNNYFNATSDNLYLVSRDEQYSTSNTQ
                     KYNTKESSSSQALTRELQNRLGDSQLEGYYLMAQKKSK"
     gene            complement(54245..55645)
                     /gene="MSV055"
                     /locus_tag="MseVgp055"
                     /db_xref="GeneID:1449817"
     CDS             complement(54245..55645)
                     /gene="MSV055"
                     /locus_tag="MseVgp055"
                     /codon_start=1
                     /product="ORF MSV055 hypothetical protein"
                     /protein_id="NP_048126.1"
                     /db_xref="GeneID:1449817"
                     /translation="MKNIIYILYYILISIIIVIVILYITFYENPQNKSLSSLKAYFFS
                     NKDKLNILAIESLDRFVNQWLKKPDELKDHPNRIYDILRSYYSYYSIYYNDETIKNMI
                     PSMISIIKNNNINPILLISILYIYNNTELNEYFYLKSETIQIDNIENAFYVFMIHRLV
                     GLSSDRYIKSKYKLNELNIIKHLDIYVLLHIFNNNNIIFDNDIINKKSLKKFSTKYIY
                     KITKYLNIIPIKQENAYNNYLLICYIANLIFNNSLSISKYYNKNNYNDIIKSAKIIKY
                     YASLIPHNYLQNIIKYSNPIITDTTIKLINRSDFSIFKPKEYIFKYNKNLIISTLSEH
                     LAYMYLNKLYIQCGYNIITVDVNLTDNINTYIKDNIAIIHNDTSIIILYKYLTTISKI
                     HHISGNNITVDNDTININNYKIYIDKSASTFLSSDFTTVSVIDNNQSIIKYFSNNYNV
                     KLDNDLITINNFLIKK"
     misc_feature    complement(<54320..54595)
                     /gene="MSV055"
                     /locus_tag="MseVgp055"
                     /note="Putative auto-transporter adhesin, head GIN domain;
                     Region: DUF2807; cl23960"
                     /db_xref="CDD:305117"
     gene            55659..57548
                     /gene="MSV056"
                     /locus_tag="MseVgp056"
                     /db_xref="GeneID:1449883"
     CDS             55659..57548
                     /gene="MSV056"
                     /locus_tag="MseVgp056"
                     /codon_start=1
                     /product="ORF MSV056 putative vaccinia G1L metaloprotease
                     homolog, similar to GB:X76267"
                     /protein_id="NP_048127.1"
                     /db_xref="GeneID:1449883"
                     /translation="MSKQEVTNVYEDMEITKLNNGIKIIYKPNYENNMSIGFLEFGHN
                     VEFSYKKIGIVHFIEHIISYILQKILKQNVSAFTSFQEMYINFEKFDIINPNILDKII
                     DLLFLNNKIHIDGKYLTKYDIKYIRHHINNEMEYRTINNYSRGFLFIYLLSGYDYAGG
                     TGFDIKYDIVLFNKLLSLISTKNMVFISSDKNVYNYLISKLRSIKKSPKSKIIIRYNL
                     PKQQIKNAQSTLLVSITELYYTATIFIPMDKSSLIGAFIMCNFLFNDFMMNTFNDKIA
                     ISIYKHTMNNLIAVLTFLKKKENLYELVIDKNDVYIFYQCILYNDYIDTFNIFDILSK
                     TNSCEYFKNDIQHTLDLIVNSYNKYDSFFLNIPFFNKYNLYNDKTILDYNIFKTEVVL
                     NIPNFALDKFTSTIYKIPLQLLMKDFTNDTNVCFFLFSDCSYQLTKDGIIMQNFKNVY
                     IDNKYYILHHSFYFDKIPISIYLKYILLFLLTNIFSSLYDIITYYHYIKILYYNSNYV
                     TINSFRSNIHLDSKIINIKTEYNFIVCLINIEISNFKNINFLINEISHTLISKFLIYL
                     VKYHIINNFLVAEAITNNPNKSSKICQKIFAKHKIQNYIIVVSNKSKTINVDELIKSK
                     VIMYK"
     gene            complement(57549..57947)
                     /gene="MSV057"
                     /locus_tag="MseVgp057"
                     /db_xref="GeneID:1449816"
     CDS             complement(57549..57947)
                     /gene="MSV057"
                     /locus_tag="MseVgp057"
                     /codon_start=1
                     /product="ORF MSV057 hypothetical protein"
                     /protein_id="NP_048128.1"
                     /db_xref="GeneID:1449816"
                     /translation="MSYSTYSGPSINTEKQMSVSYSVPLRTRVSAAVGVPTSNLADLG
                     ETTSNPCACNGTTNGSGTTNGSGTTSYSLGYNNGYGSRSYSAGLYSTNPSNINPCDMY
                     PPSQCVTGRDSRGTYRRCSNNNRSYTICYD"
     gene            complement(57944..58207)
                     /gene="MSV058"
                     /locus_tag="MseVgp058"
                     /db_xref="GeneID:1449815"
     CDS             complement(57944..58207)
                     /gene="MSV058"
                     /locus_tag="MseVgp058"
                     /codon_start=1
                     /product="ORF MSV058 hypothetical protein"
                     /protein_id="NP_048129.1"
                     /db_xref="GeneID:1449815"
                     /translation="MDKSLFSLIEKLHKIIPENDYENNIYDLYIFLRDMHSRLGQLIL
                     KCTGVKYDKISSLIDNKNFKNELDLTLLNTYGSSNNNINNTYK"
     gene            complement(58238..58573)
                     /gene="MSV059"
                     /locus_tag="MseVgp059"
                     /db_xref="GeneID:1449814"
     CDS             complement(58238..58573)
                     /gene="MSV059"
                     /locus_tag="MseVgp059"
                     /codon_start=1
                     /product="ORF MSV059 hypothetical protein"
                     /protein_id="NP_048130.1"
                     /db_xref="GeneID:1449814"
                     /translation="MEQESNNGISLIYKPYSQIIDINKETSMCIYISIYQEVIGKIIG
                     KNGITVSNIAKDIGLNIKIDKENMCVVLRTHGLPKDCLIKLVNAYDRIENIIKMDQSE
                     RKFEKLLKK"
     misc_feature    complement(<58373..58498)
                     /gene="MSV059"
                     /locus_tag="MseVgp059"
                     /note="K homology RNA-binding domain; Region: KH;
                     smart00322"
                     /db_xref="CDD:197652"
     misc_feature    complement(order(58385..58396,58409..58414,58421..58426,
                     58433..58447,58451..58459,58463..58465))
                     /gene="MSV059"
                     /locus_tag="MseVgp059"
                     /note="nucleic acid binding region [nucleotide binding];
                     other site"
                     /db_xref="CDD:238053"
     misc_feature    complement(58433..58444)
                     /gene="MSV059"
                     /locus_tag="MseVgp059"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:238053"
     gene            complement(58620..59204)
                     /gene="MSV060"
                     /locus_tag="MseVgp060"
                     /db_xref="GeneID:1449813"
     CDS             complement(58620..59204)
                     /gene="MSV060"
                     /locus_tag="MseVgp060"
                     /note="putative viral membrane protein; found in all
                     sequenced poxviruses; contains an N-terminal transmembrane
                     domain and four conserved cysteines; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="putative viral membrane protein"
                     /protein_id="NP_048131.1"
                     /db_xref="GeneID:1449813"
                     /translation="MNSSIIEIGENNIDYYTQHSTQFKNYKGYMSYILAIIFIIISTL
                     FFVIQTYKWDPLIQLEKFKRIKNNIGSWIKSITEKTAIEITRGKAKILQLPSSAFEFN
                     CYDFGSYYAAVKLDSTTALPTFILRGDGGPWQFKKASEIDVSAQQFCQYTILKNAYTS
                     VSCGLDMYNLLGFSGYFEANNPCQTALDVIVDNN"
     misc_feature    complement(58632..59204)
                     /gene="MSV060"
                     /locus_tag="MseVgp060"
                     /note="putative viral membrane protein; Provisional;
                     Region: PHA03072"
                     /db_xref="CDD:222970"
     gene            59208..60803
                     /gene="MSV061"
                     /locus_tag="MseVgp061"
                     /db_xref="GeneID:1449884"
     CDS             59208..60803
                     /gene="MSV061"
                     /locus_tag="MseVgp061"
                     /codon_start=1
                     /product="ORF MSV061 putative LINE reverse transcriptase,
                     similar to Caenorhabditis elegans GB:U00063"
                     /protein_id="NP_048132.1"
                     /db_xref="GeneID:1449884"
                     /translation="MKYEFMKIKKYIMSFLIESEWQNIKSNIIKVKDKNVTKYNINNI
                     INNIKKNDYTKQCFINELMLFLKNGLKYNKCTITEHEWVKYYKQLLYDEKLISSLPQI
                     IDFDGLDNINIFELNILMEKCKLIQYDINLQTKLLNLFNECWKYKKIPDEWLISKIKS
                     IHKNGDKNICNNYRGINLINWACKLYSKILNNRLKPIMENLISEEQSGFRKNRSIKDN
                     IYILHEIIRNRKKETYFAFIDFKKAFDNVDREILWNIMHLHGYPPHLINAIKSLYENT
                     RIIVKSKVIKINKGIKQGCAVSLSLFNIYIDHIMNEWKQHNIKGIELNDNTNLNYILY
                     ADDLVIISTNKNDFIHGIDMLNNLSKKYKLPISFEKTKVMAFKGTETINIEIYIDDNL
                     IQQVDCFTYLGYEISYTNKINLLYKLNQFDKICNLIINSLKDKVDIKIIIHVYKILAV
                     PIFTSRFIFYELSSEEENIITRHEMHFLKNILDFNLEDDIIRQILDVYKLVDKINESK
                     YKWKERLSSMDYDRLPMKIVNFH"
     misc_feature    59673..60425
                     /gene="MSV061"
                     /locus_tag="MseVgp061"
                     /note="RT_nLTR: Non-LTR (long terminal repeat)
                     retrotransposon and non-LTR retrovirus reverse
                     transcriptase (RT). This subfamily contains both non-LTR
                     retrotransposons and non-LTR retrovirus RTs. RTs catalyze
                     the conversion of single-stranded RNA into...; Region:
                     RT_nLTR_like; cd01650"
                     /db_xref="CDD:238827"
     misc_feature    59688..60425
                     /gene="MSV061"
                     /locus_tag="MseVgp061"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:278506"
     misc_feature    order(59922..59939,60084..60089,60207..60209,60213..60218,
                     60411..60416)
                     /gene="MSV061"
                     /locus_tag="MseVgp061"
                     /note="putative active site [active]"
                     /db_xref="CDD:238827"
     misc_feature    order(59922..59939,60084..60086,60213..60215)
                     /gene="MSV061"
                     /locus_tag="MseVgp061"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238827"
     misc_feature    60087..60089
                     /gene="MSV061"
                     /locus_tag="MseVgp061"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238827"
     gene            complement(60790..61995)
                     /gene="MSV062"
                     /locus_tag="MseVgp062"
                     /db_xref="GeneID:1449812"
     CDS             complement(60790..61995)
                     /gene="MSV062"
                     /locus_tag="MseVgp062"
                     /codon_start=1
                     /product="ORF MSV062 SCG gene family protein"
                     /protein_id="NP_048133.1"
                     /db_xref="GeneID:1449812"
                     /translation="MNGVYFVVIVLIIIIIILFIFYYVNLSVSKFTNDNFDNTSIVDF
                     MVINASMYQEVLDNNFFSAFNNLKIIPTFVFLSNYVEKVIVNDWYNISSNTLPINNFS
                     NKLIYWIFGGWYVAISGRNNWICVRANDSNIKCLNDEEILLKFLISDYDTGYTNNIPV
                     RNSIIISNIMFKMEEIIIINISYIALNFVDKDYYTILCKIFNIFKTNYINDKKFIISG
                     QLGINSKFIQSALETIFDIKEIVSSCYDGAISYVDNNQKVVQSSFIVLDKRLCPYGVR
                     FGIRLLENAMPSYKLVLYATIYNKNRKNKYNNMYNDKLSLNIFENIKSLGYDLSNINW
                     SEIDISELDNNYENANVNLIDDDATMEVIKLSDIIEKINNTTTNGNNATTNGNNATTN
                     GNNATTNGN"
     misc_feature    complement(60883..61926)
                     /gene="MSV062"
                     /locus_tag="MseVgp062"
                     /note="Protein of unknown function (DUF1157); Region:
                     DUF1157; pfam06636"
                     /db_xref="CDD:253836"
     gene            62037..64319
                     /gene="MSV063"
                     /locus_tag="MseVgp063"
                     /db_xref="GeneID:1449885"
     CDS             62037..64319
                     /gene="MSV063"
                     /locus_tag="MseVgp063"
                     /codon_start=1
                     /product="ORF MSV063 putative early transcription factor
                     large subunit homolog VETF-L (vaccinia A7L), similar to
                     GB:X76265"
                     /protein_id="NP_048134.1"
                     /db_xref="GeneID:1449885"
                     /translation="MDYIETFINPQVIFLYNENKKIIKTIFLSKDSMIEDSHVMTVYN
                     YLLSSHSDIFENKPQFINDHVILTFTLEQARGYIKNILGLSDDIILFSIWNNFDYYLK
                     NGIFDPYNIQNMLLVEPNDDKSILYNIYQNIVEGAVFCVTTNKNIGSQLARSNVYSSV
                     YRDYISEIINNIYKNRYAMKSSIIDAMEYSINIDFQDLLRISNIPDYNKTLCISAYNN
                     FYIKGNKITILDNFDSMYESKYLKIYDKNININIYDDVLYVKKLSDFTDILNKYNIKS
                     INIKSLKPKTTIYVYFNTFLNPNLTIEFDFDFFINDTKKTKNIFIDLTGKINIMTSQS
                     HISYRSYNISTDLAKYFTLFILGYSHIFNKVQSKAKIKKIDELYPSRYCQNYKDIKRQ
                     PILIDHIDESRLIKISDNFYTGKEDSTKTYQRKGTKKVYDPLKHGDVYIDSNGLKYQC
                     SSIYYSNMGFLGNIYSATGICYPCCYSKPKIRDTIFNTCVHGTKFIHEEKINPIIVNY
                     GRLILNPSNLSNLPYKLNLLLNSKNQIRIVKHTNRIILAKNYTVIMAYQPSTIIKDFN
                     EMYNFIIENNAILFNDNMMYTHKDIIENNNITPSIFILIQNRIHQFKNINKEQDNDNI
                     TVSIVDSNKINLIKNKFSVLNNITKEISENGITVKNGKCYIDGELVKNKNITYFTKFS
                     NITIRPKSISEYILKYFKKYIDDNIYTDNYFLFNKIFVTNILNIMHENDAILNDFSVI
                     QKKLDDMSSDYIVTQSKTYN"
     misc_feature    62058..64268
                     /gene="MSV063"
                     /locus_tag="MseVgp063"
                     /note="Poxvirus early transcription factor (VETF), large
                     subunit; Region: Pox_VERT_large; pfam04441"
                     /db_xref="CDD:282317"
     gene            complement(64316..65158)
                     /gene="MSV064"
                     /locus_tag="MseVgp064"
                     /db_xref="GeneID:1449811"
     CDS             complement(64316..65158)
                     /gene="MSV064"
                     /locus_tag="MseVgp064"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048135.1"
                     /db_xref="GeneID:1449811"
                     /translation="MDILNLFEKSINISEFNTECSNECIIYEEDCKDYIAYTDYPLEY
                     KNIFSNITKLLSLIDNKTKFKVHRFLTVNLNKLSQFKIKTLLPCYISLYYLSLDNIIL
                     SNFGCKYIFKIDIKYKKISSIVNLASQIENNNIDYDNMRNNISYLIKGWCYILTLHNQ
                     QNFFKFYDVLYDIIGRIFIFNLQQNINLKIKNIPTHFKIYKKIENYIYIALQLLSYKM
                     HFLIDENIKEMINYLSKMCIKKSHNKISYINYTLEIFKNEYKFPVISNDNNNESDEDI
                     MLDD"
     misc_feature    complement(64319..65131)
                     /gene="MSV064"
                     /locus_tag="MseVgp064"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03012"
                     /db_xref="CDD:165312"
     gene            65228..65884
                     /gene="MSV065"
                     /locus_tag="MseVgp065"
                     /db_xref="GeneID:1449886"
     CDS             65228..65884
                     /gene="MSV065"
                     /locus_tag="MseVgp065"
                     /note="late transcription factor VLTF-3; initiates
                     transcription from late gene promoters; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="late transcription factor VLTF-3"
                     /protein_id="NP_048136.1"
                     /db_xref="GeneID:1449886"
                     /translation="MDIIENCKYCGSFDIEKVKDIYTCGDCTQTYTTSSKRLSTKSKP
                     FNNKKMHFSNVMRQMSYNIIIDKNYEEFEELLAKNNLERRSLTTTIVYEFLKDKGIKN
                     YRQTFALMNKSSDSMVSLNADDTITNISILFEDFIKFLYKNGYKRTISYGFIIDRMLE
                     VLNITSNLKPNYTKSNKRDDKSELWNNYVIDLCNRPKTKTIPFIFIPNNKIENEYYFL
                     "
     misc_feature    65228..65878
                     /gene="MSV065"
                     /locus_tag="MseVgp065"
                     /note="late transcription factor VLTF-3; Provisional;
                     Region: PHA03074"
                     /db_xref="CDD:165363"
     misc_feature    65351..65803
                     /gene="MSV065"
                     /locus_tag="MseVgp065"
                     /note="Poxvirus Late Transcription Factor VLTF3 like;
                     Region: Pox_VLTF3; pfam04947"
                     /db_xref="CDD:282761"
     gene            complement(65872..68454)
                     /gene="MSV067"
                     /locus_tag="MseVgp066"
                     /db_xref="GeneID:1449810"
     CDS             complement(65872..68454)
                     /gene="MSV067"
                     /locus_tag="MseVgp066"
                     /codon_start=1
                     /product="ORF MSV067 putative mRNA capping enzyme large
                     subunit homolog (vaccinia D1R), similar to SW:P20979"
                     /protein_id="NP_048137.1"
                     /db_xref="GeneID:1449810"
                     /translation="MEFNINSIIDKFWQFYSTHNPVDNVHNEIELTYLFDNLLLLSNI
                     ASYTETKKKLQLEYIIKYVDKSIKLRQRHEYDYPNFEITNTYMIQKLTNQWTIKKLIN
                     KIEENIGNEKFIIAHNTEEDNIKNNMIIPPKKLIMSNVTIHILSSIYFIINGNVRVEF
                     KLKGTLGAADNNKMMLQTYLNNVLTYKQFTSYYIEIEILNKLSKDEFYRDITNAFRYI
                     YSINNLNNFALSTKNISPSVKTFMLPFDSLYLMDKSKYFLTSKIDGEVVQFTVKNGIC
                     DIVLYNFIFKNKQTNIPNHIVMKGFGEYKKIDNVKTIYPFVFTEIYSTDSKQKYNTRY
                     EMIKFYNDNIKNKEFDITFKHKPIIPIEKDIVNEAIAYYKSLDEKITDGVILLDKESN
                     IDYKLKIDNTVDVIASLNTHKSPNKIHKDGIYMTFNLYMNDEKNITELLKVEMKSNDL
                     ITYDNDINMLKFKNIHNRYGKNILYAPLCCIVEYSFLKSKIVNIRLDKTTKFFKSNYY
                     GNSLKVILDSKTFHEKYVPLDTVGIDYLYTMFKINNEIYDKKNLILNQNVEKYFKEPI
                     ENNQQQRPPLNIFTNLIKTEAISIAASKLCAEIPNRHVLSIDIGRGGDINKYYYIGIS
                     GMLGTDPDISALSEAQERYNSLQTRKRVNSTVYKFSSLNISILDHDYLNKVKSTYMTQ
                     QKIKYFGLIEWQMAIHYSYNVDTKNKILNILKNLSTDGTKVIITCLNGNKIKNLLINN
                     QNIKYKIQDNIYYNISKVNDDKIKVLYDATMTTWLEEYLIYDTIIEDFNKYNFILDDM
                     FEFKDIYNNDAMLVLKTNSLFPRKATSVFYKNILNQNTKDNQVLELMNLFKVYIFKYK
                     SYKK"
     misc_feature    complement(67423..68394)
                     /gene="MSV067"
                     /locus_tag="MseVgp066"
                     /note="mRNA capping enzyme N-terminal, ATPase and
                     guanylyltransferase; Region: Pox_ATPase-GT; pfam10640"
                     /db_xref="CDD:287595"
     misc_feature    complement(65893..66729)
                     /gene="MSV067"
                     /locus_tag="MseVgp066"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:302624"
     gene            67390..67617
                     /gene="MSV066"
                     /locus_tag="MseVgp067"
                     /db_xref="GeneID:1449887"
     CDS             67390..67617
                     /gene="MSV066"
                     /locus_tag="MseVgp067"
                     /codon_start=1
                     /product="ORF MSV066 hypothetical protein"
                     /protein_id="NP_048138.1"
                     /db_xref="GeneID:1449887"
                     /translation="MFKCNIKFLIFYIIIIKFYHFISSIIFLFRISTIYFSKYKWVYC
                     FNIIYFFIFTKSFHNYMIRYICLFIFKYKII"
     gene            68466..68948
                     /gene="MSV068"
                     /locus_tag="MseVgp068"
                     /db_xref="GeneID:1449888"
     CDS             68466..68948
                     /gene="MSV068"
                     /locus_tag="MseVgp068"
                     /codon_start=1
                     /product="ORF MSV068 hypothetical protein"
                     /protein_id="NP_048139.1"
                     /db_xref="GeneID:1449888"
                     /translation="MIYCYILLAVFIVFILMLYFSYTISYLPLYIPNEIVKQGGTIDI
                     SEFIELQEEQIKYEGLINDLQNSIYSSNEIINKYNNTIDIQETTIETLKNTLRQLEEV
                     IDQQQNIQERLYRLQDTIQPLVTLMLIERQIKIYIYNKIKYDLSLIIILSRFLPISPL
                     "
     misc_feature    <68661..>68843
                     /gene="MSV068"
                     /locus_tag="MseVgp068"
                     /note="Spindle Pole Component 29; Region: Spc29;
                     pfam17082"
                     /db_xref="CDD:293687"
     gene            complement(68949..70676)
                     /gene="MSV069"
                     /locus_tag="MseVgp069"
                     /db_xref="GeneID:1449809"
     CDS             complement(68949..70676)
                     /gene="MSV069"
                     /locus_tag="MseVgp069"
                     /codon_start=1
                     /product="ORF MSV069 putative rifampicin resistance (RIF)
                     protein, Heliothis armigera entomopoxvirus RIF homolog
                     (vaccinia D13L) similar to GB:U44841"
                     /protein_id="NP_048140.1"
                     /db_xref="GeneID:1449809"
                     /translation="MNRSLILYDNSNSSRLNIYTLQCNEGNYNIPYQFTSSSSVYENG
                     YLIYKITDSKLEGCNNFGLIITLPEIKGIGSIRYQSNFVYKLIEEFVIETIDNDSTVN
                     TIIKKSGLELLFEFNRSGSKYSKIIGNNIDLCSFNTGYTADDIIFTSREIYFPLITIF
                     DNQFINPHTCLRLFPKTKLQIKLKLTDFKNVMVYDKIYLKNSLKNITNIDLQPYISFT
                     GYNTTGSEIKNRFLEELVLTQDNCTTNCNKKIYYTPDFSSITNVLWSIKVDNFNGKSF
                     ISYPNYPETEESFIKSYVDKILQDLLIVDFNNNFYAKRKFDNKKCKFVEIKPFDVVKH
                     DVNNQCIINIKGIPEGMKLYYHKNILSFSRRNKNDEYNISNKFKYILGEYLEKEDRIY
                     FIDVKHDISISDVSIPIEIWNAEENTSTGDLRSDKMKEMDVIVYDNFIFGMDFISKDL
                     GIFTSTLKTNSNETIHDINSDRPNYEFYLNSNCVYPVTPINDESYPSIFIHRFNQHSI
                     LLSEPSRLIADNDKNFRRISICINWKHYPDTDPRSLFKQYMIIGMTIVKKVTYDNNII
                     NVHIVDERK"
     misc_feature    complement(68967..70649)
                     /gene="MSV069"
                     /locus_tag="MseVgp069"
                     /note="Poxvirus rifampicin resistance protein; Region:
                     Pox_Rif; pfam03340"
                     /db_xref="CDD:281351"
     gene            70701..71039
                     /gene="MSV070"
                     /locus_tag="MseVgp070"
                     /db_xref="GeneID:1449889"
     CDS             70701..71039
                     /gene="MSV070"
                     /locus_tag="MseVgp070"
                     /codon_start=1
                     /product="ORF MSV070 hypothetical protein"
                     /protein_id="NP_048141.1"
                     /db_xref="GeneID:1449889"
                     /translation="MIKIIKIYLLPLLHKSLHYKLTKLVSKRIIYKLRNKCEIDDIEN
                     LDCLFYTHVIKINNSYYYVYNNYHLISFTVDTNNKQDLYNKLKTFDFCYHNNLNEEMM
                     KAYCQVNNIL"
     gene            71179..72507
                     /gene="MSV071"
                     /locus_tag="MseVgp071"
                     /db_xref="GeneID:1449890"
     CDS             71179..72507
                     /gene="MSV071"
                     /locus_tag="MseVgp071"
                     /codon_start=1
                     /product="ORF MSV071 hypothetical protein"
                     /protein_id="NP_048142.1"
                     /db_xref="GeneID:1449890"
                     /translation="MENIYNKFVKSMFDILESNKDKINIALDEIDYEQDSVLLDRVIL
                     TNNLIKNFATYDNNQWENSLKYIPLSTFSFYNNYKGDIKYIYNFGTSEQKKEMLENYK
                     QLVYKLYGKRLTKEIINTGRNIINESDKVNFEISELIKESSNYKNPTFIAHLIDLIVY
                     NDEIRNNFINSNPLFEKLNEIDIESTIRQLIISIMNIQITSVSYMQSMSDVTSTYIKE
                     LFNNSKLLSHIMDEFKSDTSSNYNCGCNEILCNNMLKCNKIYDDIKIVEKDPSLYRPS
                     HIKKHIRHVILKIINILYIMNQTQMLHNKKIELFEYIKQISESNDDFIELLDKLNINS
                     TTQMKWSELIIKIYENRDIIFDITNKYKEPFFNSIIEYINKNEQINDELKSTIIEFIK
                     EHIETIDLDECKEYIKNIDINTPNISRVIDTIEKYLSVPLKKQLYKRIYK"
     misc_feature    <71308..>71994
                     /gene="MSV071"
                     /locus_tag="MseVgp071"
                     /note="Tht1-like nuclear fusion protein; Region: Tht1;
                     pfam04163"
                     /db_xref="CDD:282073"
     gene            72504..73400
                     /gene="MSV072"
                     /locus_tag="MseVgp072"
                     /db_xref="GeneID:1449891"
     CDS             72504..73400
                     /gene="MSV072"
                     /locus_tag="MseVgp072"
                     /codon_start=1
                     /product="ORF MSV072 hypothetical protein"
                     /protein_id="NP_048143.1"
                     /db_xref="GeneID:1449891"
                     /translation="MNYWESKSICTVFTKYNDTEIINKIDPVKSNIDHSLYKQYTIGY
                     MSNFNIVNICKFVNKHSNYIFDIDTFSWLVLNPFSDPSFNIVLYDNDKIVATIVGILR
                     SIKIKNEIHKIIHTTFLTVDENYRKQGIHFYIIDKLMENAFNKGVLLGIFSTMKKIKK
                     IKCVNVQDTYIIKSDSKKYKENNNVFDYKKLNQKNDDLYFIYNDMEIEYWFNKKYCHI
                     ISIYNNLFCFLKIKYKNNENLNILIEQYIHNKNINKYSIPNNSIMFSQYIQLPQIKLQ
                     NQIYTYIYNLNFNNLKCNICMF"
     misc_feature    <72741..72956
                     /gene="MSV072"
                     /locus_tag="MseVgp072"
                     /note="N-Acyltransferase superfamily: Various enyzmes that
                     characteristicly catalyze the transfer of an acyl group to
                     a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:302625"
     misc_feature    order(72858..72866,72894..72899)
                     /gene="MSV072"
                     /locus_tag="MseVgp072"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(73397..76309)
                     /gene="MSV076"
                     /locus_tag="MseVgp073"
                     /db_xref="GeneID:1449808"
     CDS             complement(73397..76309)
                     /gene="MSV076"
                     /locus_tag="MseVgp073"
                     /codon_start=1
                     /product="ORF MSV076 putative spheroidin, similar to
                     Amsacta moorei entomopoxvirus SW:P29815"
                     /protein_id="NP_048144.1"
                     /db_xref="GeneID:1449808"
                     /translation="MNIALKVVEVTQVNDSTWNVRFGSPFDTYKFNGKYNFVVPEYNN
                     DFVNIETSDTNVVISDGSQTKYLTFENDASEFTLVFSFNSTVDSDQISSYLTSLIKTN
                     LAPLNGKSVVLNTNVLINGVVDNTYACTHNFWLVVHNQNNVKFLLSNSDIVNHSLVVP
                     KDTTELHVPAQRLLPYKQTFLYVSETDTDVANVVNLVLDLHQGVNVSVSLGTFVSADS
                     ELSETAQKKIISLMQKIGRFDIVNADTGCVYKRNLPLKENTTYSFYVNQNGVKVQPKP
                     KLVYDGKVVHPFSVYSDDDDYVVVESGSTKILPSIYFKLYSKIKSLLKIRLQDEDDVN
                     WGEGFDLSIECEDFNNTSYSFTNNTRLPIGLYAVKYLYLGSQKDQINPSYIKWKDYVA
                     ELEYESEGKYKVLSKFYIFSNRPVITLYVVGEILDSDEDDETTLKLSLVGPSIHVRDS
                     IYYDENGLNLFKCKGNGISLLKALKLRWLNAVLKKGANFTLDGNITVGNKKFYNILDT
                     KGDSDTVNYYNNALLAKSNFNANNGLLALSVDPVNIQDLPLPDWLVCKLSGSATDIHN
                     AVIAFTNSNSKYYHNIVKGILSLLIGGNFINFSIKDTLCKYPGLIFLFARIFKKINEK
                     LRVLGKRAFYSLTYESEFADGDQLLPYCKQRGLIKEFIKNWRKTGCAALMKDRAYQKP
                     LLIISELSNVNQTESNDIGSSVANSATTPLNLIAELLGSQNSNDVTNKVVISGTGSFG
                     NIGDNDISESVISSILEFMEKNGPGGLLLHDSENSPIRRFRNSTQFLSQKNDICKLIK
                     LTTFNSCDFSAFIRSGSTVDDVPLDSNENPVVDEDTHQTILPYPYPWPWPYNRCPKGC
                     VCVRPCRKLFFNRCPKGCTCVKLPLKRCRKPYWPWADGYPHSHQHSHLLTHSHSHNHA
                     NTFHHHHSWSSCGHTHPHSYNKCQLSGVNVANHNDTEDNYDVDNVVSSDNNAVELG"
     misc_feature    complement(73613..76309)
                     /gene="MSV076"
                     /locus_tag="MseVgp073"
                     /note="Entomopoxvirus spheroidin protein; Region:
                     Spheroidin; pfam05541"
                     /db_xref="CDD:253243"
     misc_feature    complement(<73544..>73645)
                     /gene="MSV076"
                     /locus_tag="MseVgp073"
                     /note="Sulfite exporter TauE/SafE; Region: TauE; cl21514"
                     /db_xref="CDD:304402"
     gene            73510..73710
                     /gene="MSV073"
                     /locus_tag="MseVgp074"
                     /db_xref="GeneID:1449892"
     CDS             73510..73710
                     /gene="MSV073"
                     /locus_tag="MseVgp074"
                     /codon_start=1
                     /product="ORF MSV073 hypothetical protein"
                     /protein_id="NP_048145.1"
                     /db_xref="GeneID:1449892"
                     /translation="MNVDVYVHMMTMNDDDGKYLHDYVNVNVLINVNVDVNVDNHQPK
                     ANMVFYIFSMAILHKYSLLDIY"
     gene            73619..73846
                     /gene="MSV074"
                     /locus_tag="MseVgp075"
                     /db_xref="GeneID:1449893"
     CDS             73619..73846
                     /gene="MSV074"
                     /locus_tag="MseVgp075"
                     /codon_start=1
                     /product="ORF MSV074 hypothetical protein"
                     /protein_id="NP_048146.1"
                     /db_xref="GeneID:1449893"
                     /translation="MWITISPRPIWFSTSFQWQFYTSTAFWTSIKKQFSAWSYTNTAF
                     WTSIIWPWPWIRIRQNCLMCIFIYNWIFITI"
     gene            76302..76493
                     /gene="MSV075"
                     /locus_tag="MseVgp076"
                     /db_xref="GeneID:1449894"
     CDS             76302..76493
                     /gene="MSV075"
                     /locus_tag="MseVgp076"
                     /codon_start=1
                     /product="ORF MSV075 hypothetical protein"
                     /protein_id="NP_048147.1"
                     /db_xref="GeneID:1449894"
                     /translation="MFIYYNYFIFFLKFLLVLENEKIISFIKYCIIIMHNHACDKIIF
                     NFGIFYAICCTFTIAIHLQ"
     gene            76411..78207
                     /gene="MSV077"
                     /locus_tag="MseVgp077"
                     /db_xref="GeneID:1449895"
     CDS             76411..78207
                     /gene="MSV077"
                     /locus_tag="MseVgp077"
                     /codon_start=1
                     /product="ORF MSV077 hypothetical protein"
                     /protein_id="NP_048148.1"
                     /db_xref="GeneID:1449895"
                     /translation="MHVIKLFSILAFFMPYVVPSPLPYICNDNKEHYFKLNNNLEHSD
                     FECNYDSAETINVSIWKKTNIVVDSFIFTFFKIPCNALDLFISGAFSFYQNQAISLTD
                     INVYIKNVSTIIIDGIEYKFKNMAGEFHTCNIKDQKYGIYVKYEKCQHVFKGKNNYIK
                     KFGSQRKNDEYSNIFKRHCSNLKYEIGKCILVNDLQVKEYYIWDNSHKFDIKFSEQYF
                     ITPYIFVSNTGVLTKFENGFAELYSISSSNQIIKYDHVIITCKSDFIINIENGYFISM
                     PFNEGQTVLSGRELVNWSQTFGKTICRNTENKHFVLNVTLANSLKNEYINIARFQEVL
                     DKKLKIITKNLDTLCKNYVIYRKIYTEICKNNPQYCMKYFLNHYNVKARYIGGNIIGI
                     KYCIEITDFEIIKDYNYKTDKCEIFVPMKININNTKFIGYMNPSTNEVFTESPKNDYC
                     DSITYVDINDTLMYISNNQINVSTQKIHTYGHETLLTNKKISPIILKNINISDLYFEQ
                     STFQDVYDIAYHHFDELINPKQTYNFDTSSIWDFLNFHGIFHIIFIGFVIFGIFILVR
                     YASQIFSNCASIFRKTKVIYENIPMKNLNQSS"
     gene            complement(76741..76944)
                     /gene="MSV078"
                     /locus_tag="MseVgp078"
                     /db_xref="GeneID:1449807"
     CDS             complement(76741..76944)
                     /gene="MSV078"
                     /locus_tag="MseVgp078"
                     /codon_start=1
                     /product="ORF MSV078 hypothetical protein"
                     /protein_id="NP_048149.1"
                     /db_xref="GeneID:1449807"
                     /translation="MSFKNITVFIIFSLGTKLFYIIIFAFENMLTFFIFNVNSIFLVF
                     NIACMKFTSHIFKFIFNAINYNS"
     gene            78257..78673
                     /gene="MSV079"
                     /locus_tag="MseVgp079"
                     /db_xref="GeneID:1449896"
     CDS             78257..78673
                     /gene="MSV079"
                     /locus_tag="MseVgp079"
                     /codon_start=1
                     /product="ORF MSV079 hypothetical protein with C2H2 zinc
                     finger"
                     /protein_id="NP_048150.1"
                     /db_xref="GeneID:1449896"
                     /translation="MECSNCLNYNIQKFKYDYNKLSNSINMIFTCDKCNYDTECVLHI
                     KSHRKKEYHIPGYNNCGPGTDVIYNIRNDILPRNETDVHCFFHDIAYYIYKDKERRKK
                     ADKILYKNLLNLKKPHSISIPIINAILKIKMINNMY"
     gene            78363..78593
                     /gene="MSV080"
                     /locus_tag="MseVgp080"
                     /db_xref="GeneID:1449897"
     CDS             78363..78593
                     /gene="MSV080"
                     /locus_tag="MseVgp080"
                     /codon_start=1
                     /product="ORF MSV080 hypothetical protein"
                     /protein_id="NP_048151.1"
                     /db_xref="GeneID:1449897"
                     /translation="MIQNAYYILNHIEKKNIIYLVIIIVDLVQMLFIILEMIYYQGMK
                     QMYIVFFMILHIIFIKIKNVGKKLIKYYIKIY"
     gene            78693..79766
                     /gene="MSV081"
                     /locus_tag="MseVgp081"
                     /db_xref="GeneID:1449870"
     CDS             78693..79766
                     /gene="MSV081"
                     /locus_tag="MseVgp081"
                     /codon_start=1
                     /product="ORF MSV081 putative protein phosphatase 2C
                     (PP2C), similar to Mus musculus SW:P36993"
                     /protein_id="NP_048152.1"
                     /db_xref="GeneID:1449870"
                     /translation="MGNLLPLPIINGTSKSLLIKNNNIQFSLIQGYRKTMEDFYSYYI
                     DNKYLYLALFDGHGGSYVSSYLHNNFLKYLAKSIKSYNIDSYKSIDLLYNDIGKVIKN
                     VYIEIDKLIYDNIDFSKSQGSTVVSTIITNNYIIFSHCGDSPVSAYNGKNIIYKSIDH
                     KPINKKERDRIIKSGHKIINNRIDGIIDISRCLGDFKFKGLKSAIIPIPVVKIIKKDT
                     CKFFILMTDGITNFISISEICNYIEYKLQISQDISSICDSILMRAIYNESSDNISICL
                     TVIQKYMINDTLKNEYDNFIKHVNKIVVNEIKKKPQIYLNKDPKIIRILKLIKSLDSK
                     SFKFSLAYEFRLISDILDKHEIF"
     misc_feature    78771..79520
                     /gene="MSV081"
                     /locus_tag="MseVgp081"
                     /note="Serine/threonine phosphatases, family 2C, catalytic
                     domain; The protein architecture and deduced catalytic
                     mechanism of PP2C phosphatases are similar to the PP1,
                     PP2A, PP2B family of protein Ser/Thr phosphatases, with
                     which PP2C shares no sequence...; Region: PP2Cc; cd00143"
                     /db_xref="CDD:238083"
     misc_feature    order(78789..78791,78801..78806,78855..78863,79371..79373,
                     79500..79502)
                     /gene="MSV081"
                     /locus_tag="MseVgp081"
                     /note="active site"
                     /db_xref="CDD:238083"
     gene            79775..80194
                     /gene="MSV082"
                     /locus_tag="MseVgp082"
                     /db_xref="GeneID:1449898"
     CDS             79775..80194
                     /gene="MSV082"
                     /locus_tag="MseVgp082"
                     /codon_start=1
                     /product="ORF MSV082 hypothetical protein"
                     /protein_id="NP_048153.1"
                     /db_xref="GeneID:1449898"
                     /translation="MADIDEIHINDLYINTENNTSKSLKTFLSTLQSKYEKNPDNYIK
                     NISAAGHKRKRNNNNNSGERGEKHELSDTSIIPPTHCVSCNKETKNKNNGFLIKNKNN
                     YRLHSICDVCNKQKSSFIGASKVPEKLYNKINEKKQK"
     gene            79878..80063
                     /gene="MSV083"
                     /locus_tag="MseVgp083"
                     /db_xref="GeneID:1449899"
     CDS             79878..80063
                     /gene="MSV083"
                     /locus_tag="MseVgp083"
                     /codon_start=1
                     /product="ORF MSV083 hypothetical protein"
                     /protein_id="NP_048154.1"
                     /db_xref="GeneID:1449899"
                     /translation="MKKILIIILKIFQQLDIKENEIIIIIQVNEVKNMNYLILLLYLQ
                     HIALVAIKKLKIKIMDF"
     gene            80206..80577
                     /gene="MSV084"
                     /locus_tag="MseVgp084"
                     /db_xref="GeneID:1449900"
     CDS             80206..80577
                     /gene="MSV084"
                     /locus_tag="MseVgp084"
                     /codon_start=1
                     /product="ORF MSV084 hypothetical protein"
                     /protein_id="NP_048155.1"
                     /db_xref="GeneID:1449900"
                     /translation="MYEQVKEFIKLNNITLSESYLNQLNVDINKIYYVIISCEEIKDK
                     SLYDENTLIIYNDDSISEYIINKLFEIIIQYDHIKILGNCTNINLTDKKKLKCYYIKK
                     DKNKKLDDFIKLYKAILILKN"
     gene            complement(80716..81072)
                     /gene="MSV085"
                     /locus_tag="MseVgp085"
                     /db_xref="GeneID:1449806"
     CDS             complement(80716..81072)
                     /gene="MSV085"
                     /locus_tag="MseVgp085"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048156.1"
                     /db_xref="GeneID:1449806"
                     /translation="MKVYIILIILVSSLIMIILMINYSQYESNILRKLSNEYLSSLIY
                     EPLVLNEYKEGDINEIKNIVDNLIAQYNELLQEYQLIENNIKDLEIIIQENVDEIHFL
                     TNEIDKLKENVTNLSI"
     misc_feature    complement(80719..81072)
                     /gene="MSV085"
                     /locus_tag="MseVgp085"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03011"
                     /db_xref="CDD:165311"
     gene            complement(81079..83232)
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /db_xref="GeneID:1449805"
     CDS             complement(81079..83232)
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /note="RNA helicase NPH-II; catalyzes the unidirectional
                     unwinding of duplex RNA with a 3' tail; RNA helicase
                     NPH-II; The poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins"
                     /codon_start=1
                     /product="RNA helicase NPH-II"
                     /protein_id="NP_048157.1"
                     /db_xref="GeneID:1449805"
                     /translation="MDMQNITDLYKIDKKTTLYPNIINKYNYMAYLLFPNNATIFNSY
                     ITKKEVFEYPMQFAIALYPVYKLYWHNINICLNNRFIYLSNEFKNNISINTVYNLLYN
                     NELKFEDDNIIINGKNLKISYSAYSYVTIISQITINISSLNKYQIYGIIESANYLGIL
                     SSYKQNKYFDKNLFSFTKSELRSTMIDVQLKIFEIFISKKNCIISGGTGIGKTTVIPK
                     LFWWFNLLFDGYEFWNTSNENKNINDFIFKPNFEKNKTILSLPRKALIRQMGINYIKS
                     LGFDNISGSPIILKYKDVKKEKEYYNNNPILYPFVLSVNRITINNIKHSNSVIIDEIH
                     EHDKFGDIAIAIARTKKKKYNIRNIVLISATIESDIDNIRIYFKNIVEIYIPGVSLFP
                     VKEIECEDKDVISILKNYMPSVGKSVIIFYETIKKINEYKEILESILIDKIYKIYTIH
                     SKITNINAIINKLQNDKKHIHIILSTNYLESSITITNATLVIDNGKMYQKKFLTGSTM
                     YITESMYIQRKGRVGRISKGTYIRTYSKDLLQTTFKHINYQYLWEYILVFKYNNMDYY
                     NDLFIKPDDPSRIENTLNYLKNINIDIDKYISLLYSKFNKYEINMVEYLSIYINNSTS
                     DIILLNEFIDNIRNSDKYIFPYRLTEIFHKLNVRCRCINITETEEGNINCSFVILNNY
                     DGDPFFKLSFEKSNLICRYNKIYYIVSMSPLYLID"
     misc_feature    complement(81082..83139)
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /note="RNA helicase NPH-II; Provisional; Region: PHA02653"
                     /db_xref="CDD:177443"
     misc_feature    complement(82732..83133)
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /note="Domain of unknown function (DUF3503); Region:
                     DUF3503; pfam12011"
                     /db_xref="CDD:288834"
     misc_feature    complement(82114..82674)
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /note="DEAD/DEAH box helicase; Region: DEAD; pfam00270"
                     /db_xref="CDD:278688"
     misc_feature    complement(order(81799..81807,81880..81885,81955..81966))
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(81658..81936)
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     misc_feature    complement(order(81661..81663,81670..81672,81682..81684,
                     81781..81783))
                     /gene="MSV086"
                     /locus_tag="MseVgp086"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            83258..83488
                     /gene="MSV087"
                     /locus_tag="MseVgp087"
                     /db_xref="GeneID:1449901"
     CDS             83258..83488
                     /gene="MSV087"
                     /locus_tag="MseVgp087"
                     /codon_start=1
                     /product="ORF MSV087 putative thioredoxin, similar to
                     Neurospora crassa GB:D45892"
                     /protein_id="NP_048158.1"
                     /db_xref="GeneID:1449901"
                     /translation="MDDNSITKNIRTYYIPDICMNCKKLNPEKVLVTDGKFKTNFLSF
                     DQFNKNDTTFLEYASGGSSIPIKLFFNNGHYR"
     gene            83508..84125
                     /gene="MSV088"
                     /locus_tag="MseVgp088"
                     /db_xref="GeneID:1449902"
     CDS             83508..84125
                     /gene="MSV088"
                     /locus_tag="MseVgp088"
                     /codon_start=1
                     /product="ORF MSV088 hypothetical protein"
                     /protein_id="NP_048159.1"
                     /db_xref="GeneID:1449902"
                     /translation="MADAIIVLTMDKIAFKCEDCTEIIPYRIVMNIIFNNKVVYKKLF
                     LLNYDLYNISVDKNKLFSTINNKYYFSTFPTKEHKGKYVINFINKLNKDPQDVRNFIL
                     TIYFLLKYVYKIIPCWYIYDYNDLKWLINNYKGYKIYNTNRFHVSSIIIKDKLPNIPY
                     NAEIINNMIVNYCNTQINNTNLVRYVDKIDNISSLLELYQSFLSL"
     gene            complement(84146..86650)
                     /gene="MSV089"
                     /locus_tag="MseVgp089"
                     /db_xref="GeneID:1449804"
     CDS             complement(84146..86650)
                     /gene="MSV089"
                     /locus_tag="MseVgp089"
                     /codon_start=1
                     /product="ORF MSV089 Putative NTPase, Rabbit fibroma virus
                     C5 (vaccinia D5R) homolog, similar to PIR:G41700"
                     /protein_id="NP_048160.1"
                     /db_xref="GeneID:1449804"
                     /translation="MDKYIYLQKGLKVKLLDKKKCILEEEYVNQIDKLTLDELLEKIN
                     NAIENNDSIEEYHEIILNEYHDRFKLFFDIELKKKYNSDYFDSTFENFKDEISSFLAS
                     VFIEFYNINSTLELNEDDLKNHIFDGISATTSNDPNKISTHVFFTNILVSNSVFTTLK
                     IHIHNYKKRTTNELILGIDEQVFKNNTLLRCIYSKKSNSKYYHTEYDDQIESVNDLQK
                     YLVTFVDDDEDNILIDTIDTDECELTVEDGIFPHLKVFNGHVFLEKFRQTLFKASITI
                     DSNTKTLIKNLETIELNQTLDIYLQTQHACICGKITHKNHHYLFFNQNNIQLIKYGNR
                     HNCRIIKFEYPKLDSTAITKFIKDLDIVRKVNKDLKLYWDGMKWMPIIDDMIYGKIAL
                     KLLDEYKNTMLLHDKKYVSTKYFKEAKVRILTDLSDSTDTYNTNPYLIQMCNGIFDLK
                     NNIFIYGIEAKKYIKPNYIPLSYKNIEEMSEEEYNNYMENYNMLVTVINNIIPENHKD
                     RKIFECNISSSLLQISKETITFLVGPTKSGKTTIKLLLAALFGNLFLTIPIIDYVKQH
                     NPHSPNAWLGKLNGKLVCFASESNACDKFDSQTIKHMTERIIISRVLNSNEGDQHNYA
                     TQIIDTNIFPSIDITDNAILERLAVINIDHSYFINSTKIDSVNENILKDRNNILDTRV
                     IRPRNPNFSNKIENGDFSLALFNILKEWVRKYHLDELKIIHTPEKFIKTTNTNKKMDT
                     PNEDNQNNKMLTLVSSINFNNTNKNIKMHNIKCNYNRYYSTIKKLTRSRKAIEIIVIN
                     EKFIKEFEHLIPNEYKKVILNQPYVALEHLIEPKEI"
     misc_feature    complement(85208..85540)
                     /gene="MSV089"
                     /locus_tag="MseVgp089"
                     /note="D5 N terminal like; Region: D5_N; pfam08706"
                     /db_xref="CDD:285868"
     misc_feature    complement(<84689..85339)
                     /gene="MSV089"
                     /locus_tag="MseVgp089"
                     /note="Virulence-associated protein E; Region: VirE;
                     cl23993"
                     /db_xref="CDD:305150"
     gene            86786..87928
                     /gene="MSV090"
                     /locus_tag="MseVgp090"
                     /db_xref="GeneID:1449903"
     CDS             86786..87928
                     /gene="MSV090"
                     /locus_tag="MseVgp090"
                     /codon_start=1
                     /product="ORF MSV090 putative Molluscum contagiosum virus
                     MC121L (vaccinia A16L) homolog, similar to GB:U60315"
                     /protein_id="NP_048161.1"
                     /db_xref="GeneID:1449903"
                     /translation="MGGSVAINFLGTSNDNANGNKDLIIGLTDGSRIRLKMYEQINTI
                     NPSEYAGKDEYEIEYCMASPYNGLGECAKLFNTDSSTTYAKELDNYIITNEGSSCMSL
                     AFRPGSVLYETSDWIKDRIFNGNKCKIIYNGPPIYENDLLECCTGKRTENCNEKLINN
                     FTTSHCNVTMQSYCENNPNDIYCYRWLESQTKLNNDIALKLYANLCSKNHIEEYCTYF
                     CINSRNSDYPGYCDIALENYCKNNYYNESCYCYNPPSNIIPNVESVLGPKECWLDPCT
                     TNYTNQKWLTTDQLSIKKSCAIQSCIITIAALNASGNSTINLINNCVEGASSSTEVQS
                     QYISNKTIPVIQTWGSLFDPSLFIIFLALLFLILLMLLNYKPVLSL"
     misc_feature    87488..>87781
                     /gene="MSV090"
                     /locus_tag="MseVgp090"
                     /note="Pox virus entry-fusion-complex G9/A16; Region:
                     Pox_G9-A16; pfam03003"
                     /db_xref="CDD:281058"
     gene            87971..88192
                     /gene="MSV091"
                     /locus_tag="MseVgp091"
                     /db_xref="GeneID:1449904"
     CDS             87971..88192
                     /gene="MSV091"
                     /locus_tag="MseVgp091"
                     /codon_start=1
                     /product="ORF MSV091 hypothetical protein"
                     /protein_id="NP_048162.1"
                     /db_xref="GeneID:1449904"
                     /translation="MNNNITNTKMCLDIIELTNVLTDICIKCQEVLRTKYFKKIYLKS
                     NYENSINEYNITKEIQNEITKIIQQKCNH"
     gene            88220..88810
                     /gene="MSV092"
                     /locus_tag="MseVgp092"
                     /db_xref="GeneID:1449905"
     CDS             88220..88810
                     /gene="MSV092"
                     /locus_tag="MseVgp092"
                     /codon_start=1
                     /product="ORF MSV092 hypothetical protein"
                     /protein_id="NP_048163.1"
                     /db_xref="GeneID:1449905"
                     /translation="MNLDVASDCKIYIPYFNYGLHTNYIKSLLPYYYHNDNLKFGNIK
                     DIIYKFTKNDFISLSTNKLTNNILSLLNSISDINLYKLINEYGYYLISNEILYDLFIP
                     FDSFIMNNKKYILYIDELYFDNLNIKNYVIKTKSNILLSINKTKYFNNNIQIEFPDIK
                     PQIISYYDDNIYYSNYISNKLTITEFYMTYYDDGIQ"
     gene            complement(88789..89112)
                     /gene="MSV093"
                     /locus_tag="MseVgp093"
                     /db_xref="GeneID:1449803"
     CDS             complement(88789..89112)
                     /gene="MSV093"
                     /locus_tag="MseVgp093"
                     /note="sulfhydryl oxidase; involved in disulphide bond
                     formation pathway; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins"
                     /codon_start=1
                     /product="sulfhydryl oxidase"
                     /protein_id="NP_048164.1"
                     /db_xref="GeneID:1449803"
                     /translation="MDPKLWGAGAWLIIFELIYLFINKVNKDRSIYMYEIEKLKKTLY
                     IICSTLPCPTCSEHAKKNINDNSIMSQNDINIILHFFIEMYNQFHSYNIIDRKKINNY
                     WIPSS"
     misc_feature    complement(88807..89112)
                     /gene="MSV093"
                     /locus_tag="MseVgp093"
                     /note="sulfhydryl oxidase; Provisional; Region: PHA03005"
                     /db_xref="CDD:222961"
     gene            89128..89853
                     /gene="MSV094"
                     /locus_tag="MseVgp094"
                     /db_xref="GeneID:1449906"
     CDS             89128..89853
                     /gene="MSV094"
                     /locus_tag="MseVgp094"
                     /codon_start=1
                     /product="ORF MSV094 putative membrane protein (vaccinia
                     F9L), similar to SW:P24361"
                     /protein_id="NP_048165.1"
                     /db_xref="GeneID:1449906"
                     /translation="MDQLGLDIYNQIYERYLIKLNRNTANASINCNIDVGLIETENIN
                     NCNLTFTNECVSNSSTNFTLLLESLVEVLKLLPPEQSSKIEKKLGITLSELENGEDNG
                     FVQECKAQASVNNSISVNEIKITNCYSTGSQPAEFIFVNSGTVESNCGMSKISEALQN
                     TNIIIEKEDEVVTNIFGVDLLGIIVLLVTLILAYIFYCIIVMHIYKTKSAIYFSRNTI
                     VPEDELILHNINIRRTIPIINDR"
     misc_feature    89149..89703
                     /gene="MSV094"
                     /locus_tag="MseVgp094"
                     /note="Lipid membrane protein of large eukaryotic DNA
                     viruses; Region: L1R_F9L; pfam02442"
                     /db_xref="CDD:280581"
     gene            89843..90085
                     /gene="MSV095"
                     /locus_tag="MseVgp095"
                     /db_xref="GeneID:1449907"
     CDS             89843..90085
                     /gene="MSV095"
                     /locus_tag="MseVgp095"
                     /codon_start=1
                     /product="ORF MSV095 hypothetical protein"
                     /protein_id="NP_048166.1"
                     /db_xref="GeneID:1449907"
                     /translation="MTDKLRITLCSTILNLDENDKEYFLNEILQIFTEKKKLKVNQEN
                     TNINIIIIIISVIIVLIIIILVIVFVFIPSIKNKKR"
     gene            90112..90567
                     /gene="MSV096"
                     /locus_tag="MseVgp096"
                     /db_xref="GeneID:1449908"
     CDS             90112..90567
                     /gene="MSV096"
                     /locus_tag="MseVgp096"
                     /codon_start=1
                     /product="ORF MSV096 hypothetical protein"
                     /protein_id="NP_048167.1"
                     /db_xref="GeneID:1449908"
                     /translation="MGGEYLIVNQCKNKVNYIEDRNQLIDNTELDSYILNELLEYKLD
                     KIKIVDNEDNCNAVIINIPSHEEKFNDMYIKKIIKNRHIILIINKDINSNIEKVIRYH
                     SKDIPIFTLKNNIYCLNIFNRIMENNNKPIIDSVYIMHYNESENSYENF"
     gene            90573..90995
                     /gene="MSV097"
                     /locus_tag="MseVgp097"
                     /db_xref="GeneID:1449909"
     CDS             90573..90995
                     /gene="MSV097"
                     /locus_tag="MseVgp097"
                     /codon_start=1
                     /product="ORF MSV097 putative calcium binding protein,
                     similar to Atriplex numularia PRF:1906390A"
                     /protein_id="NP_048168.1"
                     /db_xref="GeneID:1449909"
                     /translation="MSIAPNEYIFNIIDTNSNNNIDASELTVFMKNFYPELTENDAQN
                     TINDIDTNGDGLISKNEFTSIISNDILPEDINNAYNALILNGENNIKQMIDLFLSVLK
                     IEPLYNLSISEYSDLLYKMIGDSKESFINLWNFLQSNT"
     misc_feature    90591..90773
                     /gene="MSV097"
                     /locus_tag="MseVgp097"
                     /note="EF-hand, calcium binding motif; A diverse
                     superfamily of calcium sensors and calcium signal
                     modulators; most examples in this alignment model have 2
                     active canonical EF hands. Ca2+ binding induces a
                     conformational change in the EF-hand motif, leading to...;
                     Region: EFh; cd00051"
                     /db_xref="CDD:238008"
     misc_feature    90591..90758
                     /gene="MSV097"
                     /locus_tag="MseVgp097"
                     /note="EF-hand domain pair; Region: EF-hand_7; pfam13499"
                     /db_xref="CDD:290234"
     misc_feature    order(90612..90614,90618..90620,90624..90626,90645..90647,
                     90720..90722,90726..90728,90732..90734,90753..90755)
                     /gene="MSV097"
                     /locus_tag="MseVgp097"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238008"
     gene            91014..91340
                     /gene="MSV098"
                     /locus_tag="MseVgp098"
                     /db_xref="GeneID:1449910"
     CDS             91014..91340
                     /gene="MSV098"
                     /locus_tag="MseVgp098"
                     /codon_start=1
                     /product="ORF MSV098 hypothetical protein"
                     /protein_id="NP_048169.1"
                     /db_xref="GeneID:1449910"
                     /translation="MVKTLVIVYIPECKICQIVNEYFEYLNSIKYINYKKIYAINSIL
                     KYKIPIDKLKGIKLQTPQIYLIENNSIIALNTAPFLNYAIKYKKTLVNKNETNNFFLK
                     KLMRNE"
     gene            complement(91324..92883)
                     /gene="MSV099"
                     /locus_tag="MseVgp099"
                     /db_xref="GeneID:1449802"
     CDS             complement(91324..92883)
                     /gene="MSV099"
                     /locus_tag="MseVgp099"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048170.1"
                     /db_xref="GeneID:1449802"
                     /translation="MALIKVAIFAILILKVYSEYICTQSVHPDIIIKLPQNVNCKDSQ
                     YVETDITVKKINDDEYESNAVIVSAKVYKCTVHAVLNIFSNFKETFIDYITLSKNEIL
                     KMNETCHYKNEELKYNELSSKYILGVPTYECVSYLFSQHTTEKTYVTMQRVKMYYKSH
                     LMHTELGTLPSCEYSSQFCKIFNDLYITWEVNENATKDYKYYQTKGYMLYDENNNTHI
                     SFIDNDTKTNVSVVIDDINNVDNDSFIQTSNFAYKIKFNKMLKDAYYRPITTYRTKRS
                     YDSSDATDVLQYLYDISSENFNRIFQLCNEMSISIMELYALCAVSPKQCISVLINDTN
                     INVNIVGNKYLINKCSSAKINKFLPSAEEYGCSLFPKVEILVQGSKISNCYYNTKTEQ
                     IFSSTKYTSNCNDITFVCLDDPDSLCIYNHFTGNVTSFKVDKIINLGFKNNIYIEPPT
                     FNISSFISVPTLNDIAPFINTNIHVSKYVQKHGLRLSAILIIVILSVFSIAIIAIFAI
                     KFLHLRFTRSS"
     misc_feature    complement(91327..92883)
                     /gene="MSV099"
                     /locus_tag="MseVgp099"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03010"
                     /db_xref="CDD:165310"
     gene            complement(93092..93298)
                     /gene="MSV101"
                     /locus_tag="MseVgp100"
                     /db_xref="GeneID:1449801"
     CDS             complement(93092..93298)
                     /gene="MSV101"
                     /locus_tag="MseVgp100"
                     /codon_start=1
                     /product="ORF MSV101 hypothetical protein"
                     /protein_id="NP_048171.1"
                     /db_xref="GeneID:1449801"
                     /translation="MIVLDVSIVSDDPYSYSSSSIVPSVIDFSSSDTHSSLYNKSSSF
                     SSSLNSIRSSSYPDIVIYYIYFKC"
     gene            93123..93815
                     /gene="MSV100"
                     /locus_tag="MseVgp101"
                     /db_xref="GeneID:1449911"
     CDS             93123..93815
                     /gene="MSV100"
                     /locus_tag="MseVgp101"
                     /codon_start=1
                     /product="ORF MSV100 putative RPO19 homolog (vaccinia
                     A5R), similar to SW:P33813"
                     /protein_id="NP_048172.1"
                     /db_xref="GeneID:1449911"
                     /translation="MSGYDEDRIELSEDENEEDLLYNEECVSEEEKSITDGTIDEDEY
                     EYGSSETIETSKTIMLNGIVDLHKFKMAQKKKLLLSSQNEILSLILKFNELLSKGSIP
                     LIDEILFIKNYNMQLFNNPKLGTPLASIILIILMNVPICFEKYGKIYNRECINDITLL
                     DKDYLISYYVNLKKLIRPVIYNENILFNKDTLYEIFPLFMKNINNDNISNEELNEIQK
                     AKSFLKNNIIEK"
     gene            93834..94367
                     /gene="MSV102"
                     /locus_tag="MseVgp102"
                     /db_xref="GeneID:1449912"
     CDS             93834..94367
                     /gene="MSV102"
                     /locus_tag="MseVgp102"
                     /codon_start=1
                     /product="ORF MSV102 hypothetical protein"
                     /protein_id="NP_048173.1"
                     /db_xref="GeneID:1449912"
                     /translation="MSFYNYFEILFDIELEKYLFNENDIFYFITKNTNKKIILPIYLE
                     KFIEYENYLYNCGYKIYNIYDDKQELCINVFKKSLIHIYIYELLIGFRLSIYDSISPY
                     IYVINEYMLCEISNNKQNYNIYLNNYFNDYLHNFDLIFCKNIIIINPTVNNYKKALNF
                     YFLDKKNNLKRKIELLF"
     gene            94376..94831
                     /gene="MSV103"
                     /locus_tag="MseVgp103"
                     /db_xref="GeneID:1449913"
     CDS             94376..94831
                     /gene="MSV103"
                     /locus_tag="MseVgp103"
                     /codon_start=1
                     /product="ORF MSV103 hypothetical protein"
                     /protein_id="NP_048174.1"
                     /db_xref="GeneID:1449913"
                     /translation="MMEKNTYIYKGYIFNDNNETYFSNSLKNKNIENLICDGEIDENV
                     FYNIQGIKKLQIKNISSNVLNKLIIPNTVEELTISNIFKDKCEIDLKKLKSLSNLKYL
                     KIFNIPNLYSVILPQNLIHFESDAMIPQTSLIFSNKLKRIIIHNNKLSI"
     misc_feature    <94421..>94576
                     /gene="MSV103"
                     /locus_tag="MseVgp103"
                     /note="VPS10 domain; Region: VPS10; smart00602"
                     /db_xref="CDD:214740"
     gene            complement(94510..94827)
                     /gene="MSV104"
                     /locus_tag="MseVgp104"
                     /db_xref="GeneID:1449800"
     CDS             complement(94510..94827)
                     /gene="MSV104"
                     /locus_tag="MseVgp104"
                     /codon_start=1
                     /product="ORF MSV104 hypothetical protein"
                     /protein_id="NP_048175.1"
                     /db_xref="GeneID:1449800"
                     /translation="MDNLLLCIIILFNLFENINDVCGIIASDSKCIKFCGNITLYKFG
                     ILNIFKYFKLDSDFNFFKSISHLSLNILEMVNSSTVFGIINLFNTLLDIFFICNFLIP
                     CIL"
     gene            94873..95637
                     /gene="MSV105"
                     /locus_tag="MseVgp105"
                     /db_xref="GeneID:1449914"
     CDS             94873..95637
                     /gene="MSV105"
                     /locus_tag="MseVgp105"
                     /codon_start=1
                     /product="ORF MSV105 hypothetical protein"
                     /protein_id="NP_048176.1"
                     /db_xref="GeneID:1449914"
                     /translation="MQNYLRDIIFESDIIDKNKKLKYDKDTQVSFINIENKDTINNRD
                     TAYSVESNKFEEKQNTNMPEIYRNISLENTNNDQNNIRYDTTNSRNSNFLRLISKPND
                     IIYSILYVLYDIIWFIKIIILSIQKCKIESYRNIILMNVIIQSIIIINTLFDLFQKKF
                     KNLKKYNYTPKLRLKLSNVLIMLDFTTVVSVISSEFYIKSISCIDIIDDGVLVLLLLF
                     NWFIYLIIISFKDSHIDEYYDLEYSNQSERSYDISN"
     gene            95701..96192
                     /gene="MSV106"
                     /locus_tag="MseVgp106"
                     /db_xref="GeneID:1449915"
     CDS             95701..96192
                     /gene="MSV106"
                     /locus_tag="MseVgp106"
                     /codon_start=1
                     /product="ORF MSV106 putative vaccinia A22R homolog,
                     similar to SW:P20997"
                     /protein_id="NP_048177.1"
                     /db_xref="GeneID:1449915"
                     /translation="MNILGIDVGIKNLGLCIINIKDNKYNIICIKTDISKLNYSILDN
                     LYNIYKLDKMDIVLIEHQFKGRLNIQYYGFLLCFFQSKQKKIISIKPPTYNAGINNNS
                     YYNRKKYSVNILKSIIEKCDNVKYINKYKKIDDIADALCLIIKYLKININENQYIQSI
                     QIL"
     misc_feature    95701..96141
                     /gene="MSV106"
                     /locus_tag="MseVgp106"
                     /note="Poxvirus A22 protein; Region: Pox_A22; pfam04848"
                     /db_xref="CDD:282675"
     gene            96207..96887
                     /gene="MSV107"
                     /locus_tag="MseVgp107"
                     /db_xref="GeneID:1449916"
     CDS             96207..96887
                     /gene="MSV107"
                     /locus_tag="MseVgp107"
                     /codon_start=1
                     /product="ORF MSV107 hypothetical protein"
                     /protein_id="NP_048178.1"
                     /db_xref="GeneID:1449916"
                     /translation="MNSSNSNTIKSRISNIIENSKNLINILEYSTIIFILPLLGYIAS
                     NIYSSQASEDWYNSIRFYIPDITTQSSGLFVNSFFYLFLGVALSQLYSENLMSTSQTK
                     SYIIWLIPIILLMIYISNPIMYQSQSILAPAIIYTISLILAFIVLYYIYSIKANGKIK
                     FGWIVFIIWIIYLTIFYYTGGSGEGRQASLMGIEPQKHTIDTCSSVNVNPQETIITTT
                     ETTHEIST"
     gene            96891..97121
                     /gene="MSV108"
                     /locus_tag="MseVgp108"
                     /db_xref="GeneID:1449917"
     CDS             96891..97121
                     /gene="MSV108"
                     /locus_tag="MseVgp108"
                     /codon_start=1
                     /product="ORF MSV108 hypothetical protein"
                     /protein_id="NP_048179.1"
                     /db_xref="GeneID:1449917"
                     /translation="MILTIVLEILSSQCFFASVSYIIDIIKNVISNYLTKKYDYDGFY
                     YKYAIYIQSIVASFLFIIIGITLYSVVDYFKN"
     gene            complement(97164..97709)
                     /gene="MSV110"
                     /locus_tag="MseVgp109"
                     /db_xref="GeneID:1449799"
     CDS             complement(97164..97709)
                     /gene="MSV110"
                     /locus_tag="MseVgp109"
                     /codon_start=1
                     /product="ORF MSV110 hypothetical protein"
                     /protein_id="NP_048180.1"
                     /db_xref="GeneID:1449799"
                     /translation="MWYIFILVILVNFSVCDINKCVDEYTKELCNIETIKHLTINNND
                     NITSVLIEYDNKSIIISCDNNDKVKYSRVLNKKLNFNLISTSYFKERCYYSFEVFKIS
                     YKPCLFILYIDDIYIFYFIKNSTEIDITPAINKNHEPQELYSYKIISKKIYYALAIAL
                     LIILFVIIISTIAYLRTSNVE"
     gene            97531..97746
                     /gene="MSV109"
                     /locus_tag="MseVgp110"
                     /db_xref="GeneID:1449918"
     CDS             97531..97746
                     /gene="MSV109"
                     /locus_tag="MseVgp110"
                     /codon_start=1
                     /product="ORF MSV109 hypothetical protein"
                     /protein_id="NP_048181.1"
                     /db_xref="GeneID:1449918"
                     /translation="MIIDLLSYSIKTLVILSLLLIVKCFIVSILHSSFVYSSTHLLIS
                     QTLKLTNITNINIYHIINKYKTLYFHS"
     gene            97802..98407
                     /gene="MSV111"
                     /locus_tag="MseVgp111"
                     /db_xref="GeneID:1449919"
     CDS             97802..98407
                     /gene="MSV111"
                     /locus_tag="MseVgp111"
                     /codon_start=1
                     /product="ORF MSV111 hypothetical protein"
                     /protein_id="NP_048182.1"
                     /db_xref="GeneID:1449919"
                     /translation="MHLLYLVLTLYTPIYGYILYNDKNITYECNNKHAINMAVCYDNN
                     IKFCIIKDSTEIYIHNIITNNKTYIQNNLIHELFINKVLFCYDDYIFLIYNKYVFKYE
                     NRLPTVFTKQMNLTDSIPPILYTIKYYDKYFVINKLKEYSKSILKNFMKYYKNYKKYS
                     KIKCKKKAQIYTYDDVIISEKLYMIIIFILILFVIFIAYKK"
     gene            98404..98796
                     /gene="MSV112"
                     /locus_tag="MseVgp112"
                     /db_xref="GeneID:1449920"
     CDS             98404..98796
                     /gene="MSV112"
                     /locus_tag="MseVgp112"
                     /codon_start=1
                     /product="ORF MSV112 hypothetical protein"
                     /protein_id="NP_048183.1"
                     /db_xref="GeneID:1449920"
                     /translation="MSITHYLYKIRSITLFPNLLLRYQNDDKNLQKILYIGKCLLTFI
                     ILSLIFDIFIILHDYAIYIFIYSIILSIYITKLHIKDIYRMLVTILICFILFDIFLTI
                     IDYLYIIKIVVNILVLFFSIKEYCIMNE"
     gene            99618..101642
                     /gene="MSV113"
                     /locus_tag="MseVgp113"
                     /db_xref="GeneID:1449921"
     CDS             99618..101642
                     /gene="MSV113"
                     /locus_tag="MseVgp113"
                     /codon_start=1
                     /product="ORF MSV113 putative early transcription factor
                     small subunit VETF-S homolog (vaccinia D6R), similar to
                     SW:P04308"
                     /protein_id="NP_048184.1"
                     /db_xref="GeneID:1449921"
                     /translation="MNKIILEDLKESNVPLYIPQILPHQLATLDFLNERSLKEKKSVL
                     LFHKMGSGKTIISLLFSIIASIETKILIILPNTSIMDIWISKLYDSLLLLNKNDKYNL
                     NNIEFTTRSRLNEELLGTNKNINDIITENIKKYDNYIIIIDEAHNFFGNASGELLIHI
                     KQNSTARYVLLTGSPISNTIESLKDIVELLTNETFEYNKYIESAGNKVFQQRINKQGI
                     ELLKNKLTGLISYYDEDRKDIPSPIFQGNIKLLNYPVVLCPMSKLQEDNYNMISNQTE
                     NDMFIKLMMNVSLVALGDKENYTNFDLLMASNKQIFPNFYVSNGKFIGQELIDLNISS
                     KLKYFMNSILTSPNAGKRFIYFANSTIGSTIIRSVMIANGISEYDKEIVNNFVCVNCL
                     KERNCNNKECIPMKFVIITSKESNKGNNSYINKILSVFNEDVNENGSVIMFLFGSRII
                     AEAYTLKDIKEIWFLTVPETKSELEQCIARAIRSFAYKDKNTRVVVRICLATTPNALS
                     NEISQIIEKYKDESLSDEEKTLLLNKFEMKLVNYAIDLPYDLRKQLYSEFKSEKAKVA
                     YNIFINLSILTNNILNDNILKCFIIEKIRRYSYENSRYKLKDILSYIKKNLKFDYKNK
                     IEDYVNEFVNDGVVVYNKSFGTCYIDWFKDDIVVKQIILEFNNYLLSYNY"
     misc_feature    99660..100223
                     /gene="MSV113"
                     /locus_tag="MseVgp113"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    99738..100142
                     /gene="MSV113"
                     /locus_tag="MseVgp113"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    99765..99779
                     /gene="MSV113"
                     /locus_tag="MseVgp113"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    100044..100055
                     /gene="MSV113"
                     /locus_tag="MseVgp113"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     gene            complement(101861..102136)
                     /gene="MSV114"
                     /locus_tag="MseVgp114"
                     /db_xref="GeneID:1449798"
     CDS             complement(101861..102136)
                     /gene="MSV114"
                     /locus_tag="MseVgp114"
                     /codon_start=1
                     /product="ORF MSV114 hypothetical protein"
                     /protein_id="NP_048185.1"
                     /db_xref="GeneID:1449798"
                     /translation="MVTIERKIIISIVLTLIINSLLICLIVLTAKSSSTSNSEVLKEL
                     KSVENNEKLMFSNIEQIENKYIKNKNLDKYLKYNDIFDNENNKFNKK"
     gene            102182..103699
                     /gene="MSV115"
                     /locus_tag="MseVgp115"
                     /db_xref="GeneID:1449922"
     CDS             102182..103699
                     /gene="MSV115"
                     /locus_tag="MseVgp115"
                     /codon_start=1
                     /product="ORF MSV115 putative vaccinia G5R homolog,
                     similar to GB:J03399"
                     /protein_id="NP_048186.1"
                     /db_xref="GeneID:1449922"
                     /translation="MKYYIKYKMGINNLNSNLKHCERLINVEYDINNIKNRYIYMDFN
                     CIFYTHAHVVTSDIELVNSIKKFIVLFIRNNNKVYVFYDSGKINKKMQEKEKRIENSV
                     KYYSKIKTKLINNNIIDEDYNIIPKYEKVCDHETGKIELVKTELTKEESKSIYSAKFN
                     LLSNFKITNFKNILSELEKLDITILTKKNVDAEFYMCSYAKKMHNDNWPIFITKDQDL
                     ISLIIQNTPVQITNIMIGNEYYNLISDNLSKNICILTLLFNKSDYMNGIYGFLFDKKK
                     LNTDLINLLNASYEPFTIKSIIKLIIDVLKITSYKKLNKIMENKKINTDIDIDKIIDT
                     ISDTDIDIDTITDTNIDTITDTNIDTTIEPNIDTNIEALTDTNIDTITDTNIKALTDT
                     NIESNIEALTDIYTITEIKSNINKKNVIKEKNTKKNKLYDRNTISNIHSNCACAGNNI
                     PNTSKYVIKICEYINDILLYQKCDYKFYDHLSNKLISFNELLEFCSSINNNLFLK"
     misc_feature    102206..>103078
                     /gene="MSV115"
                     /locus_tag="MseVgp115"
                     /note="Hypothetical protein; Provisional; Region:
                     PHA03065"
                     /db_xref="CDD:222968"
     gene            complement(103618..104571)
                     /gene="MSV116"
                     /locus_tag="MseVgp116"
                     /db_xref="GeneID:1449797"
     CDS             complement(103618..104571)
                     /gene="MSV116"
                     /locus_tag="MseVgp116"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048187.1"
                     /db_xref="GeneID:1449797"
                     /translation="MEINFDPIIHKILIEYSKTNINIVSNIKHLYLDFITRPLPDDII
                     NKIGNIPDEDRVFDIDKCFIFRSCIFHNVLIVYSIFDNETVIYSFNDEYIIYDYIILS
                     NILFVILKNKCDNTVINLTIYMENNNYYESSISDRIFNELINDIINDPDDITTHAIKN
                     KENSIPIEKSDIDLSTYIECTENDIIKQKQIRYDNIPIMVLLKQTIIYSSVGTKQIAI
                     HKMDTNDKLIIDHDFVILDIFCISLDHILILTFNNLYLVNLNKKNEHYMNMYEFTFFE
                     LISHLNKIFYDKCKDHFKNKLLLIDEQNSNNSLNDINLLDK"
     gene            104621..106432
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /db_xref="GeneID:1449923"
     CDS             104621..106432
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /codon_start=1
                     /product="ORF MSV117 putative DNA polymerase beta/AP
                     endonuclease, similar to Rattus norvegicus GB:M13962 and
                     Caenorhabditis elegans GB:Z47812"
                     /protein_id="NP_048188.1"
                     /db_xref="GeneID:1449923"
                     /translation="MLIGFHTTKDFIKEYANEYVLQFFLGSPFSYLSSTTPIPFKANK
                     HNKIFIHSKYVGNIANSKSHVTISNLKKEIVYLDTLNVNKCGSIFHLTKIVDSKEKSI
                     NTIVSSLEKLSSKLDSLNLNTFNYVIIETSNIVDHIGSTIEDLALIYNKLSSHTKNRV
                     RFCIDTAHIFNTYYAINTVKGIVDYLIKFDVLIGLNKVVAIHLNDSEGMPLSSIRPHI
                     SITEGKIFYDYKSKLSPLHIIKLFSLYYNIPCILERKTITDDLSEINKEIKIFNNLNI
                     SNIDLNTFMAILNKRKIIYMLHNIANIYEKLDENKYKAYNKAINSIYEQGIIILKYNN
                     TTINSPKLVDNMETVISKYKDIPNIGDSISKKIYNIISNTYIDNISNTKEYKYITELM
                     NVLYIGPKTAKNLISKGIKTIKDLKKNKDKYLNSQQQIAIEYYDKLKPINRSFISNLE
                     SSIKLSPNKEWYILGSYARGKLTSKDIDILIVDFDIDEILKEIYKYAKEEAVLRHGKI
                     MYSGIFKKDKTYFLIDIYKTTESEKYTSIQYFTGSKEFNIALRSLALSKDIRLNQHEM
                     YDLQTQKKYNIKSEKDIFDILGVKYVPPSKRDIYTTV"
     misc_feature    104621..105379
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="Endonuclease IV [Replication, recombination and
                     repair]; Region: Nfo; COG0648"
                     /db_xref="CDD:223721"
     misc_feature    104624..105442
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="AP endonuclease family 2; These endonucleases play
                     a role in DNA repair. Cleave phosphodiester bonds at
                     apurinic or apyrimidinic sites; the alignment also
                     contains hexulose-6-phosphate isomerases, enzymes that
                     catalyze the epimerization of...; Region: AP2Ec; cl23721"
                     /db_xref="CDD:304878"
     misc_feature    order(104636..104638,104690..104692,104780..104782,
                     105377..105379,105410..105412)
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="AP (apurinic/apyrimidinic) site pocket; other site"
                     /db_xref="CDD:237986"
     misc_feature    order(104699..104713,104780..104785,104789..104791,
                     104798..104800)
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="DNA interaction; other site"
                     /db_xref="CDD:237986"
     misc_feature    order(104771..104773,104888..104890,105008..105010,
                     105113..105115,105122..105124,105224..105226,
                     105263..105265,105269..105271,105377..105379)
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="Metal-binding active site; metal-binding site"
                     /db_xref="CDD:237986"
     misc_feature    105488..106414
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="DNA polymerase X family; Region: POLXc; smart00483"
                     /db_xref="CDD:214688"
     misc_feature    105491..106411
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="Nucleotidyltransferase (NT) domain of DNA
                     polymerase beta and similar proteins; Region:
                     NT_Pol-beta-like; cl11966"
                     /db_xref="CDD:299849"
     misc_feature    order(106046..106048,106052..106054,106190..106192)
                     /gene="MSV117"
                     /locus_tag="MseVgp117"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143387"
     gene            complement(106417..108840)
                     /gene="MSV119"
                     /locus_tag="MseVgp118"
                     /db_xref="GeneID:1449796"
     CDS             complement(106417..108840)
                     /gene="MSV119"
                     /locus_tag="MseVgp118"
                     /codon_start=1
                     /product="ORF MSV119 putative RNA polymerase associated
                     vaccinia RAP94 homolog (vaccinia H4L), similar to
                     SW:P33067"
                     /protein_id="NP_048189.1"
                     /db_xref="GeneID:1449796"
                     /translation="MANQEKIIELITIMQNYIKKDNLNVNNFINEFPNEYNNYVLYNG
                     IISDESYRFLFEIIKKNVNLAPSIVYNIFRLSQVSFDHNVYVSKIVSKKEKPSINKDI
                     HTINYMTLLNNIFTIEAIPKFINLLWNVEKREENTIQEQQTDITTITKPVSRTKIIYI
                     SYNNLFDDFYINYEQYIFQKRYLIYDNLNRVIGVPLSSSNYQLNYIININLNNLNLSY
                     NIYDTVSTKFVNIKGKGQFNLTNVKDIIQNTIDDIISYITRNRLTTLYERMFCLCYFL
                     HCYYIRLFDLLTVYEYPLIEYKDYYNIYEPVKHVYKYIPCKHIDDYNIVFKEVNNFFN
                     NYNAFIDKYIAFSNNLAICKICGESIDMFNFVEANYIQSHGYMIITTHKDNIFQYETY
                     GKLTNAELFLSDYLSIYDSIFNTNVMDDFNNTARLIIDYMIHINNNRLMYQEEYKHEI
                     DTSGLFFVRLTNNIFMSEYNEKEQFREQRMINIMIVIIITLVLVNNFNELIGIVKRKD
                     MFKRIDFKKGINELIIEIVSEYIVKQGIDIKNLNIPVIINTYIKILTPELKSHYDILV
                     LRFYNHIDILTMEEIIIYDFPMANAVKNTHSLLDLYTDKIPYVLELDNILTYENNINY
                     AIKDKINISINSINIKNYKEFTSSDINIELKSLISEIKFEYTYKNTLVRVLKEIDNDI
                     FYIDNSHKYFFNTNEIINESPFKIIGNEYFKLLYFSDPLPFLENINKKHLTILYDGIN
                     IFLNIYFPSYTFVDIPEQKYISREYYLYIFYNILVWVTNNKVQNFIYENKKNIANNYN
                     KILSYYTVV"
     misc_feature    complement(106450..108822)
                     /gene="MSV119"
                     /locus_tag="MseVgp118"
                     /note="RNA polymerase-associated transcription specificity
                     factor, Rap94; Region: Pox_Rap94; pfam03294"
                     /db_xref="CDD:281310"
     gene            107228..107515
                     /gene="MSV118"
                     /locus_tag="MseVgp119"
                     /db_xref="GeneID:1449924"
     CDS             107228..107515
                     /gene="MSV118"
                     /locus_tag="MseVgp119"
                     /codon_start=1
                     /product="ORF MSV118 hypothetical protein"
                     /protein_id="NP_048190.1"
                     /db_xref="GeneID:1449924"
                     /translation="MSIPCFTMYSDTISIINSLIPFLKSILLNISFLLTMPINSLKLL
                     TNTNVIIITIIIFIIRCSLNCSFSLYSDINILFVNLTKNRPDVSISCLYSS"
     gene            108922..109677
                     /gene="MSV120"
                     /locus_tag="MseVgp120"
                     /db_xref="GeneID:1449925"
     CDS             108922..109677
                     /gene="MSV120"
                     /locus_tag="MseVgp120"
                     /codon_start=1
                     /product="ORF MSV120 hypothetical protein"
                     /protein_id="NP_048191.1"
                     /db_xref="GeneID:1449925"
                     /translation="MESKKATKKESKEKIETPINENEIVNDILSMEKLDKYFTDKKFI
                     NLTPIDTFESLVSKIDKYHNELNMYITTFCVMLKMSDDNHIPLTEVYKTIIENTNKVY
                     SVNPFISESFTISCAGIGENGIDCNTIVHPTALCKVANYDIMLISPQIIVDYITPSLD
                     ISYKCIKDKIEKFFKLVNEFIILAYIYHKNNNKNKKYNYRKKNINNPNTISKIDLQKM
                     QKYGDFKPKYIKKDEKIDHSITNAKLDLSSIDN"
     gene            109692..110693
                     /gene="MSV121"
                     /locus_tag="MseVgp121"
                     /db_xref="GeneID:1449926"
     CDS             109692..110693
                     /gene="MSV121"
                     /locus_tag="MseVgp121"
                     /note="poxvirus myristoylprotein; virion protein
                     covalently modified by myristic acid during translation;
                     The poxviridae are enveloped unsegmented dsDNA viruses;
                     unlike many dsDNA viruses that replicate in the host
                     nucleus poxviruses encode their own replication machinery
                     and therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="poxvirus myristoylprotein"
                     /protein_id="NP_048192.1"
                     /db_xref="GeneID:1449926"
                     /translation="MGQSIEIHPKYWGVNVSQEMQISYADILNTLYTAEIDDRVAIGQ
                     YATDPNSYTNVPEFNPIIKPGGYTELHRKSYLGPDEICCLNDIRYGWVDANGNVTSNA
                     NLNKTLLSCDPTTIKVGSSNICDVPLYNTCIVDKNQEYKGKCGVWLNGLFKRWQIDFS
                     IIASINKIMSEHCSQNYKNDNCDIWLAAIRNSTNSEYYNIADNVLYAQTDKSELSCAF
                     PPEYIVRQSNKINTPKECWYRPCAFSPNYLLLSSNIDNKNNCLLSECNININNLNIIS
                     NTELSIICKNQVIYRSSKEQSNIIQEEAEFNRFLIPNYTVYFILILIFLIMIIFSKN"
     misc_feature    109692..110642
                     /gene="MSV121"
                     /locus_tag="MseVgp121"
                     /note="poxvirus myristoylprotein; Provisional; Region:
                     PHA03083"
                     /db_xref="CDD:222975"
     gene            complement(109844..110059)
                     /gene="MSV122"
                     /locus_tag="MseVgp122"
                     /db_xref="GeneID:1449795"
     CDS             complement(109844..110059)
                     /gene="MSV122"
                     /locus_tag="MseVgp122"
                     /codon_start=1
                     /product="ORF MSV122 hypothetical protein"
                     /protein_id="NP_048193.1"
                     /db_xref="GeneID:1449795"
                     /translation="MLLDPTLIVVGSHDNKVLFKFALDVTLPLASTHPYLISFKQHIS
                     SGPKYDFLCNSVYPPGLIIGLNSGTFV"
     gene            complement(110683..111375)
                     /gene="MSV123"
                     /locus_tag="MseVgp123"
                     /db_xref="GeneID:1449794"
     CDS             complement(110683..111375)
                     /gene="MSV123"
                     /locus_tag="MseVgp123"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048194.1"
                     /db_xref="GeneID:1449794"
                     /translation="MHIVAMSNLNYPRNVKMPEKCDLLFVSNITPLHDHNIISNFFDN
                     IDNIDNVIFVPGDKDILFDDTFNDRLHHHVYNRKILRHSILKTYNKNYSHNKYNLYVL
                     TDDLITINFNNKPIKIYGQSHINIKLFNNTHIHKALSGIAYINKNDKEIRNHIQQCDI
                     LYTAYPPYAILDNNLGCKDLFSRVMKVKPKFHIFNGFSKPNRFIYKDITFINSNINHN
                     NKHFTEIEYFNF"
     misc_feature    complement(110695..111375)
                     /gene="MSV123"
                     /locus_tag="MseVgp123"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03008"
                     /db_xref="CDD:165309"
     gene            111409..112212
                     /gene="MSV124"
                     /locus_tag="MseVgp124"
                     /db_xref="GeneID:1449927"
     CDS             111409..112212
                     /gene="MSV124"
                     /locus_tag="MseVgp124"
                     /codon_start=1
                     /product="ORF MSV124 putative mRNA capping enzyme small
                     subunit homolog (vaccinia D12L), similar to PIR:S42252"
                     /protein_id="NP_048195.1"
                     /db_xref="GeneID:1449927"
                     /translation="MDIDEKIKNIINNGIYEELPKVNSIPQIVIQSEFGSPKAYFGIN
                     YHMLSTIVEIQDTYNENQNLLYFAQYDKVMQSNEKITYDMTFPKFFREGTSIDKSGSS
                     MTNKTYLFCSDLITLNLLYFISKKSNMRNEMTFRLPTITSTAVIHYIIILSYMFNKVA
                     IKKNDMWLTDNFIVECNQLNMERYNTVNHQLKALNINEKNRQIKINGLFSDFTIDEIY
                     KDKIIKLINSIGGCASYLWIYIIVNMKESLKGRSNKIKNEYDKLLKIKE"
     gene            complement(112217..112651)
                     /gene="MSV125"
                     /locus_tag="MseVgp125"
                     /db_xref="GeneID:1449793"
     CDS             complement(112217..112651)
                     /gene="MSV125"
                     /locus_tag="MseVgp125"
                     /codon_start=1
                     /product="ORF MSV125 hypothetical prtoein"
                     /protein_id="NP_048196.1"
                     /db_xref="GeneID:1449793"
                     /translation="MKMNYQGYFNSNLGFTFYLNGIYNTYMMHNNYVNENDVINDIDI
                     PLFNKGNVFHRISNAEITNIINEFIKFTSKKDSLIENKKDYYIYNNKKIIKTFFTYDN
                     VKLENEMDCDISINISDLDIFLYGFYIIDKDDNILEAIGIYI"
     gene            complement(112673..113119)
                     /gene="MSV126"
                     /locus_tag="MseVgp126"
                     /db_xref="GeneID:1449792"
     CDS             complement(112673..113119)
                     /gene="MSV126"
                     /locus_tag="MseVgp126"
                     /codon_start=1
                     /product="ORF MSV126 hypothetical protein"
                     /protein_id="NP_048197.1"
                     /db_xref="GeneID:1449792"
                     /translation="MYLVGNFKLEGCDVSLNGNYDIIIYSNEIKIKLFYRTNNNININ
                     VYLTKIINIIKNNKNDDEIILFNYNENNYSYYRYKNRIFEIYNNFILPNGYISITKYN
                     TIQYSKCSDYISPYEVIIHPINGSNLTCLIMVYSIDTKDIDLIGIY"
     gene            complement(113123..113641)
                     /gene="MSV127"
                     /locus_tag="MseVgp127"
                     /db_xref="GeneID:1449791"
     CDS             complement(113123..113641)
                     /gene="MSV127"
                     /locus_tag="MseVgp127"
                     /codon_start=1
                     /product="ORF MSV127 hypothetical protein"
                     /protein_id="NP_048198.1"
                     /db_xref="GeneID:1449791"
                     /translation="MYINGIYKTNNIEIVKLLGNYDIFYIDNKIIDPYYDTYELRDNI
                     SIYKTGKVLSITDKNVKELINIYINQTFISNIPNPNIVVSKVHQNDVYDYKFMYKTKI
                     FKFYNYERLIKNYIHIYEKDNNSNFSFDFINSENIVITTPIFDSRQSSKYYAFKIYDE
                     VTGILDACGIYR"
     gene            complement(113692..114960)
                     /gene="MSV128"
                     /locus_tag="MseVgp128"
                     /db_xref="GeneID:1449790"
     CDS             complement(113692..114960)
                     /gene="MSV128"
                     /locus_tag="MseVgp128"
                     /codon_start=1
                     /product="ORF MSV128 hypothetical protein"
                     /protein_id="NP_048199.1"
                     /db_xref="GeneID:1449790"
                     /translation="MLHLIKMASGYYNLRKIHVYKRFDENDSYVKYLYKNYFILYNKN
                     KKLFNLSKLLSEYKIDINKFLPDVYYIKIHPFKKSGIYVDIKYLDDIIKYINNYLQNY
                     GWIYISSNETMIKQKLYCINMINDITKHKKKSEDEVMIATFKIENEIVKKFEKIQKKL
                     ISFKYDDCYYKCNLNGLIKYIIDTIYLKSPSNVKNYKICLENENPIQIIKKNQKRVNK
                     KKQIQIIKKNQKRVNKKKQMQINEKLNLFCYESIQTLHYETKHVIYEKPQIDNFDAII
                     QSVNKLKNNEKRKLQRKCKYLKKTPKKCPEPCNNENTDSIEPHFIVSLINSMPIDEVI
                     NIANSIIIDDDVPVHNDDFMNIDVPEQNYDFMDIKSFSKEPDDDESTISIDDDIEIDS
                     MSLFNFDFREEEISEDVSNTIFQEIHKIID"
     gene            complement(114944..115345)
                     /gene="MSV129"
                     /locus_tag="MseVgp129"
                     /db_xref="GeneID:1449789"
     CDS             complement(114944..115345)
                     /gene="MSV129"
                     /locus_tag="MseVgp129"
                     /codon_start=1
                     /product="ORF MSV129 putative membrane protein (vaccinia
                     L5R), similar to SW:P07615"
                     /protein_id="NP_048200.1"
                     /db_xref="GeneID:1449789"
                     /translation="MVLVKEKPNEKIINLNPTFILWDYEKYFSYGNFTIYIITLIEIC
                     FIIFLLFYFFQQELIFIYNYFVGPQKTDDDIEQFNALDNTLQEIVNSSLYCNGDNLYY
                     KYKGESRQALALNNEPITDCNNILNKYVTFN"
     gene            115362..116348
                     /gene="MSV130"
                     /locus_tag="MseVgp130"
                     /db_xref="GeneID:1449928"
     CDS             115362..116348
                     /gene="MSV130"
                     /locus_tag="MseVgp130"
                     /note="DNA topoisomerase type I; ATP-independent enzyme
                     that regulates the number of topological links between two
                     DNA strands; relaxes positively and/or negatively
                     supercoiled DNA"
                     /codon_start=1
                     /product="DNA topoisomerase type I"
                     /protein_id="NP_048201.1"
                     /db_xref="GeneID:1449928"
                     /translation="MRKKYIKYYNVINNKIYDDKNNEIINEELNKIIIKYKPPSHLHD
                     IKLIAKNIKEADNGIVYIGLDSTNKKQYIYGINFVTNRKKNKIKTFLKVNQKIPDIER
                     YIKKELDIFNKSDNPKISINTLFAVILLMEMNFFIRTGKKKYLNDNETIGLLTLQKSN
                     FTFNNDKYIDILFKGKKKQLQQFTVDKENHKLLYKILKLLINNTEDFIFKTTDNILFS
                     ESKMYQMMKMFSISLKDIRTFGVNRILINELWKAMQLIDISYIKKNDIRRMITDVINK
                     TANIIGHTPSISKKSYIVDELRSIITPDLFIYKDTSFKDFYNIIIKKLTESI"
     misc_feature    115362..116345
                     /gene="MSV130"
                     /locus_tag="MseVgp130"
                     /note="DNA topoisomerase type I; Provisional; Region:
                     PHA03101"
                     /db_xref="CDD:222985"
     misc_feature    115404..115550
                     /gene="MSV130"
                     /locus_tag="MseVgp130"
                     /note="Viral DNA topoisomerase I, N-terminal; Region:
                     VirDNA-topo-I_N; pfam09266"
                     /db_xref="CDD:286365"
     misc_feature    115602..116264
                     /gene="MSV130"
                     /locus_tag="MseVgp130"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain; Region: DNA_BRE_C; cl00213"
                     /db_xref="CDD:294145"
     misc_feature    order(115731..115733,115773..115778,116022..116024,
                     116028..116030,116061..116063,116235..116237)
                     /gene="MSV130"
                     /locus_tag="MseVgp130"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    order(115773..115775,116061..116063,116070..116072,
                     116208..116210,116235..116237)
                     /gene="MSV130"
                     /locus_tag="MseVgp130"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            complement(116341..116598)
                     /gene="MSV131"
                     /locus_tag="MseVgp131"
                     /db_xref="GeneID:1449788"
     CDS             complement(116341..116598)
                     /gene="MSV131"
                     /locus_tag="MseVgp131"
                     /codon_start=1
                     /product="ORF MSV131 hypothetical protein"
                     /protein_id="NP_048202.1"
                     /db_xref="GeneID:1449788"
                     /translation="MIYNNILIIIISLITMLMLHLIIKITLHIILYTYIGGLIFDIIG
                     LTLIFSKLIAIIITIFIMIDTFIIFLELEPINKISYIKFFI"
     gene            116604..117032
                     /gene="MSV132"
                     /locus_tag="MseVgp132"
                     /db_xref="GeneID:1449929"
     CDS             116604..117032
                     /gene="MSV132"
                     /locus_tag="MseVgp132"
                     /codon_start=1
                     /product="ORF MSV132 putative Amsacta moorei
                     entomopoxvirus G4R homolog (vaccinia A28L), similar to
                     SW:P29816"
                     /protein_id="NP_048203.1"
                     /db_xref="GeneID:1449929"
                     /translation="MNIIQVFGIILITSALCFIIFQLWYYYENYDYIIKYNDAYGNLE
                     YSQSANINYQDSTVYDPNDTEYDVNKKWRCALNNSIYYPVSEFGFMSTDSTKIGLTYT
                     YLNDCLLNLFDTQVKIIYNPCSVSNTSNDCVLLNNLLNGV"
     misc_feature    116604..117020
                     /gene="MSV132"
                     /locus_tag="MseVgp132"
                     /note="Poxvirus A28 family; Region: Pox_A28; pfam04584"
                     /db_xref="CDD:282447"
     gene            117022..117408
                     /gene="MSV133"
                     /locus_tag="MseVgp133"
                     /db_xref="GeneID:1449930"
     CDS             117022..117408
                     /gene="MSV133"
                     /locus_tag="MseVgp133"
                     /codon_start=1
                     /product="ORF MSV133 hypothetical protein"
                     /protein_id="NP_048204.1"
                     /db_xref="GeneID:1449930"
                     /translation="MEYKVDEVGKIIIDRISIKEKKITKLVNMFNTILQKKSNKYYKL
                     THKILYNKEKLEKYSKTVDKDVLIDKLITILLIYDFIYNVFTFELENIEKEQSKAEQK
                     FKNILKDMSKIFNEISNLFNNFKIKF"
     gene            complement(117405..117881)
                     /gene="MSV134"
                     /locus_tag="MseVgp134"
                     /db_xref="GeneID:1449787"
     CDS             complement(117405..117881)
                     /gene="MSV134"
                     /locus_tag="MseVgp134"
                     /codon_start=1
                     /product="ORF MSV134 hypothetical protein"
                     /protein_id="NP_048205.1"
                     /db_xref="GeneID:1449787"
                     /translation="MKYFAIITLVLLSNSYITKANTTLPSVLPFNQSEIKFDTQSIVE
                     AIDKINITSLNGQYEKIIASINNVVDSIENIDLGASTILRLVNPFANKINSFIDSFPI
                     EDSKIFFTIISVSALIHSISMIFFVILVVYFVFIKTVKKKNKISMNVGYSRPRREV"
     gene            complement(117900..118619)
                     /gene="MSV135"
                     /locus_tag="MseVgp135"
                     /db_xref="GeneID:1449786"
     CDS             complement(117900..118619)
                     /gene="MSV135"
                     /locus_tag="MseVgp135"
                     /codon_start=1
                     /product="ORF MSV135 putative protein phosphatase 2C
                     (PP2C), similar to Schizosaccharomyces pombe SW:P40371"
                     /protein_id="NP_048206.1"
                     /db_xref="GeneID:1449786"
                     /translation="MFKIEYASKKGSRNYNEDYVYIKNFKSCNVIAIFDGHNGTSCIE
                     YFIKLFENTFNCSNINQNYLKSLFVSIDNKIVSKNINSGSCVTMIIILYNTTYILQLG
                     DTKAILFKDSLMVYETPEHNFYNSIEYNRCLFNMQIVHNIPRYDGILSVTRSLGDSEL
                     KNKINVRTLISIPSIKILNTNDFDTIIMTTDGIHSINKPSFNTNISIANEYASKPNSD
                     NCTIIKITKKEDIISNINKLV"
     misc_feature    complement(117945..118604)
                     /gene="MSV135"
                     /locus_tag="MseVgp135"
                     /note="Serine/threonine phosphatases, family 2C, catalytic
                     domain; Region: PP2Cc; smart00332"
                     /db_xref="CDD:214625"
     misc_feature    complement(order(117966..117968,118047..118049,
                     118509..118517,118566..118571,118581..118583))
                     /gene="MSV135"
                     /locus_tag="MseVgp135"
                     /note="active site"
                     /db_xref="CDD:238083"
     gene            118649..119101
                     /gene="MSV136"
                     /locus_tag="MseVgp136"
                     /db_xref="GeneID:1449931"
     CDS             118649..119101
                     /gene="MSV136"
                     /locus_tag="MseVgp136"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048207.1"
                     /db_xref="GeneID:1449931"
                     /translation="MDKDILMKHFSVLNFISNDMLNELLNKQRGGSNNDFLKQYCWKK
                     IKNTDIYALVYYDNDKKKYYVSKLEKTLPMNQSIDQQSGSAINKDDIDIGVSTAELYG
                     GKSTKNTRKTKTQQNTNTNTTSKTRKSKKNTTTNYKQNLSGDMIPLDE"
     misc_feature    118649..119098
                     /gene="MSV136"
                     /locus_tag="MseVgp136"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03035"
                     /db_xref="CDD:165332"
     gene            119105..119554
                     /gene="MSV137"
                     /locus_tag="MseVgp137"
                     /db_xref="GeneID:1449932"
     CDS             119105..119554
                     /gene="MSV137"
                     /locus_tag="MseVgp137"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048208.1"
                     /db_xref="GeneID:1449932"
                     /translation="MIYYYINDNKYIIFGPIAQQYIDKCKLQPFCVLKSSNRKYKLFG
                     SLLYIDFINKNVFWEHSLHKYYKLYVTSIAPYGNNFIINEMYPACSITSFIFPHLNLN
                     LYNIIIPSTCEHKNNCHNRYCKEHNSHLIGYNFPFAYNKHNIKTNKC"
     misc_feature    119105..119536
                     /gene="MSV137"
                     /locus_tag="MseVgp137"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03034"
                     /db_xref="CDD:165331"
     gene            119548..120120
                     /gene="MSV138"
                     /locus_tag="MseVgp138"
                     /db_xref="GeneID:1449933"
     CDS             119548..120120
                     /gene="MSV138"
                     /locus_tag="MseVgp138"
                     /codon_start=1
                     /product="ORF MSV138 hypothetical protein"
                     /protein_id="NP_048209.1"
                     /db_xref="GeneID:1449933"
                     /translation="MLINNMKTEIKIDKDLINKLINKIYKDNVPRNSILTYCINLIKD
                     GEIKNEYYKINNVYKRDDLLLYDKTICDNNEIINVNTIGNYSPLLEYFKFKNIKYELT
                     DSPNKDLYNRSEEILSFLLSNGQFNEDCSFISNNDIIFYNYINDIKNNSNNICEKLFL
                     FTQNKNIDPDFLPKECLKNVKNKITINIQL"
     gene            120121..120540
                     /gene="MSV139"
                     /locus_tag="MseVgp139"
                     /db_xref="GeneID:1449934"
     CDS             120121..120540
                     /gene="MSV139"
                     /locus_tag="MseVgp139"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048210.1"
                     /db_xref="GeneID:1449934"
                     /translation="MKIEYINKNIWDFLSDIDNISLIVFISADYISSDDYFKYIKNKY
                     NSIKTLKNQKKTKGEVSYIYKYNVYIYYILISDYIEDIVDDINIRRSLSNFNELITTD
                     NIATSMSHMKFILPNYNNTLSYISDHITNIKNLYICL"
     misc_feature    120121..120537
                     /gene="MSV139"
                     /locus_tag="MseVgp139"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03033"
                     /db_xref="CDD:165330"
     gene            120541..122367
                     /gene="MSV140"
                     /locus_tag="MseVgp140"
                     /db_xref="GeneID:1449868"
     CDS             120541..122367
                     /gene="MSV140"
                     /locus_tag="MseVgp140"
                     /codon_start=1
                     /product="ORF MSV140 hypothetical protein"
                     /protein_id="NP_048211.1"
                     /db_xref="GeneID:1449868"
                     /translation="MDNIKKKQNIYGITIFDYNNILNYNDDKVIKHMIENKRIDDQDV
                     YINNISKLIYSKINDTKESFNNKINFNLLYSRDKYINGFQSLQIFNIYTFDFNENFLY
                     VDISLPSLIMLYNLLYNEKPVNKNFNYYVQYQSDYLDKLLVEFHNAPNSSSPILNKIL
                     YLRSFPIFNYIMEKISNNYLNDNNRHLLDKEYENDINNPAFTKNITFLNLLYFDNIEY
                     YTYNIKNLMNNNTNILSYLINIPSNINYSEIKNIIENEYNVDIIYQNASFDENYLKLH
                     IIKNEFLNITNIIDTDLYFESNRLYNLNRILLDNIKDFEIDIISEIGNYNNDILNSLY
                     IKGLYRFYHELLPLCLKFYIDGYSISHESYKFNYNYDEDENISYTINNIPLIKNINNN
                     KIKFINETFNNIPSNISYNKIFFTNLFSENIFKFKNKYISMMFCSHFILINELPTLTF
                     KYIKNDNNDIYSILNSNNIMKKNHMATEITRYIYDNFNKNNNRYDKLLNIVKDCVSKN
                     KLLFPLLLLYIKNDIAIDILILFYENDNILKELTETYDKFINTINFVSYLNNNINKSL
                     TTFLLFSNDKVRVRYNIIDSFTKLFSSLYNPKYDIILSLNSL"
     gene            complement(121430..121630)
                     /gene="MSV141"
                     /locus_tag="MseVgp141"
                     /db_xref="GeneID:1449869"
     CDS             complement(121430..121630)
                     /gene="MSV141"
                     /locus_tag="MseVgp141"
                     /codon_start=1
                     /product="ORF MSV141 hypothetical protein"
                     /protein_id="NP_048212.1"
                     /db_xref="GeneID:1449869"
                     /translation="MIHGILNIHLYKILNIMVKVHDKIYISLLYIMNLIYHYYNYQFL
                     ILYLFQNLLYYLIKYDLNYTIY"
     gene            complement(122362..122781)
                     /gene="MSV142"
                     /locus_tag="MseVgp142"
                     /db_xref="GeneID:1449785"
     CDS             complement(122362..122781)
                     /gene="MSV142"
                     /locus_tag="MseVgp142"
                     /codon_start=1
                     /product="ORF MSV142 putative membrane protein, fowlpox
                     virus 15.6kD homolog (vaccinia J5L), similar to GB:M17418"
                     /protein_id="NP_048213.1"
                     /db_xref="GeneID:1449785"
                     /translation="MSSEYENDKKLIEYCNQNTTDTKCQCILLSNDIKIFTKSSYSLP
                     YCWYAPCNKADSYKTSIIKEEQKYCHVTVCEISFGEITLKDNGVFTATNNCISTLNPI
                     AKYSQTIVKLKDDDIPNLIISFIYPITIVLLIFFISS"
     misc_feature    complement(122377..122751)
                     /gene="MSV142"
                     /locus_tag="MseVgp142"
                     /note="Pox virus entry-fusion-complex G9/A16; Region:
                     Pox_G9-A16; pfam03003"
                     /db_xref="CDD:281058"
     gene            complement(122791..124506)
                     /gene="MSV143"
                     /locus_tag="MseVgp143"
                     /db_xref="GeneID:1449784"
     CDS             complement(122791..124506)
                     /gene="MSV143"
                     /locus_tag="MseVgp143"
                     /codon_start=1
                     /product="ORF MSV143 putative poly(A) polymerase large
                     subunit PAP-L homolog (vaccinia E1L), similar to
                     SW:P33809"
                     /protein_id="NP_048214.1"
                     /db_xref="GeneID:1449784"
                     /translation="MNTYINTREFDNELIKYKQQIDTIVKFDKDEFIKKLIIIKDIYI
                     TDFINISKNNDIKRRVYTYFNKQNTFDKIGSIIAVLKFQHLIVTYVNRLLEDIIDHNN
                     GSISVELMNFTSITSKTVKKSDESIAPILKVTSNYLCRSRLINKNQEIPKNKNVSDDV
                     INICKLLENILKTILVIKNHECLVYGSFTCFNIDSNIKYNDIDLYSINAYKLMIFFMS
                     IINFLIGYDVYIFSIPFIEGHISLKYKDVVLIDCIFLPKKIIDNIPKVMINNIYFIDP
                     GMQTLNNFRMLSENFRSFKLTKDFENSYKKYIILIEYFIQNSMFNIKRLKEIFSNTYT
                     KKSIPYTINNTSLTIDIKKFIPSSLYDYVIVIWNSPDHIMKFLSKIKGRFSMKYGSFL
                     NEIFFETSISSDKISKMDIIAGNVVCEKSPYVIDENTMKKINVTNDEIDIYIDTTKKY
                     LIFTNLTTSTYLYVENDKVVDISMKNLVSFIATISLYNFLHKNNEFAMDLYYYLFALL
                     RIEDDRFIEEYTIFPRYKRKGEHIEISMYKNIFKSIFNASFTTNDVYMNYNTFIENTN
                     IYGGF"
     misc_feature    complement(124225..124506)
                     /gene="MSV143"
                     /locus_tag="MseVgp143"
                     /note="Poxvirus poly(A) polymerase N-terminal domain;
                     Region: Pox_polyA_pol_N; pfam12630"
                     /db_xref="CDD:289402"
     misc_feature    complement(123676..124068)
                     /gene="MSV143"
                     /locus_tag="MseVgp143"
                     /note="Poxvirus poly(A) polymerase nucleotidyltransferase
                     domain; Region: Pox_polyA_pol; pfam03296"
                     /db_xref="CDD:281312"
     misc_feature    complement(122884..123666)
                     /gene="MSV143"
                     /locus_tag="MseVgp143"
                     /note="Poxvirus poly(A) polymerase C-terminal domain;
                     Region: Pox_polyA_pol_C; pfam12629"
                     /db_xref="CDD:289401"
     gene            124539..124781
                     /gene="MSV144"
                     /locus_tag="MseVgp144"
                     /db_xref="GeneID:1449935"
     CDS             124539..124781
                     /gene="MSV144"
                     /locus_tag="MseVgp144"
                     /codon_start=1
                     /product="ORF MSV144 putative ubiquitin, similar to
                     Neurospora crassa GB:U01220"
                     /protein_id="NP_048215.1"
                     /db_xref="GeneID:1449935"
                     /translation="MQIFIKTLTGKTITIEIEANDTISNLKQKIQDKEGIPPDQQRLI
                     FAGKQLEDSRTLEDYNIQKESTLHLVLRLRGGIKNS"
     misc_feature    124539..124766
                     /gene="MSV144"
                     /locus_tag="MseVgp144"
                     /note="Ubiquitin-like proteins; Region: UBQ; cl00155"
                     /db_xref="CDD:294102"
     misc_feature    124539..124754
                     /gene="MSV144"
                     /locus_tag="MseVgp144"
                     /note="Ubiquitin homologues; Region: UBQ; smart00213"
                     /db_xref="CDD:214563"
     misc_feature    order(124617..124619,124662..124664,124752..124754)
                     /gene="MSV144"
                     /locus_tag="MseVgp144"
                     /note="charged pocket; other site"
                     /db_xref="CDD:176352"
     misc_feature    order(124668..124679,124746..124751)
                     /gene="MSV144"
                     /locus_tag="MseVgp144"
                     /note="hydrophobic patch; other site"
                     /db_xref="CDD:176352"
     gene            complement(124768..126345)
                     /gene="MSV145"
                     /locus_tag="MseVgp145"
                     /db_xref="GeneID:1449783"
     CDS             complement(124768..126345)
                     /gene="MSV145"
                     /locus_tag="MseVgp145"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048216.1"
                     /db_xref="GeneID:1449783"
                     /translation="MENEFNKITKSSLLYTPIMNNLIEKYGIDKIFNNVCITNNSYFY
                     ILLIEMQNYDIYDKISKNYKLIIHNLLRQIMNSTDLKEYINNIINIDNYKNLSDYIIN
                     KFWDKVYNVPPSNINIDNIKNINVSSLLSKVVTYKYYDPNKVTEFLIFTYYSKKDLAI
                     SILTNDDAEIDITFDNLLEIINNDRSIFSYINTNYYPLFKSSLKTIEYKFKVSDSNLD
                     PGYLWKSRESFENLKNDGYAKNFNDVFFSILYSYIRNGFVTHNIIIWTYLFGYKILRQ
                     DLLKELFAIIKNIPIELSGIISDLLINKNYIAIDEILNHDEPKITYEIGQINVTSENV
                     YNNYINVIESIAKKPFEPKGYFYNFDVDINKLKFNKKFFNFLFYNNPISKDILDLNMK
                     IELNYKNNECGLDYIDKYIKLYNTYNLINNNVSDFNVLYNYEYVKFDFNNMYDIIEDL
                     FELSIIKSSILKILFEEYSFIPKNITNLRKQYMEHIKRKSNLNNLYEALTSKSYKKIT
                     DKIICSDIYLQSIFMNF"
     misc_feature    complement(124777..126345)
                     /gene="MSV145"
                     /locus_tag="MseVgp145"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03007"
                     /db_xref="CDD:165308"
     gene            126360..127094
                     /gene="MSV146"
                     /locus_tag="MseVgp146"
                     /db_xref="GeneID:1449936"
     CDS             126360..127094
                     /gene="MSV146"
                     /locus_tag="MseVgp146"
                     /codon_start=1
                     /product="ORF MSV146 hypothetical protein"
                     /protein_id="NP_048217.1"
                     /db_xref="GeneID:1449936"
                     /translation="MSVLNKYTIEYICKYLSPNSILNLSLVNKHICSIIHNELYNINY
                     KISNRKYNRLSDKFELFLNINTFNIIRNTISYNLTSLSISNIRISDCCISQLYNLKNL
                     IIKKSIIDQNLPQSLKRCIMIDVDIKINDVIKNLYNLHSLGLTIKKNIKLDFPNSITT
                     LSIIESKFTKININNIVNKANIYLLFNRNLTKINLPNESYLTIVNCNKLKQIYTNEYT
                     IIDTYKIKKILNIELYHKYLLKYKSY"
     gene            complement(126701..127018)
                     /gene="MSV147"
                     /locus_tag="MseVgp147"
                     /db_xref="GeneID:1449782"
     CDS             complement(126701..127018)
                     /gene="MSV147"
                     /locus_tag="MseVgp147"
                     /codon_start=1
                     /product="ORF MSV147 hypothetical protein"
                     /protein_id="NP_048218.1"
                     /db_xref="GeneID:1449782"
                     /translation="MIVYSLVYICFNLLQFTIVKYDSLGKLIFVKFLLNNKYILALLT
                     ILLIFIFVNFDSIIDNVVIEFGKSNFIFFLIVNPNECKLYKFFITSLIFISTSIIIHL
                     FND"
     gene            complement(127075..128490)
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /db_xref="GeneID:1449781"
     CDS             complement(127075..128490)
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /codon_start=1
                     /product="ORF MSV148 putative DNA helicase (vaccinia
                     A18R), similar to SW:P20534"
                     /protein_id="NP_048219.1"
                     /db_xref="GeneID:1449781"
                     /translation="MLYSKLSPALHAALRSRINNNSVLCYDIYMNPIIYNDPNTVNNT
                     LIRIPPRMLKNYDKISFNLKSISNESLEISNLELRHKQKHIFNKILEIYNINESNKPL
                     YISLVCPCGFGKTILSIAIINKLKFKCVIIAPMKFIVSQWVDKINIFNKDLKIYSSID
                     GIKKALKDIKNGLDCDIFICPDKHLQNDEIYNYIYENFSIIIIDEIHKYNLNNDILMT
                     KFLYKNYFKMCLLLTATPADNMNLFVTHMIKANGEQNQTKNILVSVESKDINNSFSNN
                     SINILLNRIKQDKFKEVYMKNYNYKMCISKDDMRNNCIVDIIHKCFHDDTKALILTDY
                     RDHMIYLYNKLKSIINDSVYLYDVKQYKNSVSSLNEARNKNNFIIVSTIAACSESLDL
                     QSLNTLHITLPITNNKTIIQAIGRIFRTNVKDDNKFVYYYNISFIDNIIRMFINDKYY
                     NIKKQIDNDEDKKWIINKIYI"
     misc_feature    complement(127783..128268)
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /note="Type III restriction enzyme, res subunit; Region:
                     ResIII; pfam04851"
                     /db_xref="CDD:282678"
     misc_feature    complement(128146..128160)
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(127870..127881)
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(127234..127557)
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(order(127339..127347,127420..127425,
                     127483..127494))
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(127234..127236,127243..127245,
                     127255..127257,127318..127320))
                     /gene="MSV148"
                     /locus_tag="MseVgp148"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            128526..129572
                     /gene="MSV149"
                     /locus_tag="MseVgp149"
                     /db_xref="GeneID:1449937"
     CDS             128526..129572
                     /gene="MSV149"
                     /locus_tag="MseVgp149"
                     /codon_start=1
                     /product="ORF MSV149 putative RPO35 homolog (vaccinia
                     A29L), similar to SW:P21087"
                     /protein_id="NP_048220.1"
                     /db_xref="GeneID:1449937"
                     /translation="MESKVFFHEIFTIKLITPLAEKIGTCINAIYNDNIKLPVFSKYI
                     IDRTYSLSIPFENMVNNLKNISRMIPYLFSNYFRNTNNLGIKLHLISDGTKYYLTCKD
                     LELFIFDDTTGKITIIEKPKYADKHMIGCISANSNLTEEEKKKYKSEGYILLFTSTSN
                     IETNYNLHDEILKTFPDYPMKSITNEIENSRQKYEPSFIEYDTPFNLWIIVNKEGTFL
                     NIRLNHYFDIDKNIIRNYLLDIFKIINDIFFTSTDNIYQEINDYIKDLEYNGIYDHKL
                     NYDIITVKNKISTKIFDALCYVNDIPCNNGFYLKPRDTEVIQSEKLTEFFRKEIQHIS
                     EEITNHFNSIYSHN"
     gene            complement(129561..130430)
                     /gene="MSV150"
                     /locus_tag="MseVgp150"
                     /db_xref="GeneID:1449780"
     CDS             complement(129561..130430)
                     /gene="MSV150"
                     /locus_tag="MseVgp150"
                     /codon_start=1
                     /product="ORF MSV150 putative NTP pyrophosphohydrolase
                     mutT motif homolog (vaccinia D10R), similar to SW:P32817"
                     /protein_id="NP_048221.1"
                     /db_xref="GeneID:1449780"
                     /translation="MSSQIYEIETYSEKRIIEIKNFYGFENIPEPSKNTTFNIVFITA
                     DDKIVFGKRKDSYYFDILHRLTIKKKEVSNTTLRYFCCLFQNLNIDEKFYILKGIPKD
                     SRYKNIIKFISTHFGNFLEYLKKNNKIKDIDKIMLLNCNDNNKLTKYHYFTKLYIDDN
                     INKYFNIIDYKDINNRTKKINKTLVLPGGKPINKESIIDTIKRETKEELNINLNNIDV
                     SKTYYADTTIYDKIVYKTFHDITFIANIPLTSYDILLYFKPNREVSDVYFININDINY
                     KKLLILAQCILIM"
     misc_feature    complement(129609..129905)
                     /gene="MSV150"
                     /locus_tag="MseVgp150"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cd02883"
                     /db_xref="CDD:239217"
     misc_feature    complement(order(129804..129830,129858..129866))
                     /gene="MSV150"
                     /locus_tag="MseVgp150"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(130459..131400)
                     /gene="MSV151"
                     /locus_tag="MseVgp151"
                     /db_xref="GeneID:1449779"
     CDS             complement(130459..131400)
                     /gene="MSV151"
                     /locus_tag="MseVgp151"
                     /note="hypothetical protein; putative vaccinia A11R
                     homolog; The poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; the Entomopoxvirinae are a sub-family of the
                     Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048222.1"
                     /db_xref="GeneID:1449779"
                     /translation="MIISKVEYENINNNNVDLENDSNYPGYYPEFFKEQYINNVQELY
                     TEPDNSNTNTIISKLIPIDDDIEDNNDELNKLFDETIYNNENNDNDNDNVNYNTSVSI
                     TKSNKSSKSSIKTEINIFNEQNTKSSQFTKKTSPIRPPSNTELLKQLKDENKKLKKQQ
                     YKTSKSKNMQLLISKLNGFCEQSLNKKKEILNFAIKQDITLSIDDFKYMDEDEIEEIY
                     QLIKNINIHKQSFNTSMIIIKLIFVCIEKCLVDVFKLTEFKNMVSVITDEFIDNKCNT
                     TKTFINNYVSTPNIPFMDIGIQIVGIGIKNYFNVNLI"
     misc_feature    complement(130471..131400)
                     /gene="MSV151"
                     /locus_tag="MseVgp151"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03006"
                     /db_xref="CDD:165307"
     STS             131122..131145
                     /standard_name="PMC151488P1"
                     /db_xref="UniSTS:271146"
     gene            131427..135347
                     /gene="MSV152"
                     /locus_tag="MseVgp152"
                     /db_xref="GeneID:1449938"
     CDS             131427..135347
                     /gene="MSV152"
                     /locus_tag="MseVgp152"
                     /codon_start=1
                     /product="ORF MSV152 putative core protein P4a homolog
                     (vaccinia A10L), similar to SW:P33817"
                     /protein_id="NP_048223.1"
                     /db_xref="GeneID:1449938"
                     /translation="MKDKNNHINYLLDNVLNYIDFYDTLSKNNEITINGKQYKLDEIL
                     SKTYMHPLDTIKIQNTNVIFKNEIYNQFMINLFMHYNNPAMNFTHNLQNIINNKTEIL
                     PDELSFFNYNTANYLRYRFMYDDNSSGLRGGMLIDKTEDGFISYNDESASYIVKKMEN
                     YISIINEDKYDFYVTYHAFIDYFLENDKLSYGDIIDEKSKNDKMYNKDEDYKKYLNEH
                     TVSNDESKKIRKKIKYYLKFFDTILHKDIISFYEYIPLTKILDYIDKDTDIKLILDIL
                     ITKAEPLLNENNSTEIIAYLFNKKQSLRLYENKKYYNNNNNALSKFVSNKLLDIQRRI
                     INIMEINSDNNPTEILITFNSKYQSLIINNIYNAFIFFTNYINNYLIVYEFNLDSPNV
                     KKFIKKFNDLCDGIFDVLTLDEPLVDDHRIDQFFSRSFGKRDFISERSNEQLNQMIIN
                     LYKVFNEINNKLKNIVEETKKFVNAIKIEDINYYNYNKDNNKNEKKIKYAINVLLLSI
                     YVNIIKGQLDYDKLIKYLNYDPETLQKDLFSNNQNNEFNIILKNNIFKNLNFIESPDL
                     NKEFENDHYIFDSKLNDNKDKNNKYDEIINSINENSKKLFYDCLSTDYSSLFKITPHL
                     EIKDEVYKTLINNATSEFVKSGKINILNAFELKDNIYNKIPLVLNPVINIKKEVNNLH
                     EKIFKGDYEDKYKNISINNYKSFISMLPTYYYTLLYNNPTILKVTHNQQTKIVNDNKI
                     FHINSSPNINFFNPFQNSNDADLIMIENENKNNLDKLDSIIYSNFWFGIPYNDFDKLT
                     ILQKSFILRSCFTIVKSELNNTIIHTTYDNALDKGMNIDFICIIPYPYSATETMHSIV
                     MKVVNSLNITDSMFFQYNRNDYISNIGLDQEGNKIFINKVLELSSLKDLVITYILLRE
                     SNSGNADLKLSPDQEATFIVNIMRLLNYNVTVTTNKKNTSNAIYIRVRKDRITVDNFK
                     RILRKNYNISNQKILTAIGNKMAPLLSYINRKNLNKNIEYAGMENNLQSEDFIYPIIE
                     YNNPINILDNVDLSFMNTNSLFELLNTDIFEPETRLFKSKVIAAMSSNSNDNIVDVIV
                     EHLPQSSTYKKSICSNIYEIIAGNNENPLNEIIQNFITPDCDEESINIDNNTLLKKII
                     NKNKIIASVDTDITANIFKNNLIKIMETITNRYACQLRAPIHYINTLDKLKNILSSEN
                     INIEGEFKDNISGIISSLYNNTLLIIQYIIIINTILELSRAYKRVNKDINGTIINEDL
                     INEVKCVFNDIFSKYFNNIENLRNNPIFNSFLGNNNRNDVLHEY"
     misc_feature    <133530..>134660
                     /gene="MSV152"
                     /locus_tag="MseVgp152"
                     /note="Poxvirus P4A protein; Region: Pox_P4A; pfam03395"
                     /db_xref="CDD:281398"
     gene            135325..135540
                     /gene="MSV153"
                     /locus_tag="MseVgp153"
                     /db_xref="GeneID:1449939"
     CDS             135325..135540
                     /gene="MSV153"
                     /locus_tag="MseVgp153"
                     /codon_start=1
                     /product="ORF MSV153 hypothetical protein"
                     /protein_id="NP_048224.1"
                     /db_xref="GeneID:1449939"
                     /translation="MMYYMNIKKSYSNVFNNVTYSIFLSFSIKLKYKKYFDNLLLHII
                     TLSIKSFLIFIISLSNLLFHGKPYKIS"
     gene            complement(135354..136112)
                     /gene="MSV154"
                     /locus_tag="MseVgp154"
                     /db_xref="GeneID:1449778"
     CDS             complement(135354..136112)
                     /gene="MSV154"
                     /locus_tag="MseVgp154"
                     /codon_start=1
                     /product="ORF MSV154 putative serine/threonine protein
                     kinase VRK1 homolog (vaccinia B1R), similar to
                     GB:AB000449"
                     /protein_id="NP_048225.1"
                     /db_xref="GeneID:1449778"
                     /translation="MILKSVRGNIWQVSECLVNEYYINIHLLENDDNKIIKIASIEDG
                     PLFCEINFYIRYCKEEMVKDVNILPYVDSGIDKYKKLRFLVLPKLDYNLKQISINNIY
                     NLSKDIIFALKYIHSKEYIHSDIKDENILYDKNNNKFYLTDFGNITKHTKKFITNCKL
                     VNNGTYKYIGIDMHNGISTYKSDLESFGYLLYDILYGLPWNNKLDKDIINIKKDFIDN
                     VIICNNKLSKYFLYLSLIENDKNIEYVTLLKTLE"
     misc_feature    complement(135360..136010)
                     /gene="MSV154"
                     /locus_tag="MseVgp154"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:304357"
     gene            complement(136156..139728)
                     /gene="MSV155"
                     /locus_tag="MseVgp155"
                     /db_xref="GeneID:1449777"
     CDS             complement(136156..139728)
                     /gene="MSV155"
                     /locus_tag="MseVgp155"
                     /codon_start=1
                     /product="ORF MSV155 putative RNA polymerase second
                     largest subunit cowpox RPO132 homolog (vaccinia A24R),
                     similar to SW:P17474"
                     /protein_id="NP_048226.1"
                     /db_xref="GeneID:1449777"
                     /translation="MIPNNIEEYIAKLYLSSDNKLNIKSKSLINIEIPFRNFNHDLSA
                     FFTREEVINVKSSKSSKEEIILKIEFSGKQENKKSYIYSSFDNKSFDLNIGICVSIFK
                     KIINQDGESKLQLIYTYNCTPNEIRIPQYISYGGNTPMIDNSLTETNNPGGSFILSKG
                     ITKFVTCRIEQMYVYPKLKKMNKPFIFHCSFISKHPSFRMINEKIYPPQFLTIDIDYT
                     PGKIKCVIDSKKAFIQIDLILLIHFYSEMSFEDIESIIKRGFNNSIVRKIQILIKNSQ
                     MILANNENNIHTYVSNVIKEAYINKFKNDKNITLQAYTNSLLSNFLPHITNGRINKGM
                     YLISIFRQFIVGMFQPDIYPDKDNLATRRISTAADIFESIIKSSIDTLLYQIKEKSNE
                     FKIESKINQNINNALSQIKLIPQITPAFNNFFNMQDTKNSDVVKISTKSNWQEPIIVS
                     NAVMRGSSIELTKSLEARNLHESTIGVLDIYDTPDHGSNAGLIKRLTIGTIISHHTLK
                     IRERIFNEVNEYILTYAKTNNIINKINGVIISIIEESSEFYVTSIDQSKVDQFVKDIK
                     LAKISNIFCTNDIGIEVIPIHEMDKIKKINVPTNRYFQIRINVGNRRALQPMFIVENG
                     ILNLDKYKIDKNEIMSFSDIMLKYNDIIEFVDVGQALYSRICNSIKEFKQYSLEFRKT
                     IQYVRLPNYIYFSQLVSCMHDVGKMAGVRGTFGAAQYKHIITGPQDNILNKFESCTYL
                     SFPLQKSCVTNIPKDISGISKNGMGQHILVGFFSYNKNIEDGVIVNKRSVENGMLSVI
                     TLNAIVAEVSDIQINNNNPSPDNANNNYSKINVMGLPDVGTVMVKNDALYRCLKPKYK
                     ETDDNTRLFDKSEPYVSNYPAVVERTRKQGTDIIKVEILLSSYRRLAIGDKLAKSVQK
                     VTVADILDESELPYTKDGLRPDLIFNSTSITSRKTFPMYFDAMLTNMFSLIPYDENNN
                     TRYINYPTYTDMTSTDIIEYIRNKIKPLYPNISDEELNDIVYCRHVIYNPDTHKPMEL
                     VENGKKTKAFVAPILFSRLSQMSADKLSVRNRGRLDKYGQPPSGKKKGGGIKIGEMEV
                     DVFLTYSVPSITLELLSDPSEKYLPAMACSNCGIFATYEDSLEIKRWKCLQCENIGLS
                     PKIISFRLPYSTKMFLLNTNMRGITFKIREKQMPTYYLSISSTK"
     misc_feature    complement(138235..>138369)
                     /gene="MSV155"
                     /locus_tag="MseVgp155"
                     /note="RNA polymerase Rpb2, domain 3; Region:
                     RNA_pol_Rpb2_3; pfam04565"
                     /db_xref="CDD:282430"
     misc_feature    complement(136540..137598)
                     /gene="MSV155"
                     /locus_tag="MseVgp155"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cl24011"
                     /db_xref="CDD:305168"
     misc_feature    complement(order(136615..136617,136642..136665,
                     136936..136941,136945..136947,136954..136962,
                     137032..137034,137038..137040,137341..137343,
                     137353..137358))
                     /gene="MSV155"
                     /locus_tag="MseVgp155"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(137209..137211,137215..137223,
                     137233..137235,137239..137241,137341..137343))
                     /gene="MSV155"
                     /locus_tag="MseVgp155"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            140126..143509
                     /gene="MSV156"
                     /locus_tag="MseVgp156"
                     /db_xref="GeneID:1449940"
     CDS             140126..143509
                     /gene="MSV156"
                     /locus_tag="MseVgp156"
                     /codon_start=1
                     /product="ORF MSV156 hypothetical protein"
                     /protein_id="NP_048227.1"
                     /db_xref="GeneID:1449940"
                     /translation="MNKYYRYPVYNIYECLILLAIKYENNKVSLDIINSLYEILNNIK
                     FSDKITNEIIKNYNKIVEKIFYMHNQFKINDYNIILQYLIEYNNEINKCIKENKFPCK
                     NPLYNITYKKKLYIYDLDYEEKKDKELVINIEQKNAVDKINDIKNNVNNIHSDNETII
                     TGKETLIDILNKLLKLVSSDEKQLIEQIYKNINNKEIEFKNIDNVQKEINKKQDELNK
                     LLDESKKEFIKKQEELNKTIDKKQEELIKKLNDKEINFNIDEKQKLLDQINSKINTLN
                     ENIKGVMNLYTETKNKISNLQNEILNKDSTIKSLDEKQKLLDELDKNINNITSLYNKS
                     NTKITNIQQLLESSLTDFNNANININELKSKIKLFDNDIQKLNNDITEQNNKITDFFN
                     NSTRIFKEKLDTEYKKIDDIKNNNLQKLEESYKKIDEQTEYYKNKINKEYNDIIELKN
                     NNLQKLEEENKKIDEQTEYYKNKINKEYNDIIELKNNNLQKLEEENKNINDKLTKLKN
                     DIESNTELFNKLNISDFKDKSREIAKLNTEYEQLRKDLLENINKTNELMKLSDNKLSS
                     LEQLYDSKKNILDGIDKIYNSLKEKNDKIDEYFSNIEKFDIYNVIENKFIGNLDSIIN
                     KIINNDQFKEYINSKIDSKSNELSTMFDDIFNAKNQIASITNNIENISNKIKDLNEFI
                     ISNEDSSKELLDEIRKYKQQFDKIKDAMNTEVKSFENTLQKDIDSIKSNINELTNAYD
                     IINTKANDLDDKLNNYGSEFKNLYNNASDLLDTIQKNNDEKVKQLNEYLEKNKNQSIE
                     INDIVNNFIKELIKFNNTETNKSLNELLTNDDINDKIFKLYKELNKISTNNLLKIYKN
                     EIDNVNEKLSIVIENLQFINSFLSIEFNQGSITSHINFLLNTLAGINDVLNKLNLKIM
                     ADTTRRGDTNIRDEIKNQISSENIKSQKFNEKNEKDLKKLISFNDKLNKYNISAGYTE
                     YNNIEHECLKYLYIAVSDQEYRYYKFIIHNIKQIDKNKKNSMLQFLKLFLKRYIIIYD
                     LKILSDTIDNIQIKQYYLNKLYKNEYKLNTFEQFINQTYGFTMPIFNILNISTNMVFD
                     YIFKNNNIYCPLYNFDYTSFDTYSRQEFLNSLIYKLDYI"
     misc_feature    140216..142369
                     /gene="MSV156"
                     /locus_tag="MseVgp156"
                     /note="helix-rich Mycoplasma protein; Region:
                     Mplasa_alph_rch; TIGR04523"
                     /db_xref="CDD:275316"
     gene            143533..144825
                     /gene="MSV157"
                     /locus_tag="MseVgp157"
                     /db_xref="GeneID:1449941"
     CDS             143533..144825
                     /gene="MSV157"
                     /locus_tag="MseVgp157"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048228.1"
                     /db_xref="GeneID:1449941"
                     /translation="MYNKYILEKLIRIKLLKPKIYIVTSNKSLNDIKKIVNVYNSLVK
                     SINKALNLPSRLSIDGIVLKDLIWDNSKIIIKNYPYVYYEIGITNNFISSEKNYIYTD
                     GVDCLIFKKTLKKSIISVYIQHASFKGNKKTSGFNIWDILPKIDYYLYCNINNCISMI
                     DNISIRCLIISKDTNISMEELYISIMNGKSMHDELDIKIIYYDINKQRHFNHFNNFKV
                     LPEYDKKNDIANVILTYKNKKLFLYIKKLYNSKIQNTVLNKNNLTYDLIVEDKIIPLK
                     KTYFLHYYKINKDIFYYNDNNNNIKIFSNEINFDGLIDIDHYEFNYKLYNKNSLFIKL
                     CIASQIIDKYENEILNINDENIETVIKNIKKINNKILINNLSKLLNKSIKDHMNEINI
                     NINDIKYDYNLQTFVGKNSDIYNSIYKLIKEIYLLSNA"
     misc_feature    143539..144768
                     /gene="MSV157"
                     /locus_tag="MseVgp157"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03031"
                     /db_xref="CDD:165329"
     gene            complement(144808..145485)
                     /gene="MSV158"
                     /locus_tag="MseVgp158"
                     /db_xref="GeneID:1449776"
     CDS             complement(144808..145485)
                     /gene="MSV158"
                     /locus_tag="MseVgp158"
                     /codon_start=1
                     /product="ORF MSV158 putative core protein VP8 homolog
                     (vaccinia L4R), similar to GB:X76267"
                     /protein_id="NP_048229.1"
                     /db_xref="GeneID:1449776"
                     /translation="MYYNPLYTIINASKSIYIGDNIIGGANKIFIPDNKSIIRILHKR
                     SFTKKKTKYDSNKLKIDNATFYNIYDMRDFIANGKKTINDFIDLLMKDRFSLLVGDSI
                     LRPGNRKEIFSQTSYPILITFKMNPKLKYVVENPEQMLNEAKQISEDTVYAYKQIGTY
                     VVSVSPSSVIIDSIKYIDNSKNKIKLVNVNKDKEITINEDYNPILIEDLNTIVKELNI
                     TPLGITQ"
     gene            complement(145525..146202)
                     /gene="MSV159"
                     /locus_tag="MseVgp159"
                     /db_xref="GeneID:1449775"
     CDS             complement(145525..146202)
                     /gene="MSV159"
                     /locus_tag="MseVgp159"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048230.1"
                     /db_xref="GeneID:1449775"
                     /translation="MYDNLLVFDSCSIINSLFKEICFENYIIFIDWTNTIWDKYEDKY
                     VFRNGNIKTADDYNRVLNDNKCYGFYVITDNIQESSDAIFELQNLGIKSDLFQKRNKL
                     DNKNTDIYELSYYGIIKSKDDKLNTSRIIENFLKDNYNFVLNKLYIYYITGNMCNVVQ
                     NLIFSKIKKTILYIPSREDEIYLQDNIDKNNCYGGNNLCTIKRNLINISNIIKQKLIP
                     KNNTNVC"
     misc_feature    complement(145561..146199)
                     /gene="MSV159"
                     /locus_tag="MseVgp159"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03017"
                     /db_xref="CDD:165316"
     gene            complement(146228..146701)
                     /gene="MSV160"
                     /locus_tag="MseVgp160"
                     /db_xref="GeneID:1449774"
     CDS             complement(146228..146701)
                     /gene="MSV160"
                     /locus_tag="MseVgp160"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048231.1"
                     /db_xref="GeneID:1449774"
                     /translation="MDISNIVLDHFSEINISYFNKIFEEIDYDISDYSFDSNDIGSLI
                     IYTSDKKKMQVEKINIPSQYLDENKKKILKLLDNDKIKSLSENEKMRIFINIQLQLSN
                     FNYENHESNDNNLLIDCFPYECKNCNNKVTIDNEFNIICDKNKNHKYTIDEYNKE"
     misc_feature    complement(146237..146686)
                     /gene="MSV160"
                     /locus_tag="MseVgp160"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03018"
                     /db_xref="CDD:165317"
     gene            complement(146721..147002)
                     /gene="MSV161"
                     /locus_tag="MseVgp161"
                     /db_xref="GeneID:1449773"
     CDS             complement(146721..147002)
                     /gene="MSV161"
                     /locus_tag="MseVgp161"
                     /codon_start=1
                     /product="ORF MSV161 putative Helothis armigera EPV ORF F2
                     protein, similar to GB:AF019224"
                     /protein_id="NP_048232.1"
                     /db_xref="GeneID:1449773"
                     /translation="MEDQKRSTNSIIKNLTRLFPNPTNSRNIIILLLFITFILSILFI
                     IIQNYTDDLNSGWLLALTYIDIILIVICFLIHINLIYQNQIEKIGYKSL"
     gene            147019..148587
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /db_xref="GeneID:1449942"
     CDS             147019..148587
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /codon_start=1
                     /product="ORF MSV162 putative NAD+ dependent DNA ligase,
                     similar to Thermus thermophilus SW:P26996"
                     /protein_id="NP_048233.1"
                     /db_xref="GeneID:1449942"
                     /translation="MDNIKKIKQTSDVNKVLNKISLEDISEIIKILNEKYYEGETLIS
                     DEIYDKIIEYVNKKYPDNDITKKIGYEPKNKVKLPYYMGSENKIYDEDEKKFNNWIEK
                     YGTSSIIVSVKADGISVLWDIGKNKLYTRGDGNYGKDISWFLKYMNYDLPELSDYVIR
                     GELVINKDKTRNDVAGAINSLEANRNEDILKEIYFVGYEILNPRFNQENQFKKLKQHK
                     IRHIKAMKYDIEDVSLECLSELYQELKPKMKYDIDGLVIRNNNVNDPITDGNPPWSFA
                     YKPPNTIYTTKVLNVIWQISKQNKYIPIAELEPIKLENKTIKRVSCYNAKFVTENGIG
                     TDAIVEIEYRGGAIPKLVNVIKPVTVDESDLPDGKIIDNHLYAPIDSKESNIKIISQF
                     FKILSIQAPNKKVIEHLYDNGITNIVELLKSDLTELLDTTKKINKNALHSINIAKSIE
                     ISLPLAIAALSIPNLTEKVLEKIYNTHKDFLTTKQDFEKIKGINKLSAEKIKSQILKN
                     KNMIDEYLKLIKIK"
     misc_feature    147034..148209
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /note="Ligase N family; Region: LIGANc; smart00532"
                     /db_xref="CDD:214709"
     misc_feature    147073..147858
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /note="NAD+ dependent DNA ligase adenylation domain. DNA
                     ligases catalyze the crucial step of joining the breaks in
                     duplex DNA during DNA replication, repair and
                     recombination, utilizing either ATP or NAD(+) as a
                     cofactor, but using the same basic reaction...; Region:
                     LIGANc; cl03295"
                     /db_xref="CDD:295776"
     misc_feature    order(147271..147273,147349..147351,147355..147357,
                     147409..147411,147502..147504,147598..147600,
                     147784..147786,147790..147792)
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(147355..147357,147361..147366)
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    147355..147357
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     misc_feature    147871..148086
                     /gene="MSV162"
                     /locus_tag="MseVgp162"
                     /note="NAD-dependent DNA ligase OB-fold domain; Region:
                     DNA_ligase_OB; pfam03120"
                     /db_xref="CDD:281160"
     gene            complement(148590..148808)
                     /gene="MSV163"
                     /locus_tag="MseVgp163"
                     /db_xref="GeneID:1449772"
     CDS             complement(148590..148808)
                     /gene="MSV163"
                     /locus_tag="MseVgp163"
                     /codon_start=1
                     /product="ORF MSV163 hypothetical protein"
                     /protein_id="NP_048234.1"
                     /db_xref="GeneID:1449772"
                     /translation="MYLLNILLIYIVFFIIGYTIIDYVSYLCDRYDKYVEQEKENQMQ
                     LWQSSIEEVIEPLKTKIDEIYEWLSEKK"
     gene            148850..150796
                     /gene="MSV164"
                     /locus_tag="MseVgp164"
                     /db_xref="GeneID:1449943"
     CDS             148850..150796
                     /gene="MSV164"
                     /locus_tag="MseVgp164"
                     /codon_start=1
                     /product="ORF MSV164 putative core protein, fowlpox virus
                     P4b homolog (vaccinia A3L), similar to SW:P17355"
                     /protein_id="NP_048235.1"
                     /db_xref="GeneID:1449943"
                     /translation="MTTDTISYHKFPISLEDICKCYNNDNNEYMTFEYDPISGENHIC
                     SIAGNCIISDFFNKLTSEFTKTQLIAGARKSDKNNKSNNISTNIDKKQDILKRLAEYI
                     AKSFSKSPNLYTEQDIRNIIALSNIDGIRNINLSNEDINNIINLATVYYKSKIVDHPL
                     FSVKSENVTDLMQQLKQVDSVANISDYEGFLNNLKLRSYNYIDVTSCNLTNTLYYHPN
                     EPSIPSIIFALFANRLPILFDLITSQDLYMLQKELQSDDYSKYNNLFLLIFRLSDKDY
                     FYNLKGHSGSKNSFYNELSRIILSMAVKQMVYNIIAGTVTSNLTNSFVNIINRYRVDN
                     IRSPQEAMLTILLKMWSYKPTIVLKSSIGPYNDLKPESVFYVEYDINDISRIDASTNI
                     RFGQEMLKYIYYDRLSNKVVLLPTVLNTVPTINANLNQFPFLANQYSQMSYGANNITL
                     RSLGIFVLSIPRIISSLYYNGYANEYGGRLNTRYINIDQTITISDRIFILSSAVCYKS
                     ATTINADPCFGTQIAMGTIAIVRTQKGWLRYDPDLKVSCNSQQEILDKMIRSEYNKYT
                     ASDQYGMNEGFDDEFEHWKKDIKNVEKIIDRFDKGYVNIDALIINDSEAIDIISRYGT
                     ILIYSDQSGSSSLCDVSIKNCYTY"
     misc_feature    149132..150736
                     /gene="MSV164"
                     /locus_tag="MseVgp164"
                     /note="Poxvirus P4B major core protein; Region: Pox_P4B;
                     pfam03292"
                     /db_xref="CDD:281308"
     gene            150915..151295
                     /gene="MSV165"
                     /locus_tag="MseVgp165"
                     /db_xref="GeneID:1449944"
     CDS             150915..151295
                     /gene="MSV165"
                     /locus_tag="MseVgp165"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048236.1"
                     /db_xref="GeneID:1449944"
                     /translation="MLNCVIYIVIILFVFVILFFYITSIKRDNFESTTHETDELANST
                     KSELETLDQKVINKFIQDSIINTRLSNIEESLNNIISKLQDNEVEKQVIEVNQPKEKK
                     QEIVRKRNITVKKEIENDEDEIVE"
     misc_feature    150918..151283
                     /gene="MSV165"
                     /locus_tag="MseVgp165"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03030"
                     /db_xref="CDD:165328"
     gene            151313..151603
                     /gene="MSV166"
                     /locus_tag="MseVgp166"
                     /db_xref="GeneID:1449945"
     CDS             151313..151603
                     /gene="MSV166"
                     /locus_tag="MseVgp166"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048237.1"
                     /db_xref="GeneID:1449945"
                     /translation="MTDAELYFLIIVIIVYIILILSTIGLIWGYLLSIRKIRSSIDQN
                     MRSRRKGWYWFLNFLFWLLPLSLAAAFYFFTVWYVMNPQAQQYWFPPPSSST"
     misc_feature    151313..151588
                     /gene="MSV166"
                     /locus_tag="MseVgp166"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03029"
                     /db_xref="CDD:165327"
     gene            151629..152165
                     /gene="MSV167"
                     /locus_tag="MseVgp167"
                     /db_xref="GeneID:1449946"
     CDS             151629..152165
                     /gene="MSV167"
                     /locus_tag="MseVgp167"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048238.1"
                     /db_xref="GeneID:1449946"
                     /translation="MNINNPIYINLIDILRTRTFVLDQYERNQPIVYYDYDSYTKVNY
                     KCEYEKNHIKLITEYNDSIIEYNLMNNVRHIDTSQNNIIISNQKSKHNEFDMNILSYH
                     HPTYMKQNRMKVEFIPNVNDILTNYKPSIDSLCIDYKILYNSEIFKEYSDRLYIAYTS
                     VNMSNVYETDYRKILYTA"
     misc_feature    151638..152159
                     /gene="MSV167"
                     /locus_tag="MseVgp167"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03028"
                     /db_xref="CDD:165326"
     gene            complement(152173..152391)
                     /gene="MSV168"
                     /locus_tag="MseVgp168"
                     /db_xref="GeneID:1449771"
     CDS             complement(152173..152391)
                     /gene="MSV168"
                     /locus_tag="MseVgp168"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048239.1"
                     /db_xref="GeneID:1449771"
                     /translation="MSNYMYNITAANSINSCSECEKTINDILLNENYLKSLNDRCINK
                     ILDILKTHEPNIDLILDEEVKIKLLNRI"
     misc_feature    complement(152179..152391)
                     /gene="MSV168"
                     /locus_tag="MseVgp168"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03019"
                     /db_xref="CDD:165318"
     gene            152435..153127
                     /gene="MSV169"
                     /locus_tag="MseVgp169"
                     /db_xref="GeneID:1449947"
     CDS             152435..153127
                     /gene="MSV169"
                     /locus_tag="MseVgp169"
                     /codon_start=1
                     /product="ORF MSV169 hypothetical protein"
                     /protein_id="NP_048240.1"
                     /db_xref="GeneID:1449947"
                     /translation="MEYIFLNNNNTYTAGYSYGIKPQFVTPLTSTTNVQNEDDHNINT
                     IKPDKSSTIENNENNATRTTENVSPQSVDMSIFNDGDSYIPDFFLSNISDTIFLIFIS
                     TAAIIAASKIDNINVSYLIIAAISLLISTEYGISISIVLFAIIMANNANAFILVLVVI
                     SLVHIFVPIPWLITDSFNYNYLLQGILGLLTLLAINYKKLVIYYAIPKETTTVFKNAT
                     AAMSNESTIISY"
     gene            153165..154139
                     /gene="MSV170"
                     /locus_tag="MseVgp170"
                     /db_xref="GeneID:1449948"
     CDS             153165..154139
                     /gene="MSV170"
                     /locus_tag="MseVgp170"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048241.1"
                     /db_xref="GeneID:1449948"
                     /translation="MEDIDKILHITVINDDEINTENDTEVENIKNTDFDGLKIFTECG
                     YIFKNVTNKKIQCIICNESCNIHCIWCSDENCVLHSINKLSLVQFNNEHKMRNFVRIN
                     TIFPKNVTFYLTGKFNIVKHKKKDSFSDYYSYIEIYTYTMIPDMLKIIENKIFETEKL
                     IVDKKIPYSYNDYLKVLRVDKLNDYSFVRSAENTYPIVYIDTNKDYNKISIKYNDKKY
                     EFKLKALCNIYPDLDNSIKSYFKESLLTICINPVCFLIPKIDPKFTLKFKFNVLINMK
                     EQSININRPDIDFNNQSLTKEIIEEFIDNLTAQEKILNDEEKKKKTTF"
     misc_feature    153201..154136
                     /gene="MSV170"
                     /locus_tag="MseVgp170"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03027"
                     /db_xref="CDD:165325"
     gene            complement(154129..154863)
                     /gene="MSV171"
                     /locus_tag="MseVgp171"
                     /db_xref="GeneID:1449770"
     CDS             complement(154129..154863)
                     /gene="MSV171"
                     /locus_tag="MseVgp171"
                     /codon_start=1
                     /product="ORF MSV171 ATP/GTP binding motif homolog
                     (vaccinia A32L), similar to GB:D11079"
                     /protein_id="NP_048242.1"
                     /db_xref="GeneID:1449770"
                     /translation="MKIKKFNFDTLKERPFNMSIVASTGQGKTTLLKYILNNLKFHFK
                     FIYLITNDDQGYRNNKYYKYVYPNHVFYLTKYEKPEYIVSKICEIKKFTNKTLNDKSY
                     GEKFNTLIIFDDVGNNFRNKLKNFTNECRHAFISTIFLVHKEIHLDPDTRDSMKFFVI
                     NKKTIDLKYIIPNTSIRKEISKDIVPLLLQYEKKFGLYIVIDNVHAELFYIYISEDEM
                     KNLDNNYFLLSTESSMKQIILEKIKK"
     misc_feature    complement(154159..154854)
                     /gene="MSV171"
                     /locus_tag="MseVgp171"
                     /note="Poxvirus A32 protein; Region: Pox_A32; pfam04665"
                     /db_xref="CDD:282513"
     gene            154891..155445
                     /gene="MSV172"
                     /locus_tag="MseVgp172"
                     /db_xref="GeneID:1449949"
     CDS             154891..155445
                     /gene="MSV172"
                     /locus_tag="MseVgp172"
                     /codon_start=1
                     /product="ORF MSV172 hypothetical protein"
                     /protein_id="NP_048243.1"
                     /db_xref="GeneID:1449949"
                     /translation="MSNPNNYSDKDLLIVKTVRSNALPDNVIFAFDMNNGLFKNIFNS
                     VFNNALLGGMHDALRESMNKNYYDNELGGASNTNQGRYGQSNNRGQQNDSGCRIAKTT
                     GECDRREHPYREGNPRNMSSVRYDDDYDRYNNMYDRNRNNDMYDRNRNNNNNNNNDLY
                     SRSNVASDDIVVDKALLSTVFKNT"
     gene            155472..156845
                     /gene="MSV173"
                     /locus_tag="MseVgp173"
                     /db_xref="GeneID:1449950"
     CDS             155472..156845
                     /gene="MSV173"
                     /locus_tag="MseVgp173"
                     /codon_start=1
                     /product="ORF MSV173 putative serine/threonine protein
                     kinase Swinepox virus C20L homolog (vaccinia F10L),
                     similar to SW:P32216"
                     /protein_id="NP_048244.1"
                     /db_xref="GeneID:1449950"
                     /translation="MKSTNCEGNLTIIYLLSKRINEFRNGSNGIINTIRNIVKEFSVK
                     EKSSFIKMKKQMNIIKNEISNMNEEIFLPYFMMNTYALDDYIYHISTGAFGMTFRATD
                     NFILKFIINPINNQYHEFIIPHKLYNILKGTGCENFILVPCALIKQIDIKHLMNIIIA
                     HNIIFIFIKHIINPTNDINIFDTYLNFDKMIKIYKEIISYEDFYKYFTYFYKKYFKDL
                     FNIILINNYYMILSHVKHILTKMLDNSFSYNSSLIISNLAICASNELKLIKISENGFI
                     PDMINGIPAQNINPNYLRHIVLQVLLIIYYANKDETIFIHNDIKPNNILVFPKINDIV
                     VKFGNCNIIFKEKYYFKLTDFDLSYIKDFKNERIKGIINEKYDNFITDIFYFLYRFKH
                     DFFKNLEEIDPALNKAIIEYFMKYIHKKDIVDKYHYVGSKKFYSDDVYNFIMESGLFK
                     NWIHKLA"
     misc_feature    155589..156830
                     /gene="MSV173"
                     /locus_tag="MseVgp173"
                     /note="Poxvirus serine/threonine protein kinase; Region:
                     Pox_ser-thr_kin; pfam05445"
                     /db_xref="CDD:283176"
     gene            complement(156837..157502)
                     /gene="MSV175"
                     /locus_tag="MseVgp174"
                     /db_xref="GeneID:1449769"
     CDS             complement(156837..157502)
                     /gene="MSV175"
                     /locus_tag="MseVgp174"
                     /codon_start=1
                     /product="ORF MSV175 putative metalloprotease, similar to
                     Bacteroides fragilis GB:U90931"
                     /protein_id="NP_048245.1"
                     /db_xref="GeneID:1449769"
                     /translation="MKYIFVFLIFAFFTCPQDAYKKNYHDIIWCFKPINNKFHDVTNA
                     NIWFADNIFITDILDKVFDIYDPFYPYNITTSNSTNCNLEISFNRLYKLARVSKNAIQ
                     INIKFVKHFRTIKKNRYLYVGLFTHQIGHFLGLKDLNDKNDVMYKKFIYQKIKKRYDP
                     YMLQKMLSVKNMRKLCKKFKLNQHILSKKWCYNSVKDKYIYIGKNRCYLWIIKIQKGL
                     HLC"
     gene            157386..157571
                     /gene="MSV174"
                     /locus_tag="MseVgp175"
                     /db_xref="GeneID:1449951"
     CDS             157386..157571
                     /gene="MSV174"
                     /locus_tag="MseVgp175"
                     /codon_start=1
                     /product="ORF MSV174 hypothetical protein"
                     /protein_id="NP_048246.1"
                     /db_xref="GeneID:1449951"
                     /translation="MKFVVDRFETPNNIMIVFFVCILWTCKKCKNQKYKYVFHISKWY
                     IYRYNQLIIDVLIQNAV"
     gene            complement(157680..158396)
                     /gene="MSV176"
                     /locus_tag="MseVgp176"
                     /db_xref="GeneID:1449768"
     CDS             complement(157680..158396)
                     /gene="MSV176"
                     /locus_tag="MseVgp176"
                     /codon_start=1
                     /product="ORF MSV176 putative metalloprotease, similar to
                     Homo sapiens GB:X89576"
                     /protein_id="NP_048247.1"
                     /db_xref="GeneID:1449768"
                     /translation="MKFMILIFILIKIVSSNHVWKTDIFWCYERNDDVDVHVNHEYIH
                     GHLRTAIYPYKFVFPFNISEINADSNLCNLRISVERKFHFNKITNKACFKFKDGALAH
                     AGHTHYSKSYIHIHDDLLKVHPQIDENDYIYIDVFIHEFGHIIGLSHNSYDPTDVMYS
                     FKRKESYLFELYKNVVLFDKILSRKNLLELISLYSNKFEKVNDEWAINKLNGQWIYFG
                     TKETKCVMYLPSLQNWIVLC"
     misc_feature    complement(157884..>158228)
                     /gene="MSV176"
                     /locus_tag="MseVgp176"
                     /note="Zinc-dependent metalloprotease. This super-family
                     of metalloproteases contains two major branches, the
                     astacin-like proteases and the adamalysin/reprolysin-like
                     proteases. Both branches have wide phylogenetic
                     distribution, and contain sub-families, which...; Region:
                     ZnMc; cl00064"
                     /db_xref="CDD:294052"
     misc_feature    complement(order(157950..157952,157968..157970,
                     157977..157982))
                     /gene="MSV176"
                     /locus_tag="MseVgp176"
                     /note="active site"
                     /db_xref="CDD:238124"
     gene            complement(158570..159202)
                     /gene="MSV177"
                     /locus_tag="MseVgp177"
                     /db_xref="GeneID:1449767"
     CDS             complement(158570..159202)
                     /gene="MSV177"
                     /locus_tag="MseVgp177"
                     /codon_start=1
                     /product="ORF MSV177 hypothetical protein"
                     /protein_id="NP_048248.1"
                     /db_xref="GeneID:1449767"
                     /translation="MTNSECKKIRLALISVFITALICSIVALSIILSQKHGNELSKDQ
                     NGYIEKFSEIMNGFTNKINENEENFLDEFEKNENAEKEIIQHIDDLRNMINQQQSTSK
                     NNNLPQVNYESINQNPQILHPPNVQFIPPPNQQLPQSQFVPLIKIPIANNGIPPPFPT
                     QQFIPQNSQMQGVPMNIQQLLQNCPINYPPNIWASRVGNMHYPPSMQAVG"
     gene            complement(159301..160698)
                     /gene="MSV179"
                     /locus_tag="MseVgp178"
                     /db_xref="GeneID:1449766"
     CDS             complement(159301..160698)
                     /gene="MSV179"
                     /locus_tag="MseVgp178"
                     /codon_start=1
                     /product="ORF MSV179 putative metalloprotease, similar to
                     Mus musculus GB:L36244"
                     /protein_id="NP_048249.1"
                     /db_xref="GeneID:1449766"
                     /translation="MCTKISSKWQFISLSVIIALILITSVGLIIMKNQMTNEEFAISS
                     FENKLKNSENYTLLSKLLDLSKFNYTNSSEFATTETVENANTIILPTKTDNIEEDDEF
                     EEDGEFEEDGEFEEKDEYITTEKQNVKEVQHIKLKTEDQDDIVFDDTENKLFTYKNEL
                     FIKTDGHAQVIYNDKEVFNNYNTNNVKTSVIIDLNSVIPNEIPVIPNENSVIPNEIPV
                     IPNENPVIANENPVPNENDDYIHLRIPLHRCKPDKRNIYGYVGKPKKKMNWCFLNNAY
                     NSMIDNELFKELIRISVKVWNNFVPFQMYETNTLHNCDIKISIENRQHSSFDGGFCWD
                     FAGEAAHTIFDKQMHFPVDKINTIMYQSYDYPLELLFIITHEFGHIFGLAESNVRGSV
                     MTANSVYKRLDMINDPHYDFNNIISFHDICNIIKIYNRIPKKIKPVKSDIIRQIRSYY
                     NINEPVHIYTYEKGF"
     misc_feature    complement(159415..159912)
                     /gene="MSV179"
                     /locus_tag="MseVgp178"
                     /note="Matrixin; Region: Peptidase_M10; pfam00413"
                     /db_xref="CDD:278824"
     misc_feature    complement(159415..159912)
                     /gene="MSV179"
                     /locus_tag="MseVgp178"
                     /note="Zinc-dependent metalloprotease. This super-family
                     of metalloproteases contains two major branches, the
                     astacin-like proteases and the adamalysin/reprolysin-like
                     proteases. Both branches have wide phylogenetic
                     distribution, and contain sub-families, which...; Region:
                     ZnMc; cl00064"
                     /db_xref="CDD:294052"
     misc_feature    complement(order(159544..159546,159562..159564,
                     159571..159576))
                     /gene="MSV179"
                     /locus_tag="MseVgp178"
                     /note="active site"
                     /db_xref="CDD:238124"
     gene            159328..159510
                     /gene="MSV178"
                     /locus_tag="MseVgp179"
                     /db_xref="GeneID:1449952"
     CDS             159328..159510
                     /gene="MSV178"
                     /locus_tag="MseVgp179"
                     /codon_start=1
                     /product="ORF MSV178 hypothetical protein"
                     /protein_id="NP_048250.1"
                     /db_xref="GeneID:1449952"
                     /translation="MHRFIYVVITPNLSDNIRFDWFDFFGDAIIYLYNITYVVKRYYI
                     VKIIMRVINHIKSFVN"
     gene            complement(160757..161788)
                     /gene="MSV180"
                     /locus_tag="MseVgp180"
                     /db_xref="GeneID:1449765"
     CDS             complement(160757..161788)
                     /gene="MSV180"
                     /locus_tag="MseVgp180"
                     /note="hypothetical protein; putative homolog of vaccinia
                     virus L3L; The poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; the Entomopoxvirinae are a sub-family of the
                     Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048251.1"
                     /db_xref="GeneID:1449765"
                     /translation="MSDNEYLNNISIQKDLPLLNTLLKNTFVKTENDKAILSKLTDGN
                     NFNEDRIRTHALYTSIYSDCTALFRDKLNKMLVNKTVSIYSHELFCWLNLSDKVIKRE
                     SIGFPLIYKHERGKTGINILFETGKISTFNSVYNLTFGSRNVIDQLKFQKLLISYTLF
                     KSNIMYDTLIFDEFTIPETIITFKIQSMYFNIKLNVFVILSCKTSLYYADTSNSIIES
                     KYINDALAYFKESTEYNFIEYFLLNFINLLDLNCIPIYSTILSTDTINISSTPPKGIL
                     VKFLQNKKFNYGILADYFNCTYIIYYITESKPKKNEFLQHIVSSREDIFIAEDLIPII
                     KGYIIGKVC"
     misc_feature    complement(160766..161788)
                     /gene="MSV180"
                     /locus_tag="MseVgp180"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03020"
                     /db_xref="CDD:165319"
     gene            161820..163124
                     /gene="MSV181"
                     /locus_tag="MseVgp181"
                     /db_xref="GeneID:1449953"
     CDS             161820..163124
                     /gene="MSV181"
                     /locus_tag="MseVgp181"
                     /codon_start=1
                     /product="ORF MSV181 hypothetical protein"
                     /protein_id="NP_048252.1"
                     /db_xref="GeneID:1449953"
                     /translation="MINIKDNKKLMCTIIFSSLAVISISLSPIALYNTNLDNNITEKI
                     DKNIEMINKNKNLLTKNTQILNQNNKMINSLTEILYNSTGKTQNKILTKILNNFTKIL
                     NSNSEILNKSTKNQNKLLQIEDRLIEMQNDLIEIKHSNSELQNINNQLQNSYTELLNT
                     NKEIQNKITKLINRLMKNNNTDTKNLEKVTEIQNKLTEISYKYTEILNNNKHLQKKII
                     EIENSKRKNEIENLKEVFFKHSYMNKNVSSWKIFFEVYGISNDTIINIYNNNINDDKT
                     LKIFNILKKIACLLEQKINKKFSLNDFILFNIISTSEINNYLKQQIQISLNYWKNVHL
                     RFTLFNHTNRNTIFITNFNKSYNECDIQINDTLIKIDNNYIFNNQIKEILQLSISYII
                     GKFVNKRTILDERNVMNPFSLLYNKHDINCMLVKNCELNINY"
     misc_feature    162072..>162527
                     /gene="MSV181"
                     /locus_tag="MseVgp181"
                     /note="Chromosome segregation ATPase [Cell cycle control,
                     cell division, chromosome partitioning]; Region: Smc;
                     COG1196"
                     /db_xref="CDD:224117"
     gene            complement(163118..163771)
                     /gene="MSV182"
                     /locus_tag="MseVgp182"
                     /db_xref="GeneID:1449764"
     CDS             complement(163118..163771)
                     /gene="MSV182"
                     /locus_tag="MseVgp182"
                     /codon_start=1
                     /product="ORF MSV182 hypothetical protein"
                     /protein_id="NP_048253.1"
                     /db_xref="GeneID:1449764"
                     /translation="MKKYNESNDSNNILISKMESYCCDDNCVKYPKKCYLRCCQKNYC
                     YGCEKELQFCKCQCKQFIKDNENVYKTYIINDKTIKLKKLDYNSIYLSKFIDDNSRYM
                     FNISSKHFIIHKTYLTFCGNDNVNYNKINDIVKYYPSNTINYNFIINNKYINIDYKSD
                     DYTILNNFLEYNSYASKYIGDYKFGVYIFKIKDKTLLTILKKKSETAKLIDNLLNIQ"
     gene            163810..164538
                     /gene="MSV183"
                     /locus_tag="MseVgp183"
                     /db_xref="GeneID:1449954"
     CDS             163810..164538
                     /gene="MSV183"
                     /locus_tag="MseVgp183"
                     /codon_start=1
                     /product="ORF MSV183 putative myristylated membrane
                     protein, Molluscum contagiosum virus MC069R (vaccinia L1R)
                     homolog, similar to GB:U60315"
                     /protein_id="NP_048254.1"
                     /db_xref="GeneID:1449954"
                     /translation="MGASASVNTIVSNINNRVENSLTQEASASATANCNVEIGSITFK
                     STKGCVVEVSNLCSAQAEASVDAVVNATIDFYNDLSFEQKQEAPAWFTAAFGVNTTTT
                     NITNDFKNIVEQRCKADAVLNSSITVNNITVADCVAPESEGVIKFTFTNSGTAAGQCA
                     ISALLDLQVAGSNTVSAKQTTGTDWTVIFAYVALVAGIAIIAGIFYYIYKLRLSPKDK
                     VNIELAKLGATSSKIIQLSQYLRG"
     misc_feature    163810..164415
                     /gene="MSV183"
                     /locus_tag="MseVgp183"
                     /note="Lipid membrane protein of large eukaryotic DNA
                     viruses; Region: L1R_F9L; pfam02442"
                     /db_xref="CDD:280581"
     gene            164558..165805
                     /gene="MSV184"
                     /locus_tag="MseVgp184"
                     /db_xref="GeneID:1449955"
     CDS             164558..165805
                     /gene="MSV184"
                     /locus_tag="MseVgp184"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048255.1"
                     /db_xref="GeneID:1449955"
                     /translation="MKILNTLLDYINQIINMLFPNSEDEFNKLKIFENINIENKKTDE
                     IIKIFKEIEHKIANYVKTELYKMNQQDYIILYNKIESYIRSNNKPFELTPDERQQIYE
                     GLFTIKCYFDNEWMDKSITWIRNIFLHIIMIIIVSIIKHAIKTYMLTIKYIQDVRKDT
                     NLKTLIMLRNGILNIIVYKIIPIMLYIYKHDTSNLPNAFKYPPTDINELDTNKINNII
                     EYLKEEIEKNMFNYISGFKKYNMESINNMINVLKGDNCDKLCNPDEAKELLNFLQDPH
                     VQNMLLDGEIDLPQKNVIKDLNSKILNNSEYVTLNIMNELLDTNIGKKLMQIFTGSSS
                     ESLSNTILGAENKINNGINLNNNSFGFKDSDIVLITVMECLDAIRACANNSKNCCVKT
                     PSLTVNVNTPITKLSVDGTEFKL"
     misc_feature    164558..165802
                     /gene="MSV184"
                     /locus_tag="MseVgp184"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03026"
                     /db_xref="CDD:165324"
     gene            complement(165250..165438)
                     /gene="MSV185"
                     /locus_tag="MseVgp185"
                     /db_xref="GeneID:1449763"
     CDS             complement(165250..165438)
                     /gene="MSV185"
                     /locus_tag="MseVgp185"
                     /codon_start=1
                     /product="ORF MSV185 hypothetical protein"
                     /protein_id="NP_048256.1"
                     /db_xref="GeneID:1449763"
                     /translation="MTFFCGKSISPSSNIFCTCGSCKKFNNSLASSGLHNLSQLSPFN
                     TFIILLIDSILYFLNPDI"
     gene            165805..166827
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /db_xref="GeneID:1449956"
     CDS             165805..166827
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /codon_start=1
                     /product="ORF MSV186 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048257.1"
                     /db_xref="GeneID:1449956"
                     /translation="MKYTLIIITILFIYGTYELKLCDVCKCIDYGANCRNKFLDEYIN
                     RNNESILLDLHNISWIDLSYTLYTYNAQNIIKYMKTLSFLNISHNHLHNADVENLYLN
                     RRLFKLDLSYNFISYLYIIDHWIWLSVSHNTNISFYVVYSNLEYLDASYCGLTSFNYT
                     NVFPNLKYLNLSYNFLTHIDIKFINGYKLILNNNAIQYILNINNVRYVDLYNNNISTI
                     DSISIYNISYLNVLKNNIICNRTTLYTYLKYTYIIPINIKIACKMGKDEYDIENIICK
                     KIKDVYLNKYKHEMYYIEITAYILTFTVVLIIVVLYIIYIIINKYYENEYDNNNNNII
                     MNNLTL"
     misc_feature    165973..166044
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    166045..166116
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    166117..166233
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    166234..166299
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    166300..166365
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    166417..166479
                     /gene="MSV186"
                     /locus_tag="MseVgp186"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            166845..167630
                     /gene="MSV187"
                     /locus_tag="MseVgp187"
                     /db_xref="GeneID:1449957"
     CDS             166845..167630
                     /gene="MSV187"
                     /locus_tag="MseVgp187"
                     /codon_start=1
                     /product="ORF MSV187 putative late transcription factor
                     VLTF-2 homolog (vaccinia A1L), similar to SW:P33814"
                     /protein_id="NP_048258.1"
                     /db_xref="GeneID:1449957"
                     /translation="MNEYKTDFTKQEISEAALNLIKDLKSMFYEIHYIANQAIINDSI
                     KCIYCNDECYNGNVFNIKENSINIGYFCSNICRDIFYSIIQFIFNIPPNKVNFIPFQL
                     LNDNSKEDYNVIKKIFKNIDYKNLILFSKYNNEQIISNFKIILKNNKIWHFTYKFNFE
                     TKINKCLNCGSEEVDKDIILLTKYKTLQGFCSVICKDNICKQVYYTLIPKYKYLTYSV
                     PTQLLKNVDVKTMINKLKNKSNVYGGYTTYDSKNIKLEYFTPN"
     misc_feature    <167043..>167096
                     /gene="MSV187"
                     /locus_tag="MseVgp187"
                     /note="late transcription factor VLTF-2; Provisional;
                     Region: PHA03073"
                     /db_xref="CDD:177518"
     gene            167805..168011
                     /gene="MSV188"
                     /locus_tag="MseVgp188"
                     /db_xref="GeneID:1449958"
     CDS             167805..168011
                     /gene="MSV188"
                     /locus_tag="MseVgp188"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048259.1"
                     /db_xref="GeneID:1449958"
                     /translation="MIFDNLHCQGVDMTYYLYLKFIKKENSKKLREIIEPIKNNMVTI
                     YLETVIVKNTLRNKDKPIEYISPI"
     misc_feature    167805..168008
                     /gene="MSV188"
                     /locus_tag="MseVgp188"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03025"
                     /db_xref="CDD:165323"
     gene            complement(168000..169331)
                     /gene="MSV189"
                     /locus_tag="MseVgp189"
                     /db_xref="GeneID:1449762"
     CDS             complement(168000..169331)
                     /gene="MSV189"
                     /locus_tag="MseVgp189"
                     /codon_start=1
                     /product="ORF MSV189 putative core protein, Amsacta moorei
                     EPV entomopoxvirus G1L homolog (vaccinia I7L), similar to
                     SW:P29817"
                     /protein_id="NP_048260.1"
                     /db_xref="GeneID:1449762"
                     /translation="MQTTIRRFFNKNLKMPESGINYILMMLLDKFKIIHFINPIDYST
                     NANTPLINHFDKSETKGKISYIPLEFLLDFYKSQYGDLSINFKSEFEMKEYLINMLYI
                     YLSEKDIKINDFLKSSKYKNIPLIYFRKPFIKCEFSKTKDFSMYASIQDDYSRENNVH
                     IGFNNIHKIYPKANHGKDTWLHVFDIYNVVYPLTFINNDYEYYKLLHFPVTDSSRAMV
                     YSGCKFSKNQFMHHYSQFLKNNNKQFFIFPMIYNDHFTSAVIDKKRKICYLFNSSGYS
                     PEQIKHNKKYMFIDTDMNIKRYNIQNEKTSYLYHNIDILRHIFGDTINIFIMNSFEIQ
                     YDSPDCGMFTILFLYNIILNNLKCEMDFKKAYLYMTFVGDLIASSYRGIFFISKYDVK
                     KFDEYNTLNIIKMKNKKYEQSIDMYCKNMNRINKAVDKLNEKYNEFKNLNR"
     misc_feature    complement(168012..169319)
                     /gene="MSV189"
                     /locus_tag="MseVgp189"
                     /note="Vaccinia virus I7 processing peptidase; Region:
                     Peptidase_C57; pfam03290"
                     /db_xref="CDD:281306"
     gene            169350..170033
                     /gene="MSV190"
                     /locus_tag="MseVgp190"
                     /db_xref="GeneID:1449959"
     CDS             169350..170033
                     /gene="MSV190"
                     /locus_tag="MseVgp190"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048261.1"
                     /db_xref="GeneID:1449959"
                     /translation="MTVFSTTYYIVNTIIVLILLAAVIVIYVFYFLNSPIVYKSVTKI
                     IALNANGIALNNLNLLYTTDMILINDSTIKGIEVSSENNLKDLEVYTGDDVSKYTNYL
                     NFYSIYSGDQTVLVGISNAIQDIRPFIYFTPSIIAIVLVVNEICYCFMGSNNSVADDI
                     IATIYYITENYSSFVIVGPLTIEYTSQFLNIPINTDYRVITNKKILSLDTQIFSYEID
                     PGILFTIGS"
     misc_feature    169365..170030
                     /gene="MSV190"
                     /locus_tag="MseVgp190"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03024"
                     /db_xref="CDD:165322"
     gene            complement(170017..170628)
                     /gene="MSV191"
                     /locus_tag="MseVgp191"
                     /db_xref="GeneID:1449761"
     CDS             complement(170017..170628)
                     /gene="MSV191"
                     /locus_tag="MseVgp191"
                     /codon_start=1
                     /product="ORF MSV191 MTG motif gene family protein"
                     /protein_id="NP_048262.1"
                     /db_xref="GeneID:1449761"
                     /translation="MTMMEHIYEYIENKQNENIIMNPWIKDICLPMYNKSNVLITSSI
                     LKFLYFGPKIPINDSPGYIYVDEYKKNEIYAIYYSKDNIEFPCKIKINVDDMVLVKNY
                     LCYKLSEYKYGDSGELFKCDFDIILRAMEIPYNNELLTKNLEKVLIEKNITYSKSEYN
                     DSFRLIVHIDQFKLLINKLNIDILSKPYEAVEKIIQEYSMTQL"
     gene            170671..171024
                     /gene="MSV192"
                     /locus_tag="MseVgp192"
                     /db_xref="GeneID:1449960"
     CDS             170671..171024
                     /gene="MSV192"
                     /locus_tag="MseVgp192"
                     /codon_start=1
                     /product="ORF MSV192 hypothetical protein"
                     /protein_id="NP_048263.1"
                     /db_xref="GeneID:1449960"
                     /translation="MEKIKIFNKNEFNDIKKFQKENKLTNNALFNAWYEDKNPFCYCV
                     IKNDKIICIVLLSHCDFSDKKYILNYIYTLKNYRRQGYAFKLVNYIKHKINFSVFCMN
                     YESKKLFEKCGLFKM"
     misc_feature    <170761..171012
                     /gene="MSV192"
                     /locus_tag="MseVgp192"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:290041"
     misc_feature    170806..171009
                     /gene="MSV192"
                     /locus_tag="MseVgp192"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:278980"
     misc_feature    order(170881..170889,170917..170922)
                     /gene="MSV192"
                     /locus_tag="MseVgp192"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            170978..171289
                     /gene="MSV193"
                     /locus_tag="MseVgp193"
                     /db_xref="GeneID:1449961"
     CDS             170978..171289
                     /gene="MSV193"
                     /locus_tag="MseVgp193"
                     /codon_start=1
                     /product="ORF MSV193 hypothetical protein"
                     /protein_id="NP_048264.1"
                     /db_xref="GeneID:1449961"
                     /translation="MNQKNCLKNVDYLKCKLQLLGQLLFISFQKLNFLSTLQSNVSVK
                     YSSNSLRLIDVLLYFSNASFNNSSFSLEDKLSNNFIFLITTLFAVICLLIVILSSNII
                     G"
     gene            complement(171010..172239)
                     /gene="MSV194"
                     /locus_tag="MseVgp194"
                     /db_xref="GeneID:1449760"
     CDS             complement(171010..172239)
                     /gene="MSV194"
                     /locus_tag="MseVgp194"
                     /codon_start=1
                     /product="ORF MSV194 ALI motif gene family protein"
                     /protein_id="NP_048265.1"
                     /db_xref="GeneID:1449760"
                     /translation="MDLDNLIFNNKKIHIAIYENKPYFKGKDIAEILEYKDTNDAIKK
                     HVDDDDKSKYEDLINRPGILPSLTYNEKNTIYISESGLYSLILSSKKSEAKIFKKWIT
                     NEVLPNIRKHGEYKIKKELETLTTNFQNLLTLKEQEKEQLQQQLNQEKEQLQQQLDQE
                     NKIKEELEKQKKLNEQYKEYCNRLQKLEKNEIIYVLTNNTDLSKNIFKIGKTNINSIK
                     NRLSTYNTGASDPYYYVFYKEVYDATKIEKDFNTLMNRYNINVTSPNKTKLNNELYKL
                     YYLDLEYVLNAVIDSNDTLINIIKEKHEEFYINSINKQSVVYPIIFEDNITINRQITA
                     NNVVIKNIKLFDSLSSNEKEELLKEAFEKYNKTSIKRKEFEEYFTETFDCKVDKKLSF
                     WNDMKSNCPNNCSLHFK"
     misc_feature    complement(171919..172206)
                     /gene="MSV194"
                     /locus_tag="MseVgp194"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     smart01040"
                     /db_xref="CDD:214989"
     misc_feature    complement(171373..171666)
                     /gene="MSV194"
                     /locus_tag="MseVgp194"
                     /note="T5orf172 domain; Region: T5orf172; pfam10544"
                     /db_xref="CDD:287509"
     gene            complement(172287..172550)
                     /gene="MSV195"
                     /locus_tag="MseVgp195"
                     /db_xref="GeneID:1449759"
     CDS             complement(172287..172550)
                     /gene="MSV195"
                     /locus_tag="MseVgp195"
                     /codon_start=1
                     /product="ORF MSV195 ALI motif gene family protein"
                     /protein_id="NP_048266.1"
                     /db_xref="GeneID:1449759"
                     /translation="MNLDNLIFNNKKIHIVIDNNNKVLFKAKNCAEILKYTNPLKAIR
                     DHVRQKHQISFKNINMNDSFILNNIHPDTIFITESDFYSLISK"
     misc_feature    complement(<172296..172517)
                     /gene="MSV195"
                     /locus_tag="MseVgp195"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:280632"
     gene            complement(172537..173145)
                     /gene="MSV196"
                     /locus_tag="MseVgp196"
                     /db_xref="GeneID:1449758"
     CDS             complement(172537..173145)
                     /gene="MSV196"
                     /locus_tag="MseVgp196"
                     /codon_start=1
                     /product="ORF MSV196 ALI motif gene family protein"
                     /protein_id="NP_048267.1"
                     /db_xref="GeneID:1449758"
                     /translation="MNIYVAIFNNKSYFRAKDCASILEFKHTKDAIRHYVSNGNKIKF
                     KNINIRSKKYIHPHTVFINNFGLIELILKHKSIVHHNIIDKLICKFDLNVDLNITPKE
                     QKYIDVIISCFINHRYKTQYKVFEFYIDLYFTDLKIAIECDKYNYNGHYTSYDKYRQI
                     LIQNELNCKFIRFNPYDTDFNIYNLINKIHVFILKNKTNEFR"
     misc_feature    complement(172918..173136)
                     /gene="MSV196"
                     /locus_tag="MseVgp196"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:280632"
     gene            complement(173279..174289)
                     /gene="MSV197"
                     /locus_tag="MseVgp197"
                     /db_xref="GeneID:1449757"
     CDS             complement(173279..174289)
                     /gene="MSV197"
                     /locus_tag="MseVgp197"
                     /codon_start=1
                     /product="ORF MSV197 tryptophan repeat gene family
                     protein"
                     /protein_id="NP_048268.1"
                     /db_xref="GeneID:1449757"
                     /translation="MQYYYEFYKLYKVYLSTNKENRTVIIDYIKKYNNVSLIYILSKY
                     NNLNEDFIIDMQDIFDWDHISISQKLSESFIRKFKDKVNWKEISKHQKLSEKFIIEFQ
                     DNVNWEEISKYQILSEKFIIKHKDKVNWDLLYNKNFSINFIRKYQDKLNWKKVSAFIE
                     LTDDNIIEFKDKINWRYLCEFNKLSIDIIKKYKDKMHWCNISCNNLLTLDIMREYKNE
                     INWCIVIIQNHTILTKDIVIEFRDKLLPYWIHILDKFRNLSKSELIEIFFPYDIIFEN
                     YNECPICLSDEKCLFSKTICKHVFHKKCIDNWLLNNYNCPLCKTEIKNKYIFKMINEI
                     SV"
     misc_feature    complement(173324..173455)
                     /gene="MSV197"
                     /locus_tag="MseVgp197"
                     /note="RING-finger (Really Interesting New Gene) domain, a
                     specialized type of Zn-finger of 40 to 60 residues that
                     binds two atoms of zinc; defined by the 'cross-brace'
                     motif C-X2-C-X(9-39)-C-X(1-3)-
                     H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved
                     in...; Region: RING; cd00162"
                     /db_xref="CDD:238093"
     misc_feature    complement(order(173336..173338,173345..173347,
                     173378..173380,173387..173389,173396..173398,
                     173402..173404,173441..173443,173450..173452))
                     /gene="MSV197"
                     /locus_tag="MseVgp197"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:238093"
     gene            complement(174316..175515)
                     /gene="MSV198"
                     /locus_tag="MseVgp198"
                     /db_xref="GeneID:1449756"
     CDS             complement(174316..175515)
                     /gene="MSV198"
                     /locus_tag="MseVgp198"
                     /codon_start=1
                     /product="ORF MSV198 MTG motif gene family protein"
                     /protein_id="NP_048269.1"
                     /db_xref="GeneID:1449756"
                     /translation="MLNIFEFIEQNNFDIKLGPWFNEIWIPLFNETELLITLNILNFI
                     HYGTSNVVLDYHPMRNNTNLKRDFEKILNNNKINYKKIKYNDIINNEDYYNKVKEEIE
                     NIRPCNLEKSTWFILSVDEFKMLIMRLSTNVAIEVREYFILLEKILFKYSNYTNKYLI
                     EESIKQIKQKDEQLKILQSSNNVLNNFVNNIKQKNKKGYIYIATSKNYAKLNTFKIGK
                     TDNLISKRQSQLNNSHTSFDKIYICYYEAVYNPNKVEQIIHDVLESFRDSSNNEFFIL
                     HYKYLLNIVKLIIKNINEPYDNINDIIKNELIKMYDLKPFIPEELIITSESILLNELK
                     DKIFALLDEYIESNNLNITRSELLRKLDICSCNKLTLWKHISKILNWEKSNKPINYKN
                     TQIIIRY"
     misc_feature    complement(175072..175512)
                     /gene="MSV198"
                     /locus_tag="MseVgp198"
                     /note="MSV199 domain; Region: MSV199; pfam10553"
                     /db_xref="CDD:287517"
     misc_feature    complement(174649..174924)
                     /gene="MSV198"
                     /locus_tag="MseVgp198"
                     /note="T5orf172 domain; Region: T5orf172; pfam10544"
                     /db_xref="CDD:287509"
     gene            complement(175573..176049)
                     /gene="MSV199"
                     /locus_tag="MseVgp199"
                     /db_xref="GeneID:1449755"
     CDS             complement(175573..176049)
                     /gene="MSV199"
                     /locus_tag="MseVgp199"
                     /codon_start=1
                     /product="ORF MSV199 MTG motif gene family protein"
                     /protein_id="NP_048270.1"
                     /db_xref="GeneID:1449755"
                     /translation="MLNIFEFIEQNNFEINLGSWFNEIWLPLFNKTELLITLNILHFI
                     HYGTSKSVLDGNTTLNYRELKRDFEKILNNNKIKYKKIKYEEIVNNKNYYELVKNEIK
                     NITPNNLNKSTWFILDVLQFKMLIMRLSTNVAKEICEYYVTLENILHKYKLHNYFY"
     misc_feature    complement(175606..176046)
                     /gene="MSV199"
                     /locus_tag="MseVgp199"
                     /note="MSV199 domain; Region: MSV199; pfam10553"
                     /db_xref="CDD:287517"
     gene            176444..176635
                     /gene="MSV200"
                     /locus_tag="MseVgp200"
                     /db_xref="GeneID:1449962"
     CDS             176444..176635
                     /gene="MSV200"
                     /locus_tag="MseVgp200"
                     /codon_start=1
                     /product="ORF MSV200 hypothetical protein"
                     /protein_id="NP_048271.1"
                     /db_xref="GeneID:1449962"
                     /translation="MSLNQGPKLNSNIFSILNINFSYTVNKNNYVEVIQIPLNQCPIY
                     LFFIDCFIKNVSNIPIKTQ"
     gene            complement(176622..177155)
                     /gene="MSV201"
                     /locus_tag="MseVgp201"
                     /db_xref="GeneID:1449754"
     CDS             complement(176622..177155)
                     /gene="MSV201"
                     /locus_tag="MseVgp201"
                     /codon_start=1
                     /product="ORF MSV201 hypothetical protein"
                     /protein_id="NP_048272.1"
                     /db_xref="GeneID:1449754"
                     /translation="MTNIPKCHIPKNLMMFNNMIISNRICIAKYKLNLLLDKEKLLNY
                     DMINKIDNIFHEYYNFEHSNGIPINIMKLVEIIMDQESNILNIIHKIENSLKKYYKFC
                     ISLPENQESYIDIEYKFVNNGNCHKRKLPENFDDDVCNYKMKKIENVESNLKRKLSEN
                     FDDDDCNCKIKKMIIGF"
     gene            complement(177221..178207)
                     /gene="MSV202"
                     /locus_tag="MseVgp202"
                     /db_xref="GeneID:1449753"
     CDS             complement(177221..178207)
                     /gene="MSV202"
                     /locus_tag="MseVgp202"
                     /codon_start=1
                     /product="ORF MSV202 hypothetical protein"
                     /protein_id="NP_048273.1"
                     /db_xref="GeneID:1449753"
                     /translation="MEYINNSSMLSIKYIKDNLNNFLNIPYNAKLKYHKLEDFDEIQY
                     DNLLSKIYNDKQNYALLKYLITIGIKYHNIKDDYLFLLPINMFDTFIYCTDNIKIKYL
                     FHKYKIENANKFDNICNYLAWIDPIYYINKIGLVEKMGFYDINDLLIYLYNFTYDIFT
                     NNAYKYIKDETLKNILIYICPFIYNDNGIIKIRKHKYKYLLPYNNELQMLSIDKYTRF
                     MIFIANNGKWNIPEIIDHKEEIICEYLNIELFDNYILMPCINKWLENNKNIINNKIIK
                     LMLTHKLKDSTIKLIFDSLDIHLIYNLYKKYYKRCIPEIHNIIKERMMNMIS"
     gene            178373..178558
                     /gene="MSV203"
                     /locus_tag="MseVgp203"
                     /db_xref="GeneID:1449963"
     CDS             178373..178558
                     /gene="MSV203"
                     /locus_tag="MseVgp203"
                     /codon_start=1
                     /product="ORF MSV203 hypothetical protein"
                     /protein_id="NP_048274.1"
                     /db_xref="GeneID:1449963"
                     /translation="MTLHVAHFSTGTNPLKSILTRYVTIHYIYTIYSLFIIKSCITFI
                     ISNILDFSSKITNLQFN"
     gene            complement(178465..179133)
                     /gene="MSV204"
                     /locus_tag="MseVgp204"
                     /db_xref="GeneID:1449752"
     CDS             complement(178465..179133)
                     /gene="MSV204"
                     /locus_tag="MseVgp204"
                     /codon_start=1
                     /product="ORF MSV204 ALI motif gene family protein"
                     /protein_id="NP_048275.1"
                     /db_xref="GeneID:1449752"
                     /translation="MEIINYNNNQIHLLYTTIGEVYYKGKDIAKILRYIDTKKVIRNN
                     VLSTNKVNYSTLIKNVSINGQLHKTPHHTIFINTKGLKNLFDMPVKRLSNKEINDLIE
                     FLNSHNIKKSSNSNNIIEKYNINKHNLSTSTHNTKDNILTNIIKCFKNDKYKIEYHIG
                     EYYIDLYFPVYKIAVEYKNNNYNKNRQIEIENQLNCKFVIFDEKSNIFDIINVIHDLM
                     MNNE"
     misc_feature    complement(<178882..179106)
                     /gene="MSV204"
                     /locus_tag="MseVgp204"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:280632"
     gene            complement(179160..180752)
                     /gene="MSV205"
                     /locus_tag="MseVgp205"
                     /db_xref="GeneID:1449751"
     CDS             complement(179160..180752)
                     /gene="MSV205"
                     /locus_tag="MseVgp205"
                     /codon_start=1
                     /product="ORF MSV205 tryptophan repeat gene family
                     protein"
                     /protein_id="NP_048276.1"
                     /db_xref="GeneID:1449751"
                     /translation="MPTCSEIINKLKENGLSYVSGFKKQQLLNLLEYKFDNIPNDKLY
                     KIFYNSDTKYKFKIIQYIISNNISNRHIDSFIIYYYNNLDINYIKKNPNTVNWALVSK
                     HSNINIQFALEFEDKLDWFIISTEKYLSVDFIIKFEHRLYLREIPIRYLPESLIRRYN
                     DILDWTSISEYIYFDSDNIPHHRSIEFFRDFADKLNWNLISSRLNAIISEFIIVFKDK
                     LNWTILSDKKLSIDFIKEFKDYLNWNIISNKKLYNHFIDEYKDYLNWDSISINKKISK
                     SFLIKYKNRLNWKYICQYQKLSEDVIMKFKNKIDWDVLYKYQKLSENIIEKFYYKVPF
                     EYICQYQILSDNFIRKNENKINWNIVSKHQKLSEDIILQYHDKLHWEYISQYQELSED
                     IILQYHDKLHWEYIAKHQILSEYLIEKFEIKLNWDDISKYQTLSEYFIKKHINKINKY
                     NICTYQNISNKLYIELCKAYEIFDNINNEDCIICLSNEQNNFTKTMCNHIFHKKCIDI
                     WLNNNNTCPMCRRQIIIQRKNI"
     misc_feature    complement(179193..179330)
                     /gene="MSV205"
                     /locus_tag="MseVgp205"
                     /note="RING-H2 zinc finger; Region: zf-rbx1; pfam12678"
                     /db_xref="CDD:289448"
     misc_feature    complement(179184..179315)
                     /gene="MSV205"
                     /locus_tag="MseVgp205"
                     /note="RING-finger (Really Interesting New Gene) domain, a
                     specialized type of Zn-finger of 40 to 60 residues that
                     binds two atoms of zinc; defined by the 'cross-brace'
                     motif C-X2-C-X(9-39)-C-X(1-3)-
                     H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved
                     in...; Region: RING; cd00162"
                     /db_xref="CDD:238093"
     misc_feature    complement(order(179196..179198,179205..179207,
                     179238..179240,179247..179249,179256..179258,
                     179262..179264,179301..179303,179310..179312))
                     /gene="MSV205"
                     /locus_tag="MseVgp205"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:238093"
     gene            complement(180771..181634)
                     /gene="MSV206"
                     /locus_tag="MseVgp206"
                     /db_xref="GeneID:1449750"
     CDS             complement(180771..181634)
                     /gene="MSV206"
                     /locus_tag="MseVgp206"
                     /codon_start=1
                     /product="ORF MSV206 putative glycosyl transferase,
                     similar to Haemophilus somnus GB:U20824"
                     /protein_id="NP_048277.1"
                     /db_xref="GeneID:1449750"
                     /translation="MNIRYHIIVLTIKRNKQRQKDIINYMNAQKYNNYSFFYGIDYKQ
                     NKDNVKYVARHIFKQISPYGVMACAASHILLWKFIASLESKYDFVIVLEDDTIINIDK
                     LNKYIDYIYNLTKTGFTFLYSDYCLGWDSKIIIDKECTIIKNPMINMSLGAYALTSNI
                     AKIISDYYIEYKVWFHIDVQLSLDIVNYMNISSYILCVNKMIVQPSGYNSSMGLKHNS
                     LFLYSINNTTMYRLLTTPFFRIKELEFDAYTVAILIILLILLLYNSLTVFSIILFFLI
                     IYEMILIYISG"
     misc_feature    complement(<181332..181619)
                     /gene="MSV206"
                     /locus_tag="MseVgp206"
                     /note="Glycosyltransferase family 25 [lipooligosaccharide
                     (LOS) biosynthesis protein] is a family of
                     glycosyltransferases involved in LOS biosynthesis. The
                     members include the beta(1,4) galactosyltransferases: Lgt2
                     of Moraxella catarrhalis, LgtB and LgtE of...; Region:
                     Glyco_transf_25; cl01298"
                     /db_xref="CDD:294790"
     gene            complement(181635..181871)
                     /gene="MSV207"
                     /locus_tag="MseVgp207"
                     /db_xref="GeneID:1449749"
     CDS             complement(181635..181871)
                     /gene="MSV207"
                     /locus_tag="MseVgp207"
                     /codon_start=1
                     /product="ORF MSV207 hypothetical protein"
                     /protein_id="NP_048278.1"
                     /db_xref="GeneID:1449749"
                     /translation="MIDQLQIKYQKLIKSYNLLNQYNMQHISEIQSLKKRINELERII
                     QEINNQSFDYALLQCNILKRIYDISMVYKNSLNI"
     misc_feature    complement(<181713..>181871)
                     /gene="MSV207"
                     /locus_tag="MseVgp207"
                     /note="Dynein heavy chain, N-terminal region 1; Region:
                     DHC_N1; pfam08385"
                     /db_xref="CDD:312031"
     gene            complement(181897..182595)
                     /gene="MSV208"
                     /locus_tag="MseVgp208"
                     /db_xref="GeneID:1449748"
     CDS             complement(181897..182595)
                     /gene="MSV208"
                     /locus_tag="MseVgp208"
                     /codon_start=1
                     /product="ORF MSV208 putative uracil DNA glycosylase UNG
                     (vaccinia D4R), similar to Equine herpesvirus GB:U20824"
                     /protein_id="NP_048279.1"
                     /db_xref="GeneID:1449748"
                     /translation="MTFYDFIPDNWKCYIDKKLIIDIENRLNDKHIIKPSKENIFKCF
                     KYFNPEHTNVVILGYRPFSLIQDGLAFSCPNEYKNKPIENKLFINEIFSNYNRLDKIS
                     DKMHKSSLECLAKQGVLLLNVNLTIGSNINDHSDIGWEYLTNDIIKKISINNDNIVFI
                     LIGSKMHDKCNIIHNIDNHFIIKTSYPSYQTLYSENSKYNVIPFINSKCFIKANEYLK
                     IHKNIEIDWISCLI"
     misc_feature    complement(181915..182547)
                     /gene="MSV208"
                     /locus_tag="MseVgp208"
                     /note="Family 1 of Uracil-DNA glycosylase (UDG) enzymes;
                     Region: UDG_F1; cd10027"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(182038..182040,182230..182232,
                     182347..182349,182383..182388,182410..182424))
                     /gene="MSV208"
                     /locus_tag="MseVgp208"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(182023..182034,182038..182043,
                     182104..182109,182347..182355,182407..182412,
                     182416..182421))
                     /gene="MSV208"
                     /locus_tag="MseVgp208"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(182026..182034,182038..182040,
                     182104..182109,182203..182208,182347..182355,
                     182404..182412,182419..182421))
                     /gene="MSV208"
                     /locus_tag="MseVgp208"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(182038..182040,182416..182418))
                     /gene="MSV208"
                     /locus_tag="MseVgp208"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            182790..183131
                     /gene="MSV209"
                     /locus_tag="MseVgp209"
                     /db_xref="GeneID:1449964"
     CDS             182790..183131
                     /gene="MSV209"
                     /locus_tag="MseVgp209"
                     /note="hypothetical protein; putative vaccinia A21L
                     homolog; The poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; the Entomopoxvirinae are a sub-family of the
                     Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048280.1"
                     /db_xref="GeneID:1449964"
                     /translation="MVFLFFMIYFFILSINIILNKELYKLELDKKLYQVAEDDLKTTI
                     SCINDYWFIVKRNSRYLDLQYLRRNNNYVPCTTTPLASDFLDSCGLNAKYNNKKEPCY
                     AALLNLLFLLR"
     misc_feature    182790..183101
                     /gene="MSV209"
                     /locus_tag="MseVgp209"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03023"
                     /db_xref="CDD:165321"
     gene            183142..183477
                     /gene="MSV210"
                     /locus_tag="MseVgp210"
                     /db_xref="GeneID:1449965"
     CDS             183142..183477
                     /gene="MSV210"
                     /locus_tag="MseVgp210"
                     /codon_start=1
                     /product="ORF MSV210 hypothetical protein"
                     /protein_id="NP_048281.1"
                     /db_xref="GeneID:1449965"
                     /translation="MKKYNYIITLSNMAFFELEVNMVKDLMIKYEHGIVTKNHYFDML
                     NIILNTVNNKIINTLYHTYVNANNDDDKIIDIMNKLYNDMNELIFLIQNIFTNHLVEH
                     QYVLKNLEI"
     gene            complement(183498..183743)
                     /gene="MSV211"
                     /locus_tag="MseVgp211"
                     /db_xref="GeneID:1449866"
     CDS             complement(183498..183743)
                     /gene="MSV211"
                     /locus_tag="MseVgp211"
                     /codon_start=1
                     /product="ORF MSV211 hypothetical protein"
                     /protein_id="NP_048282.1"
                     /db_xref="GeneID:1449866"
                     /translation="MVNMENKIIIDDMEIFIYDYNDYYNIGNEIYYLNKNDIKNININ
                     NIFLLFNNYKFRIFKSKYIIVIDYYEYNNHDKKCYCI"
     gene            complement(183737..184138)
                     /gene="MSV212"
                     /locus_tag="MseVgp212"
                     /db_xref="GeneID:1449747"
     CDS             complement(183737..184138)
                     /gene="MSV212"
                     /locus_tag="MseVgp212"
                     /codon_start=1
                     /product="ORF MSV212 hypothetical protein"
                     /protein_id="NP_048283.1"
                     /db_xref="GeneID:1449747"
                     /translation="MLSVKLVNKDGIYNLITPYYTYIFKKDVTIIDIIPVINNIQNIE
                     LYTSKDSCKYIYSNLIKSFIIPNSIEKKIKLSFDNGMSILESSHIKYDISNYNRFLES
                     VLSIILLNKGNDVIITCKDISINILNLISQW"
     gene            184168..185163
                     /gene="MSV213"
                     /locus_tag="MseVgp213"
                     /db_xref="GeneID:1449966"
     CDS             184168..185163
                     /gene="MSV213"
                     /locus_tag="MseVgp213"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_048284.1"
                     /db_xref="GeneID:1449966"
                     /translation="MFIQFYVNVLRDRLKILSIFNPNGTLWCDGTKCEIVFTSNFKCC
                     ISIPFIKTNITELRGFDICYDKISELSLKNSIADKITLTFKDNGIYVEELIFENNINI
                     IDPKYISMQSISQINTPSNNNNNFASAERIDDISDINETDNIISEKLELKKHDSGDLT
                     IGYTIHDKFTLNTNNTYKYRINPNMYNKVGAVFKIKLDVLTEFIKKLMTTKGASIEMQ
                     VIKNTIKFKAYRTDNIKNNTIDESCLYCSLINLYYPILRKYKIALNNFALLKKLNISI
                     SDFKAKDKKIYKYIQFNIIMQEDLVIGLCIYPGSANITNPEELQNYFIFMPVENY"
     misc_feature    184168..185160
                     /gene="MSV213"
                     /locus_tag="MseVgp213"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03022"
                     /db_xref="CDD:165320"
     gene            complement(185141..186301)
                     /gene="MSV214"
                     /locus_tag="MseVgp214"
                     /db_xref="GeneID:1449746"
     CDS             complement(185141..186301)
                     /gene="MSV214"
                     /locus_tag="MseVgp214"
                     /codon_start=1
                     /product="ORF MSV214 SCG gene family protein"
                     /protein_id="NP_048285.1"
                     /db_xref="GeneID:1449746"
                     /translation="MNNNIIFYVIVGIIFFIFFIIKCINNYNYNYNYTTEFIIIKGSF
                     RESIINSRTFDNLIDLNLKPSFMFFTNFIKNELIAYGGFYNNSLTFPTNNIINGSLNW
                     LYPGWFAVVNGRGDYICANSNNKNIRRLNYDKNILKYLTSNSSDINDHIIITNILYNF
                     NEIVLISINKIASTNDDAEYYNILGNIILYIKNNFINDKLFIMCGETGLNGKYIQSII
                     NNIFKKNTTISSCYDGIFNYVSDNIYSQTSFILIDKRLCPYGIKFGLRYVENEISLNN
                     LIIYATVFNSNNRTKKVEYYNDDISINIINSIKSQINYNDKFVNWENIDISNLNNNFT
                     NDSINMVDDPTSYTREKLDTILNNINYNIKLLNDKIDSISEQLLNSNNFQQA"
     misc_feature    complement(185228..186199)
                     /gene="MSV214"
                     /locus_tag="MseVgp214"
                     /note="Protein of unknown function (DUF1157); Region:
                     DUF1157; pfam06636"
                     /db_xref="CDD:253836"
     gene            complement(186322..187434)
                     /gene="MSV215"
                     /locus_tag="MseVgp215"
                     /db_xref="GeneID:1449745"
     CDS             complement(186322..187434)
                     /gene="MSV215"
                     /locus_tag="MseVgp215"
                     /codon_start=1
                     /product="ORF MSV215 SCG gene family protein"
                     /protein_id="NP_048286.1"
                     /db_xref="GeneID:1449745"
                     /translation="MIYFVLLVVLAIYLIIYIIWDINDFISKIKNYINNDYSNLIMSK
                     LPVNEEEIVEFNIIVGWMDNVILDRCLDGLQYSKIKPTLVFLSNLKTDDILAYGGFNK
                     LLNYPINNIINRNGWIYNGYFILGNGNGDFICVDSNNSNIKRYDKNYTVDKLSINPGK
                     TNDNIIVLNIIYKSEELLLININELSSDFNNSEYYEYLGNILLYIKNNYLNNKKFIIC
                     GSVGLNSKYINLAIETIFLDTVISSCYNGSITYFNNNGLYAQTTFIILDKNLCSYGVR
                     FGVKYLENEILKYNLLLYAYIYNENYTGNKIEYFTDALSINIFESIKSRSDYIDDYVN
                     WDKIDTSTLNTNFEYKKDYLKNDTSSYTKEILTYDE"
     misc_feature    complement(186334..187431)
                     /gene="MSV215"
                     /locus_tag="MseVgp215"
                     /note="Protein of unknown function (DUF1157); Region:
                     DUF1157; pfam06636"
                     /db_xref="CDD:253836"
     gene            complement(187431..188543)
                     /gene="MSV216"
                     /locus_tag="MseVgp216"
                     /db_xref="GeneID:1449744"
     CDS             complement(187431..188543)
                     /gene="MSV216"
                     /locus_tag="MseVgp216"
                     /codon_start=1
                     /product="ORF MSV216 SCG gene family protein"
                     /protein_id="NP_048287.1"
                     /db_xref="GeneID:1449744"
                     /translation="MKYIYFVIVGIVFIIYLFIFTNYYTNTNVYNVLNNTLTEISNNI
                     LSKINTKDYSNNIILYGLSSRNNSIYRSLDGIQYEKNIPSIVFFNNFLRNEYVNNENK
                     YLNFPNNNLNKSSQWIYGGWFINANANLDAICVRSNNLNNFNRFYGQFYESYIQYDPS
                     DDNDHIIVSKILYKNQIDILLINVTKISQGNIISNDYFQYTGKILTYIKKEIIKDNLF
                     ILFCDNGLNGKYNKLIIDTVFGDDVITSCYDGVITYARDNTFTQSIFFCIKKSLCENG
                     VKFGLKYPISDPTPFTNILLYAIIYNEPNENEYFNDPLTITILESIKSSSNYDNKYVE
                     WNLIDTSTLDTNFENIYVFKEEKYISKKNIESLLNK"
     misc_feature    complement(187434..188534)
                     /gene="MSV216"
                     /locus_tag="MseVgp216"
                     /note="Protein of unknown function (DUF1157); Region:
                     DUF1157; pfam06636"
                     /db_xref="CDD:253836"
     gene            complement(188540..189685)
                     /gene="MSV217"
                     /locus_tag="MseVgp217"
                     /db_xref="GeneID:1449743"
     CDS             complement(188540..189685)
                     /gene="MSV217"
                     /locus_tag="MseVgp217"
                     /codon_start=1
                     /product="ORF MSV217 SCG gene family protein"
                     /protein_id="NP_048288.1"
                     /db_xref="GeneID:1449743"
                     /translation="MIEYVIVGIIFLIFLLIFLLKYEKNKYINFLKDTNTNILSEYYK
                     QLSNTFSDSIVNEIGIDFMITQGSFENSIIDNVMNGMQSIKNIPTFIFLNNLKTSDVI
                     MYGGFNATLDFPANNITNESDNWIYGGYFIVANNGDFISVKANNEKIRRFNKSDNIIN
                     NLKYNDNSLTSNIMYTNIIYNLKEVILINIRMSKPDNALNENYYSIFLNILVYLNINV
                     IKDKNFIISGITGINSKFMDLAIKTVFLDNTISSCYNNSFTNVENDILVQSSFIIIHK
                     DLCPYGVRFGIRYLEISSSNFNFILYATVYNKNIGEYTVNYFDDKLTLDIFKYYQSSD
                     NFIDDYINWDKINIDNLTKEYEINEDTLIDNNNVKYSRTLLENIINK"
     misc_feature    complement(188543..189622)
                     /gene="MSV217"
                     /locus_tag="MseVgp217"
                     /note="Protein of unknown function (DUF1157); Region:
                     DUF1157; pfam06636"
                     /db_xref="CDD:253836"
     gene            complement(189977..190939)
                     /gene="MSV218"
                     /locus_tag="MseVgp218"
                     /db_xref="GeneID:1449742"
     CDS             complement(189977..190939)
                     /gene="MSV218"
                     /locus_tag="MseVgp218"
                     /codon_start=1
                     /product="ORF MSV218 hypothetical protein"
                     /protein_id="NP_048289.1"
                     /db_xref="GeneID:1449742"
                     /translation="MYLWKSNICTCSQVINNPLYNIKDSKKVCIIHKNYYKKILCENY
                     HLFNKSRNIKKYFDYILKNIFPKLSLESIIYIYNNELSKYINHIEVLYREYYTKLFLN
                     SNELDENHNLWINYLKSTYSEYNFNTDFNNIKLQLFNPLKILDLNIPKNDHNKSGILF
                     IKNITYNKKPNNIYLLYSCGIIFYNPEKNNCCSNLNNIIKFKEISIELASILYGKKIN
                     YKNICNALYIMYKSKKILKYNKYKLLKILFPNTYDEYYFKNDIIYNSNEYYDFHNFDI
                     YNAIKTLNKYNLLIYLKLNYKSFDILNYLNIEVNHKNKIYTRIM"
     gene            190981..191472
                     /gene="MSV219"
                     /locus_tag="MseVgp219"
                     /db_xref="GeneID:1449967"
     CDS             190981..191472
                     /gene="MSV219"
                     /locus_tag="MseVgp219"
                     /codon_start=1
                     /product="ORF MSV219 hypothetical protein"
                     /protein_id="NP_048290.1"
                     /db_xref="GeneID:1449967"
                     /translation="MNILYNNYTEGLILYNPIKIYEINDQEKIKLNLHLFMDKKKFKI
                     NMHTLSFNEFMSKLYLIIVSKIKDNNLKENIHTYLKYNININEYKNINTEINDINKDI
                     DILNNKISNNDYNILKDICYIICKIDNIKNIKNTKIKNVLYIKNSLYSNIDKNIIIVN
                     NKI"
     gene            191566..191928
                     /gene="MSV220"
                     /locus_tag="MseVgp220"
                     /db_xref="GeneID:1449968"
     CDS             191566..191928
                     /gene="MSV220"
                     /locus_tag="MseVgp220"
                     /codon_start=1
                     /product="ORF MSV220 hypothetical protein"
                     /protein_id="NP_048291.1"
                     /db_xref="GeneID:1449968"
                     /translation="MIILLLLHNYIDIKSISEYYKRYPKNNFLHELKKYKNSYELIIN
                     EYFIMHYNIYINSNYKELFKKIYKYRNYEHLINHYSEIIKNYILHNYSLFDKEKCDKI
                     LNNNNSKEVIQQCYEFFL"
     gene            191912..193384
                     /gene="MSV221"
                     /locus_tag="MseVgp221"
                     /db_xref="GeneID:1449969"
     CDS             191912..193384
                     /gene="MSV221"
                     /locus_tag="MseVgp221"
                     /codon_start=1
                     /product="ORF MSV221 hypothetical protein"
                     /protein_id="NP_048292.1"
                     /db_xref="GeneID:1449969"
                     /translation="MNFFYEIILFIISIIIKMNLTNACNDIINYLNNIDSRLLKIFIK
                     NKTFISGSFVSYMIAINKLKKNDDIDLYCSDPDQLIKDFDDLNIHSLVNRFNNTINYF
                     IKYNTELIKFQIIYAKISSLKFIDNYDISLTKVAYVTHENYIYLSEEFKNDYNKKEFH
                     ASDIISNYRYNKYESFARLNYNSQIKKIKFDYDYKIDYYNYINKCNTIVGITGIPFTY
                     SMELLDDSIKCNAMKGCILSDCKNKSIKYICKNCIEKLKFNIVLDNEFYNKHFIVFGA
                     ATRFGNLIFEYLSSNVNNCIGTSYWYESESKNIIKYNLEHEPSYDILEKILASDIVIL
                     SATKLGNTNEIYYYKNIVDHGIDKNLLMDRFNCNVIGYLNLLYSYMKFKIDKKSNKKQ
                     IFVYIDNYMSEFNDNTSHPEFNIVKVAQKRVIYQFEKPFNKLNINILIYNIGNKYMPK
                     KLNVYILMKILNDIIKKNEKIDNILDTSAIQYIIKNGIKK"
     gene            193368..193841
                     /gene="MSV222"
                     /locus_tag="MseVgp222"
                     /db_xref="GeneID:1449970"
     CDS             193368..193841
                     /gene="MSV222"
                     /locus_tag="MseVgp222"
                     /codon_start=1
                     /product="ORF MSV222 hypothetical protein"
                     /protein_id="NP_048293.1"
                     /db_xref="GeneID:1449970"
                     /translation="MELKNKNISIENFRILDGILHSTILDIVVSIFGIIFISNYPNII
                     NFRYDYSILYGMCFLNAFISTYYMYALYRKNIFGIIMYIFWHFIVIFILLCILIINAS
                     FLINNPTILDLIKIILFWFITKQKLDYTFLIITHYNKMTDNDLPPPYTEVENNKY"
     gene            193896..194411
                     /gene="MSV223"
                     /locus_tag="MseVgp223"
                     /db_xref="GeneID:1449971"
     CDS             193896..194411
                     /gene="MSV223"
                     /locus_tag="MseVgp223"
                     /codon_start=1
                     /product="ORF MSV223 hypothetical protein"
                     /protein_id="NP_048294.1"
                     /db_xref="GeneID:1449971"
                     /translation="METLNIFRNGISRLFKNIIPSLTFVQTIFNFITYTFAYCISYKF
                     DPIKDYEYTIYYIIFYTISGLSLIYLFCLINGIDHGSIVYIILVYCFISILAVNIIVY
                     LTENEIDNDLLLRVLINCFILNQMINYSSLLVSCHKYMIDYSTLKHDSYYSNPPTYDE
                     IFNSQQNERTT"
     gene            194435..196936
                     /gene="MSV224"
                     /locus_tag="MseVgp224"
                     /db_xref="GeneID:1449972"
     CDS             194435..196936
                     /gene="MSV224"
                     /locus_tag="MseVgp224"
                     /codon_start=1
                     /product="ORF MSV224 putative NTPase/helicase"
                     /protein_id="NP_048295.1"
                     /db_xref="GeneID:1449972"
                     /translation="MECELCLEKNKSTIQCDACKYITCIPCIIKFNKTICPKCYKIYS
                     DILIMPFIENKIFFNIYKSTYVKSKITIKDARLYDYILKNKKLLRFGKSLNYKSCIDI
                     NSFLCLCNTPSCKGIISKNNPICLFCDSVFCTKCKEKILEYNHTCNEKILETIKLLKE
                     STMLCPNCLTYITKSYGCNDMFCTNCGTRFCWRTGQRQKYNSNTHYKVNNTNVYEYIN
                     DLSQTGKFINHAVKYLRNFNNKIMMIECKHYNNDKIVSNAYMNYKKFDFFKYIYDNKK
                     KCDNIYNLKELIYDYYSKNIVSNNCLYTINNNNIIISKTKNKNIKIMNDKDENNDSGI
                     EMIDYIQEIHAYNIKKILLKYKKAYDLSIPGSGKSYVALYVAKQMNLKNIFIICPACL
                     VDKWNFIIKKYNKYNNFNYIILSNNNICINRFEDGNILLSKLLNVNNKIIYEPTEFLK
                     NFLSSESMIIIDESHTIRNTNSYTLKAIYKIVNTSIGYILNISATPIENKNQLQHVVK
                     KLGINDNSEDSDIMKLFIEYILRICEIQDIIKVYKNRYIYQNVILSKNFNTFIGMCKL
                     ADYENTRKLIYLDYINKSYISLNKILFNKIAYTAPIYNVIQPYLAKYKMNNRNEETID
                     LAFTNINVEDKTSTLEFGNKIVKGLMQIETAILESIENMVYTVLENTNNVKVVVALNY
                     TDSINDIYKELSKFYDNILVITGKTNNKTKIIEKFQEPNNNYRLLIVNPLCVNNGLDF
                     DDKYGNYKRFVIFNPNLISINMYQFIYRFERKDSKSKPIIHILDTHYEVVDNLIKKVK
                     IQNDIFKAIKKIREYPEWIETETSVLQLLNELNKH"
     misc_feature    195524..195922
                     /gene="MSV224"
                     /locus_tag="MseVgp224"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    195527..195541
                     /gene="MSV224"
                     /locus_tag="MseVgp224"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    195818..195829
                     /gene="MSV224"
                     /locus_tag="MseVgp224"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     gene            complement(196914..197342)
                     /gene="MSV225"
                     /locus_tag="MseVgp225"
                     /db_xref="GeneID:1449741"
     CDS             complement(196914..197342)
                     /gene="MSV225"
                     /locus_tag="MseVgp225"
                     /codon_start=1
                     /product="ORF MSV225 hypothetical protein"
                     /protein_id="NP_048296.1"
                     /db_xref="GeneID:1449741"
                     /translation="MNYKEIFGDVLKTNIIVHTIGADAAFGKGIAYTIKKKYFKMVKY
                     LQSKTPLEIPGVYEYINNDNKIIINLVTKPSSYKKPTLKQYEDAIELLREYCIKNNIT
                     TLNMPAIGSGLDGLNWDDVSNIIKEKLCNSNINVNVYLIH"
     misc_feature    complement(196962..197333)
                     /gene="MSV225"
                     /locus_tag="MseVgp225"
                     /note="Macro domain, a high-affinity ADP-ribose binding
                     module found in a variety of proteins as a stand-alone
                     domain or in combination with other domains like in
                     histone macroH2A and some PARPs (poly ADP-ribose
                     polymerases). Some macro domains recognize poly...;
                     Region: Macro; cl00019"
                     /db_xref="CDD:294024"
     misc_feature    complement(order(197001..197009,197013..197015,
                     197250..197255,197259..197261,197280..197282,
                     197316..197318))
                     /gene="MSV225"
                     /locus_tag="MseVgp225"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239150"
     gene            197604..197933
                     /gene="MSV226"
                     /locus_tag="MseVgp226"
                     /db_xref="GeneID:1449973"
     CDS             197604..197933
                     /gene="MSV226"
                     /locus_tag="MseVgp226"
                     /codon_start=1
                     /product="ORF MSV226 hypothetical protein"
                     /protein_id="NP_048297.1"
                     /db_xref="GeneID:1449973"
                     /translation="MEKVPFVIKKDNETWYNMLDIIKILGYKKKLHLHASLLNKNNKK
                     KFYQLLTKNTLKNKYFKYTNVQKNRIFINEVALFYILLSSKKENAIICKNYVFGNLFK
                     LENLNLC"
     misc_feature    197610..197906
                     /gene="MSV226"
                     /locus_tag="MseVgp226"
                     /note="BRO family, N-terminal domain; Region: Bro-N;
                     pfam02498"
                     /db_xref="CDD:280632"
     gene            complement(197885..198805)
                     /gene="MSV227"
                     /locus_tag="MseVgp227"
                     /db_xref="GeneID:1449867"
     CDS             complement(197885..198805)
                     /gene="MSV227"
                     /locus_tag="MseVgp227"
                     /codon_start=1
                     /product="ORF MSV227 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048298.1"
                     /db_xref="GeneID:1449867"
                     /translation="MHNMDKLEINSFECIMKYLNEKDQMAFVSTCSKTLYLGYLSKYK
                     GYIKWNNQKNVYIKRLIIRNEMTNEKIDSIYGIEEINFVNIQKNFLKDVSLPLSLNKL
                     EFNVIVNNELNDFTSLKILVNLKELHINSIIDKLQLKNILLPKNLEIFNTDAVYIKKD
                     IFKNLENLKILSIIYDKLNRSKNNIHELILPSCIKKLFIINAIVYNYNFLNKLSNLEI
                     LILNRSTITNLVVVKIPNTLYLIGLVNVYADLNRKYYSDQKLISKIKNVKYLYIDKQS
                     DKYIIIKNCNTKIVNQHKFKFSSLNKLPNT"
     gene            198841..199680
                     /gene="MSV228"
                     /locus_tag="MseVgp228"
                     /db_xref="GeneID:1449974"
     CDS             198841..199680
                     /gene="MSV228"
                     /locus_tag="MseVgp228"
                     /codon_start=1
                     /product="ORF MSV228 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048299.1"
                     /db_xref="GeneID:1449974"
                     /translation="MSVMLEGINIDYKSLMNIESLFIKDLNISTNISKYTNLYKLTNL
                     KFLIFETNEYILDKIKLPKSLISLDIIFNICDEYVNLSFINHFDKLEYLSINSGCIYE
                     IYINEIPKSLKVLKTNITFINKSILYNSNLLSIKFINCDTTSLILPQSTISLEFNNTF
                     TYDYTCLESLINLKELILKKCYIGNLNTVKISNNIEKLNIINISNKPYNNDIIDIVEF
                     IVKLDNIKIFECVMDDNECINCIIKNNHDRCNHNILLYILALLNGNNILSTNEKNKKI
                     YLI"
     gene            199808..200356
                     /gene="MSV229"
                     /locus_tag="MseVgp229"
                     /db_xref="GeneID:1449975"
     CDS             199808..200356
                     /gene="MSV229"
                     /locus_tag="MseVgp229"
                     /codon_start=1
                     /product="ORF MSV229 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048300.1"
                     /db_xref="GeneID:1449975"
                     /translation="MSVISIDNEIWFKDRYILSILDTYDLKSILSKVHKDNRIKLKII
                     KRSNSVDDINIYINKTGLISLSEKLNTNELNYIINKYKSNKICSYNEYIGTIIHCFNH
                     CRYQVNYKIYKYKIDLFFIDYKLAIECDIGDIDINYEIDKQQYIEQQIKGCKFIRFNP
                     FVPDFNLCKVVNTIMIFMYDNK"
     misc_feature    <200114..>200197
                     /gene="MSV229"
                     /locus_tag="MseVgp229"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cl00516"
                     /db_xref="CDD:294350"
     gene            200414..202426
                     /gene="MSV230"
                     /locus_tag="MseVgp230"
                     /db_xref="GeneID:1449976"
     CDS             200414..202426
                     /gene="MSV230"
                     /locus_tag="MseVgp230"
                     /codon_start=1
                     /product="ORF MSV230 hypothetical protein"
                     /protein_id="NP_048301.1"
                     /db_xref="GeneID:1449976"
                     /translation="MAINNNFHILLDKVINMKIEKFIKLLKYKYDNVNFEEKKQIIST
                     LLKFNNFDKTEMCGVSVEKFVQLINNKSASEKYSDVDSSIDESQNSDSDSDSDSGVNI
                     DESQNSDSKVNINKLENESQNSDSKVNIDESQNSDSKVNINKLENESQNSDSKVNIDE
                     SQNSDSKVNIDESQNSDSKVNIDESQNSDSKVNIDESQNSDSKVNINKPENSELENES
                     QNSDSKVNIDESQNSDSKVNIDESQNSDSKVNIDESQNSDSKVNIDESQNSEPEKESQ
                     NSDSGVNRESQKNSNTFYCSSCNNGICKIFTKNLDEIKPKFSFYLQIYYLRQLIENKQ
                     IKNFNIMEFIKYYESLNEDKIKQQNLCEEIEQYILFLKEDKDQSKHENDDDENESMNE
                     NESKHENDGDENESMNEDESKHENDDDDEDESKHENDDDDENESKHENDDENESMNED
                     ESENKNEMKKHQSVDKDKIDISLLNNLIVDISSKDNNDEEMEKILGELLLFRESIENE
                     SVNKNDEEIESMNENENLSVIAENKSVCKDESLSVIVENESLNKNDEENESKHESVNE
                     LQSLCVIENKQKNDIIYDTEYFKKYGKLSNKYHNVCIVNKDIYCLTCNQSIGRTYIKK
                     NSHNFDKPIKLYVNENIYTLLFNQPEKIVHIKKYIKYNEEEIYVYD"
     misc_feature    200624..>201295
                     /gene="MSV230"
                     /locus_tag="MseVgp230"
                     /note="N-acetylmuramoyl-L-alanine amidase; Validated;
                     Region: PRK08581"
                     /db_xref="CDD:236304"
     misc_feature    <201524..202099
                     /gene="MSV230"
                     /locus_tag="MseVgp230"
                     /note="Midasin, AAA ATPase with vWA domain, involved in
                     ribosome maturation [Translation, ribosomal structure and
                     biogenesis]; Region: MDN1; COG5271"
                     /db_xref="CDD:227596"
     gene            200853..201056
                     /gene="MSV231"
                     /locus_tag="MseVgp231"
                     /db_xref="GeneID:1449977"
     CDS             200853..201056
                     /gene="MSV231"
                     /locus_tag="MseVgp231"
                     /codon_start=1
                     /product="ORF MSV231 hypothetical protein"
                     /protein_id="NP_048302.1"
                     /db_xref="GeneID:1449977"
                     /translation="MNHKILILKLILMNHKILILKLILMNHKILILKLILMNHKILIL
                     KLILMNHKILILKLILINQKILN"
     gene            201060..201344
                     /gene="MSV232"
                     /locus_tag="MseVgp232"
                     /db_xref="GeneID:1449978"
     CDS             201060..201344
                     /gene="MSV232"
                     /locus_tag="MseVgp232"
                     /codon_start=1
                     /product="ORF MSV232 hypothetical protein"
                     /protein_id="NP_048303.1"
                     /db_xref="GeneID:1449978"
                     /translation="MNHKILILKLILMNHKILILKLILMNHKILILKLILMNHKILIL
                     KLILMNHKILNRKKNHKILILGLIENHKKIQIHFIVPHVTMEYARYLQKI"
     gene            complement(201477..201830)
                     /gene="MSV234"
                     /locus_tag="MseVgp233"
                     /db_xref="GeneID:1450006"
     CDS             complement(201477..201830)
                     /gene="MSV234"
                     /locus_tag="MseVgp233"
                     /codon_start=1
                     /product="ORF MSV234 hypthetical protein"
                     /protein_id="NP_048304.1"
                     /db_xref="GeneID:1450006"
                     /translation="MKYQFYLYPHFDVFSFHFYFHFHLHSYFHFHHHFHVYFHFHHHH
                     HFHVYFHLHHHHHFHVYFHLHSYFHFHHHHFHVYFHFHSYFHFHHHHFHVYFDLYLLS
                     KIKYIVQFLHINFVV"
     gene            complement(201518..201796)
                     /gene="MSV233"
                     /locus_tag="MseVgp234"
                     /db_xref="GeneID:1449740"
     CDS             complement(201518..201796)
                     /gene="MSV233"
                     /locus_tag="MseVgp234"
                     /codon_start=1
                     /product="ORF MSV233 hypothetical protein"
                     /protein_id="NP_048305.1"
                     /db_xref="GeneID:1449740"
                     /translation="MFFHFIFIFTFIFIHTFIFIIIFMFTFIFIIIIIFMFTFIFIII
                     IIFMFTFIFIHTFIFITIIFMFTFIFIHTFIFIIIIFMFTLIFIFFQK"
     gene            complement(202720..204120)
                     /gene="MSV235"
                     /locus_tag="MseVgp235"
                     /db_xref="GeneID:1450005"
     CDS             complement(202720..204120)
                     /gene="MSV235"
                     /locus_tag="MseVgp235"
                     /codon_start=1
                     /product="ORF MSV235 putative CPD photolyase, similar to
                     Monodelphis domestica GB:D31902"
                     /protein_id="NP_048306.1"
                     /db_xref="GeneID:1450005"
                     /translation="MRLLILYIKISLFYKMNVNRCKILLKLENKIYNNVLYWCVRDQR
                     IQDNWGLIYAQELALKSKSSLHMCICLVPEFLNATIRQFDFMLNGVKQMEEECKNLNI
                     HFHLLIGISVDVLPKFIKKYNIGVLIVDFYPIKIFNNWVNQLISKINIDVYQVDSHNI
                     VPCWIASNKLEYSAKTIRNKINYKLSEYLTEFIPIIKHTYNTYIKINNNWKKAEQSLN
                     IDRNVKPVSWAKSGTKYAFKILDIFIQNRLKDYAKKRNDPNANAISNLSPWIHFGQIS
                     TQRIILEINKYKKLYPKSVEVFCEEAIIRKELCDNFCYYNENYDNINGANNWAIKTLN
                     EHKNDTRKHIYSLYQLENALTHDNLWNASQKQMIIYGKMHGYLRMYWAKKILEWTKSP
                     EEALYISIYLNDKYFIDGRDPNGYVGCMWSICGIHDRAWKERPIFGKIRYMSYEGCRR
                     KFDVDLFIKKYYKNNN"
     misc_feature    complement(202738..204018)
                     /gene="MSV235"
                     /locus_tag="MseVgp235"
                     /note="photolyase PhrII; Region: phr2; TIGR00591"
                     /db_xref="CDD:129679"
     misc_feature    complement(203545..204018)
                     /gene="MSV235"
                     /locus_tag="MseVgp235"
                     /note="DNA photolyase; Region: DNA_photolyase; pfam00875"
                     /db_xref="CDD:279247"
     gene            204132..204533
                     /gene="MSV236"
                     /locus_tag="MseVgp236"
                     /db_xref="GeneID:1449979"
     CDS             204132..204533
                     /gene="MSV236"
                     /locus_tag="MseVgp236"
                     /codon_start=1
                     /product="ORF MSV236 hypothetical protein"
                     /protein_id="NP_048307.1"
                     /db_xref="GeneID:1449979"
                     /translation="MDKINPSMSKNEVFNIMKERVKNDNFKQKLTSNKEIIKNIENGS
                     YVPKNANYVEKNYDVITQDEYVKSYQFVNGDYIPNIITEKLGITKNNIKEFTFKLNDP
                     DVRHITVFKENNKIGQIFMKSSDMINVLSFK"
     gene            204558..205136
                     /gene="MSV237"
                     /locus_tag="MseVgp237"
                     /db_xref="GeneID:1449980"
     CDS             204558..205136
                     /gene="MSV237"
                     /locus_tag="MseVgp237"
                     /codon_start=1
                     /product="ORF MSV237 putative vaccinia B2R homolog,
                     similar to SW:P20999"
                     /protein_id="NP_048308.1"
                     /db_xref="GeneID:1449980"
                     /translation="MFISHHLGGYNESLHAFPDLSTDKVIDVTKYSKIYVDDNMYIIS
                     GLMWIFSKIENRYIGGLVPYFVCNDILEGGSLITDENNTAISCVTMKKDNMYALSGLA
                     YETFDQNINVPIYHHELENGHSVYGSIQGKYEIIKEYAKSFKQSSHNSISEYHIWVGE
                     KLIQITSINNDKKEIFRFRIKKGGILADEYVI"
     misc_feature    204591..205100
                     /gene="MSV237"
                     /locus_tag="MseVgp237"
                     /note="Nucleopolyhedrovirus p26 protein; Region:
                     Baculo_p26; pfam04766"
                     /db_xref="CDD:113533"
     gene            complement(205224..206102)
                     /gene="MSV238"
                     /locus_tag="MseVgp238"
                     /db_xref="GeneID:1450004"
     CDS             complement(205224..206102)
                     /gene="MSV238"
                     /locus_tag="MseVgp238"
                     /codon_start=1
                     /product="ORF MSV238 putative thymidylate synthase,
                     similar to Arabidopsis thaliana GB:L08594"
                     /protein_id="NP_048309.1"
                     /db_xref="GeneID:1450004"
                     /translation="MEITSSDEYQYLKGISEILSNGRITKNRTGVDTKTVYGLTMKYK
                     LDDSFPLFTTKSMFWRGIVEELLWFISGSTNTNILKNKGIHIWDENGSLKYIKKRGFN
                     DRKEGDLGPVYGFQWRHFGAKYIDMDTNYTNQGFDQLTHIINKIKNKPESRNIILTAW
                     NPIDVENMVIPPCHCFVQFHVINNKYLTCQMYQRSADMGLGVPFNVASYSLLTYMIAH
                     LTNLKPYEFIHNIGNAHIYVNHINGLKKQLERTPNPFPKLKIKRQVDNIDDFKFDDFE
                     LIDYNHLGKIKLDMVV"
     misc_feature    complement(205227..206078)
                     /gene="MSV238"
                     /locus_tag="MseVgp238"
                     /note="Thymidylate synthase; Region: Thymidylat_synt;
                     pfam00303"
                     /db_xref="CDD:278719"
     misc_feature    complement(order(205404..205409,205518..205523,
                     205527..205529,205557..205559,205569..205571,
                     205575..205577,205617..205622,205641..205646,
                     205992..205994,205998..206000,206022..206024))
                     /gene="MSV238"
                     /locus_tag="MseVgp238"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238211"
     misc_feature    complement(order(205392..205394,205398..205400,
                     205488..205493,205512..205514,205518..205526,
                     205581..205586,205764..205766,205833..205835,
                     205842..205844,205908..205910,206019..206021))
                     /gene="MSV238"
                     /locus_tag="MseVgp238"
                     /note="active site"
                     /db_xref="CDD:238211"
     gene            206210..207499
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /db_xref="GeneID:1449981"
     CDS             206210..207499
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /codon_start=1
                     /product="ORF MSV239 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048310.1"
                     /db_xref="GeneID:1449981"
                     /translation="MDIQLLDFYSYKNIIKYLDNEDINKLSIIKKCRNFNLELNITIL
                     HKYIRFYDPLEIKKLDCHKCNIKDCKFLKSLKNLEELDISYNNNLNNLLLPKSIKKLN
                     CNNCNIKDFKFLKQLDNLKELDISYNNNLDNSSLCYIPKSIKRLNCGYCKINDFNFLA
                     PLDNLIYLNICGNRNLNNSSLYYISKSIKKLNCNNCNIIDFKFLEPLDNLIYLNISNN
                     TNLNNFTLFYIPKSIKILNCNNCNIINFKFLEPLENLIELDISENNNLNNLSLYYIPK
                     SVKILRCCRCNLKNCKFLESLINLEELNLSFNKYSNISSLYYIPKSVKILFCRGCNIT
                     DFKFLESLENLIELDISRNTNLNNLTLYNISKSIKILECEGCNIKDFKFLKQLDNLKV
                     LNISYNRNINKKSLYYIPKNIKTLYCNNCNIKYFKNL"
     misc_feature    206375..206440
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    206501..206566
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    206567..206635
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    206636..206689
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    206702..206770
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    207041..207106
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    207107..207175
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    207176..207241
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    207242..207376
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    207377..207454
                     /gene="MSV239"
                     /locus_tag="MseVgp239"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     gene            208070..209653
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /db_xref="GeneID:1449982"
     CDS             208070..209653
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /codon_start=1
                     /product="ORF MSV240 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048311.1"
                     /db_xref="GeneID:1449982"
                     /translation="MAIQLLDFYSYKTLIEYLDINNINKLSIIEECRNYNLELNIITI
                     YKYIDFYNPLEITNLDCHKCNIIDCNFLKPLENLEELNISENNNLNKLLLPKSIKKLN
                     CNNCNIKDFKFLEPLDNLEELNISCNYDSNNSSLYCIPKSIKKLNCNNCNIKDFKFLE
                     LLDNLEELNISCNYDSNISLCNLPKSIKKLECYNCNIINCNFLKPLENLIELYISDTC
                     DSNTYYLQLYYYIPKSVKILKYYNINITNFKFLESLENLIELDISENNNLNNLSLYYI
                     PKSVKILKCHICNITDFKFLERLENLIELNITANKNLNISSLYYIPKSVKILFCRGCN
                     ITDFKFLERLKNLEILDISCNRNINISSLYYIPKSVKKLQYECCHTDFKFLETLDNLI
                     ELSILGNRNVNISSLYYIPKSVKKLNCLNCDITDFKFLELLINLIELNISSNTDSNIS
                     LCNLPKSIKKLDCGHCNLTDCKFLEALNNLEELNISGNKNLNNLSLYYLPKCIKTINY
                     THCNLTDFKFLDNLIELNV"
     misc_feature    208973..209041
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    209042..209107
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    209108..209185
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    209186..209317
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    209318..209440
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    209441..209506
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     misc_feature    209507..209566
                     /gene="MSV240"
                     /locus_tag="MseVgp240"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275381"
     gene            209732..210895
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /db_xref="GeneID:1449983"
     CDS             209732..210895
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /codon_start=1
                     /product="ORF MSV241 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048312.1"
                     /db_xref="GeneID:1449983"
                     /translation="MNKINQYCYNEIIKYLDIKDINNLALINFNFKKFNIYNKAQILY
                     SHHEIYNFNDIVNLNCSGCNITNFDFLKKLINLKILDISKNENSNISEENIPSSLIEL
                     YCSNCNITNFDFLKKLINLKILDVSYNLLSNINKCEIPSSLIKLFIKFNNQDNYKFLE
                     KLHNLQILDISDNWDIDVDIYKLPSSIIKLYCRDSNINDFSFIENLYNLKELYLTQNP
                     QSFISDYKLSITILKLICNECKIKDFKFLENLYNLKELDISENINSNISECKLSNSIL
                     KFTCYKCNIKDFKFLENLYNLKELNISENINSNISECKLPNSILKFTCYKCNIKNFKF
                     LERLCNLKYLNISHNTNSNILKCKLSNSIIKVFCEPYDVLTEVKINGICYSFV"
     misc_feature    209960..210025
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    210023..210136
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="Leucine Rich repeats (2 copies); Region: LRR_4;
                     pfam12799"
                     /db_xref="CDD:289563"
     misc_feature    210026..210091
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    210092..210223
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    <210194..210859
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     misc_feature    210224..210289
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    210290..210355
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    210356..210487
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    210488..210553
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    210554..210619
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    210620..210751
                     /gene="MSV241"
                     /locus_tag="MseVgp241"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            212889..213878
                     /gene="MSV242"
                     /locus_tag="MseVgp242"
                     /db_xref="GeneID:1449984"
     CDS             212889..213878
                     /gene="MSV242"
                     /locus_tag="MseVgp242"
                     /codon_start=1
                     /product="ORF MSV242 putative inhibitor of apoptosis
                     protein (IAP), similar to Autographa californica NPV
                     GB:D36828"
                     /protein_id="NP_048313.1"
                     /db_xref="GeneID:1449984"
                     /translation="MDGFNQQMPIDEMVEKTYDKWDNSIEIYRMMNAGFTCKGPSIVE
                     CMECRKVLTDWKKGDNPFFEHIYYSKDCPLINLILLRLLSIQILGIETKLKDLGLIIP
                     IWKTCNDELRVMDVVDDGSTFKNVKNDDFDLYKNHNLKKKSKISYYCPTCKVDIQLLE
                     DEINSDHYIFKKHIRFSENSCDFMKLKLGSDICDKIYNVDLKLKSSAEELKKLFTQYE
                     NENKNENKNLKCKICNNNNRNIIAFPCLHIYACISCYKKNKKCNSCNEDILQYARVII
                     NENELCSTCNSEKCDMLFLPCGHISSCKNCFYKGKMKCNKCDKDVMGTSDITL"
     misc_feature    212922..213107
                     /gene="MSV242"
                     /locus_tag="MseVgp242"
                     /note="Baculoviral inhibition of apoptosis protein repeat
                     domain; Found in inhibitors of apoptosis proteins (IAPs)
                     and other proteins. In higher eukaryotes, BIR domains
                     inhibit apoptosis by acting as direct inhibitors of the
                     caspase family of protease enzymes; Region: BIR; cd00022"
                     /db_xref="CDD:237989"
     misc_feature    order(213000..213002,213012..213014,213018..213020,
                     213039..213047,213051..213053,213063..213065,
                     213078..213080,213090..213095)
                     /gene="MSV242"
                     /locus_tag="MseVgp242"
                     /note="peptide binding groove; other site"
                     /db_xref="CDD:237989"
     misc_feature    order(213021..213023,213030..213032,213081..213083,
                     213102..213104)
                     /gene="MSV242"
                     /locus_tag="MseVgp242"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:237989"
     misc_feature    213720..>213839
                     /gene="MSV242"
                     /locus_tag="MseVgp242"
                     /note="Zinc finger, C3HC4 type (RING finger); Region:
                     zf-C3HC4_3; pfam13920"
                     /db_xref="CDD:290631"
     gene            213634..213825
                     /gene="MSV243"
                     /locus_tag="MseVgp243"
                     /db_xref="GeneID:1449985"
     CDS             213634..213825
                     /gene="MSV243"
                     /locus_tag="MseVgp243"
                     /codon_start=1
                     /product="ORF MSV243 hypothetical protein"
                     /protein_id="NP_048314.1"
                     /db_xref="GeneID:1449985"
                     /translation="MHAFHVTKKTKNVIPAMKTFCSMLELLLTKMNFAVHAIQKNVIC
                     YFYHVDTFHLAKIAFIKEK"
     gene            complement(214002..214649)
                     /gene="MSV244"
                     /locus_tag="MseVgp244"
                     /db_xref="GeneID:1450003"
     CDS             complement(214002..214649)
                     /gene="MSV244"
                     /locus_tag="MseVgp244"
                     /codon_start=1
                     /product="ORF MSV244 hypothetical protein"
                     /protein_id="NP_048315.1"
                     /db_xref="GeneID:1450003"
                     /translation="MDKVYKFGSLTNLNSGNIYNLIYNKNYTFTIGRNSKCDIFINDK
                     KISNIACIIKCDYEKKKCFIYGGCSNSKKYLYFDNNDGLLQNGIFIKFPNLEWMDLSI
                     NGNIYILRSNIKLNLINELIDTTLIDISGNIYIWRSIDVKLNNKICNYSMCTSTKYEY
                     MFYKCGHKINKKTATFWKKTKMLCNDIYTNKYKLINICPFCFNESFIINYSFYCK"
     misc_feature    complement(<214236..>214556)
                     /gene="MSV244"
                     /locus_tag="MseVgp244"
                     /note="Pellino; Region: Pellino; pfam04710"
                     /db_xref="CDD:282553"
     gene            complement(214655..215215)
                     /gene="MSV245"
                     /locus_tag="MseVgp245"
                     /db_xref="GeneID:1450002"
     CDS             complement(214655..215215)
                     /gene="MSV245"
                     /locus_tag="MseVgp245"
                     /codon_start=1
                     /product="ORF MSV245 putative RNA polymerase subunit RPO18
                     homolog (vaccinia D7R), similar to SW:P33058"
                     /protein_id="NP_048316.1"
                     /db_xref="GeneID:1450002"
                     /translation="MSSISKIPKIVGPNKINTAIEFDIILEARDITNDVRMNIKKYID
                     RVYLNKGLGLKYILQINYDPIFKNELPLLPLENISPTNPIYPYKITLECECIYFNINQ
                     EIKGNISIEHGEIPEIIVYNNYIRCNINKTPNMQVNISDKNITINNKSYSNYDECIVK
                     IENLRDSTGVNKIIAEGIIIEEENIY"
     gene            complement(215229..215660)
                     /gene="MSV247"
                     /locus_tag="MseVgp246"
                     /db_xref="GeneID:1450001"
     CDS             complement(215229..215660)
                     /gene="MSV247"
                     /locus_tag="MseVgp246"
                     /codon_start=1
                     /product="ORF MSV247 hypothetical protein"
                     /protein_id="NP_048317.1"
                     /db_xref="GeneID:1450001"
                     /translation="MLFCYNFTYTTENRIISSISLLIHFYNFIYFIMLIIYKEKEYEY
                     IYELPDNTLILFLIATVFTIVHNFIHILYTNMIAIYSIILLQFISILIYITIFVCIFI
                     LMCINFDTICAIIYLLLCASICSMELAIFVIRWNNYHNNEK"
     gene            215380..215586
                     /gene="MSV246"
                     /locus_tag="MseVgp247"
                     /db_xref="GeneID:1449986"
     CDS             215380..215586
                     /gene="MSV246"
                     /locus_tag="MseVgp247"
                     /codon_start=1
                     /product="ORF MSV246 hypothetical protein"
                     /protein_id="NP_048318.1"
                     /db_xref="GeneID:1449986"
                     /translation="MYIKIDINCNKIIEYIAIIFVYNICIKLCTIVNTVAIKNNINVL
                     SGNSYMYSYSFSLYIINIIKYIKL"
     gene            215803..216255
                     /gene="MSV248"
                     /locus_tag="MseVgp248"
                     /db_xref="GeneID:1449987"
     CDS             215803..216255
                     /gene="MSV248"
                     /locus_tag="MseVgp248"
                     /codon_start=1
                     /product="ORF MSV248 putative inhibitor of apoptosis
                     protein (IAP), similar to Orgyia pseudotsugata NPV
                     GB:U75930"
                     /protein_id="NP_048319.1"
                     /db_xref="GeneID:1449987"
                     /translation="MVDNFCTPLYPYYITLQSRINSYENWPISLFFKINRLCEAGFFY
                     TNIGDITVCFNCGLKIKNWLYYNDPWIEHSKWSPNCNYIIFNKGKKFINFAKNFKHQL
                     LYNCIICNENNISYILKPCGHASTCYECSYKIYKCPVCYNTISTIIRY"
     misc_feature    215851..216051
                     /gene="MSV248"
                     /locus_tag="MseVgp248"
                     /note="Baculoviral inhibition of apoptosis protein repeat
                     domain; Found in inhibitors of apoptosis proteins (IAPs)
                     and other proteins. In higher eukaryotes, BIR domains
                     inhibit apoptosis by acting as direct inhibitors of the
                     caspase family of protease enzymes; Region: BIR; cd00022"
                     /db_xref="CDD:237989"
     misc_feature    order(215935..215937,215950..215952,215956..215958,
                     215977..215985,215989..215991,216001..216003,
                     216016..216018,216028..216033)
                     /gene="MSV248"
                     /locus_tag="MseVgp248"
                     /note="peptide binding groove; other site"
                     /db_xref="CDD:237989"
     misc_feature    order(215959..215961,215968..215970,216019..216021,
                     216040..216042)
                     /gene="MSV248"
                     /locus_tag="MseVgp248"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:237989"
     misc_feature    216118..216222
                     /gene="MSV248"
                     /locus_tag="MseVgp248"
                     /note="Zinc finger, C3HC4 type (RING finger); Region:
                     zf-C3HC4_3; pfam13920"
                     /db_xref="CDD:290631"
     gene            216210..216401
                     /gene="MSV249"
                     /locus_tag="MseVgp249"
                     /db_xref="GeneID:1449988"
     CDS             216210..216401
                     /gene="MSV249"
                     /locus_tag="MseVgp249"
                     /codon_start=1
                     /product="ORF MSV249 hypotehtical protein"
                     /protein_id="NP_048320.1"
                     /db_xref="GeneID:1449988"
                     /translation="MSCMLQYYINYYKILIFFILYLIYVYILYVKNSFFFEKIIYLII
                     LTSCMLYCVLNVILYVMIK"
     gene            216350..217675
                     /gene="MSV250"
                     /locus_tag="MseVgp250"
                     /db_xref="GeneID:1449989"
     CDS             216350..217675
                     /gene="MSV250"
                     /locus_tag="MseVgp250"
                     /codon_start=1
                     /product="ORF MSV250 hypothetical protein"
                     /protein_id="NP_048321.1"
                     /db_xref="GeneID:1449989"
                     /translation="MHAVLCTKCNIICNDKIKIQKHKEIENIISFNVETNICECKIPN
                     LQFCFFNVNKIIVNEIPYYTSLIKLVIFNIAILSTASFEIWINNDIDEKINYEINDQI
                     VPINENILSYIPKEDYDKIKIINHYEFCHEDFYFDDYAFCEEHKFCQNHMNYENGIWK
                     ENYEYCYNICNECEESKIFKFENKLENYTLLSKLLSSEITTTETVENANTIILPTKTD
                     NIDDDSEYFYDREIYYYGYFTMHENKDYDFINKVVDDYVDNYVNKFVDDFVNKVVNKN
                     VDNVVDEVVNKNVDKVVNEVVNKNVDKVVDEVVNKNVDDFVNKIDDDFVNKIDDDFVN
                     KIDDDFVNKNVDEVVNKIDDEFVNKNVDEVVNKIDDVLNKNVNEVVNKDVNDFVNKID
                     DEVVNKNVNDFVNKNVNDFVNKNVNDFITIIIMNFKSVRKKEIYVYTFI"
     gene            218047..219036
                     /gene="MSV251"
                     /locus_tag="MseVgp251"
                     /db_xref="GeneID:1449990"
     CDS             218047..219036
                     /gene="MSV251"
                     /locus_tag="MseVgp251"
                     /codon_start=1
                     /product="ORF MSV251 hypothetical protein containing
                     C3H2C3 RING finger"
                     /protein_id="NP_048322.1"
                     /db_xref="GeneID:1449990"
                     /translation="MFFHTMKIFFINMIKYRLINENNYRYYNIDKNITKIDICCDKYI
                     NYLDISKCYNIQSLICKNNKIEKLIIHDQLLYLYCENNNIDYININKHSRLLILDCSN
                     NDITSLLINDRLYYLNCSNNNINYIRCNNNLKILKCYNCNLSNIFLNNGLIYLDCSYN
                     KLENININTSLLHLNCSNNELSNINCVDSLKYIDCENNYIIEIITNNELFELNCINNP
                     LKIISIYNNLKSLKFDTNLEYIYFNEHNEIIINGIKNYIDRFNLKKIEVFDNDDICSI
                     CLDKGILYKTICNHTFHKECLNNINNNLCPYCKQNILCIPLHTPIKLDNNEKI"
     misc_feature    218443..218484
                     /gene="MSV251"
                     /locus_tag="MseVgp251"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    218671..218754
                     /gene="MSV251"
                     /locus_tag="MseVgp251"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            219048..219533
                     /gene="MSV252"
                     /locus_tag="MseVgp252"
                     /db_xref="GeneID:1449991"
     CDS             219048..219533
                     /gene="MSV252"
                     /locus_tag="MseVgp252"
                     /codon_start=1
                     /product="ORF MSV252 tryptophan repeat gene family
                     protein"
                     /protein_id="NP_048323.1"
                     /db_xref="GeneID:1449991"
                     /translation="MERIFNDYFLLKKIFVNMQIIDIINLYESDIIEKSSILSYISTI
                     KDSTHNVILNNENVSDNFIYNFLDICCININMLIDNRLKFNKNLSCNIIDKYINIYNN
                     IEYINWNNISMLKLTYEFIKKYKNELNWNIICKYKINLNDQIINDNNDFINWYYIKNT
                     F"
     gene            219557..220759
                     /gene="MSV253"
                     /locus_tag="MseVgp253"
                     /db_xref="GeneID:1449992"
     CDS             219557..220759
                     /gene="MSV253"
                     /locus_tag="MseVgp253"
                     /codon_start=1
                     /product="ORF MSV253 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048324.1"
                     /db_xref="GeneID:1449992"
                     /translation="MYKIYFRDIDKYKKEDIIFLDCSKYFIKNFKFLESLPNLQILYI
                     SCNKNSNIEKIKLPKTITEFVCDNCDIRSFKFITNLPNLKKLNISVNFNSDIEKCKLP
                     ESIIELICEYCFIKDYSFINNLPNLQILNISNNFEPIEYINIQNLIDFNASNCIINNF
                     SFLENSKLQKLNLCGVCITNKLSKHKLPNTIIKLNCNRCDVIDFSFIESLINLETLFI
                     KYNVNSNISSCKLPNSIKYIDCEECLITDFTFLEPLHNLIKLSISYNMNSNINIINLP
                     KFIQEFTCKKCNINDFSFLLSLSNLLILNISCNDVLKCILPNSIKSLKCYCCNIKDFS
                     FLSPLKKLKYLDICNNPNSNITRDMIPSYVNFICKRNDVKEFNFNGINVNFKEYIYFS
                     SDECDFSD"
     misc_feature    <219620..>220234
                     /gene="MSV253"
                     /locus_tag="MseVgp253"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     gene            220798..221799
                     /gene="MSV254"
                     /locus_tag="MseVgp254"
                     /db_xref="GeneID:1449993"
     CDS             220798..221799
                     /gene="MSV254"
                     /locus_tag="MseVgp254"
                     /codon_start=1
                     /product="ORF MSV254 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048325.1"
                     /db_xref="GeneID:1449993"
                     /translation="MCDIKILNISNNKNPNFNIPNYITEFICTNCDIKDFSFIEKLDN
                     LEILNISNNPNSNISKCLLPKSIKTFICIDCNITDFKFIEKMPNLETLIISYNTNSNI
                     YQCWIPNSIITFVCIGCYISDFSFIQFLPNLKILDISYNKHAYIILPVSIIKLVCTNC
                     SIKNFRFLEKLHNLQILDISNNKNSNISNCNLSKLIIELTCCGCKIYNFKFIEKLKNL
                     QILNLSRNYVYSNINDCNLPITIKKLTLGFFKDINYKFINKLLNLEILILEYIICSLT
                     IPNTIKELYLFYCEIKDFKFIESFKYLKKLHIIHNNSYSNILDCIIPTSVCEYKFEI"
     gene            221829..223040
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /db_xref="GeneID:1449994"
     CDS             221829..223040
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /codon_start=1
                     /product="ORF MSV255 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048326.1"
                     /db_xref="GeneID:1449994"
                     /translation="MNEELKKYKYEDIINNKYEYIKFLDCTNRNIKNFKFLELLTNLE
                     ILIISDNPDSNISLCKLPNKIKRFECNYCNIKDFKFLEPLENLEILDISENYNSNISL
                     CKLSNKLKKIICNYCNIKDFKFLEPLENLEILDISENYNSNISDCNLSKKLIKLDCKF
                     CNIVDFKFIENLENLQILDISWNKDAIISKYKIPLSLIEFKCQYCKISDFKFLESLIN
                     LKILNISKNKNSNISDCILSSSIIEFNCIFCRIYDFKFLQNLFNLKKLYISYNFHSNI
                     SECTLPVSLIKLECKYCNIVNCNFLKNLSNLQILDISNNNRCHISYCKLSSSIIEFRC
                     KSCKLLNFKFLEDLYNLQILDISNNPNSNISDCVLSSKLIKLYCEKCNIKNFEFIKIF
                     KKLEIYINNYF"
     misc_feature    221955..222086
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222087..222170
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222219..222293
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222351..222416
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222417..222482
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222483..222614
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222615..222680
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222681..222746
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222747..222878
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222879..222941
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    222945..222983
                     /gene="MSV255"
                     /locus_tag="MseVgp255"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     gene            223107..223511
                     /gene="MSV256"
                     /locus_tag="MseVgp256"
                     /db_xref="GeneID:1449995"
     CDS             223107..223511
                     /gene="MSV256"
                     /locus_tag="MseVgp256"
                     /codon_start=1
                     /product="ORF MSV256 hypothetical protein"
                     /protein_id="NP_048327.1"
                     /db_xref="GeneID:1449995"
                     /translation="MKESNKTLFCGICNTTSNKYVSGICVTCFKISKNSHLIDSFCIV
                     CNGITKINKYNGICKTCNYNIDYWYEQIAKSYNERFLTFKCKTCKKYIDCQSGYRHCV
                     ECIERYFKVRCITCNKFIDAKSYDTKCKICKK"
     gene            223560..225683
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /db_xref="GeneID:1449996"
     CDS             223560..225683
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /codon_start=1
                     /product="ORF MSV257 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048328.1"
                     /db_xref="GeneID:1449996"
                     /translation="MALNYYSFVELIKYLNNPDEIHGLISLNEIYKSYIIESRIELLF
                     YYRDIKEYDEKYYPFITNLDCSNCPDVTIDFLNKFINLKVLNISNNSHLSEDIDDLRL
                     PNLINLNCSSCNIKFFDFLSKFTNLQVLDISNNINCEDKSINVLNILTNLKILNISNN
                     NCDYKIIDNLNKLKKRLQVLNISNNEQLSKKIDYLRLPNLIDFNCSSCNIKSFNFLNN
                     FTKLQILDISNNENIWTYALPLPPFLIKVNCSGCNITNSDFLRYVDNLEELDISNNPD
                     LKIEYMPTKIKKLNISECYIKNDNFLKGLNNLQELNISYNPYNYFRKSIEIDIDNLSN
                     TLIKLYLRKCNIKNVSSFKNLINLQELVISENRQVNINNLPDELISLNLSSCKIINIE
                     FPKKLKELNLSKTYISNIKNLPKSLIKLDISYCNLKNDNCLKDLNNLKELDISGNWEI
                     CFSSLPKSIIKIKCKNCNITNTDFLNNLDNLQELDMSVNYYININKSRRIDNLPKKLI
                     KLNINNCDCAYISFKGLDNLEELEMIRNTCLIDYLPKSLIKLHGYTHTFKIKDLNKLT
                     TLCLPGIIKINIEDLPKSLIELDISTCKYIINEDCLKNLYNLKELTMSINCNIIKQTL
                     PESLIKIKIKLCKYSYDDFIKDIYDKKLNLSNEYGKYISFLPEIIKNNYNAFKIHLID
                     NIYNLKKIKSIDISNNECRCHCLGL"
     misc_feature    223737..223799
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    223803..223871
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    223872..223937
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    223938..224012
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224013..224087
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224088..224156
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224157..224222
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224223..224288
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    <224268..>224828
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="E3 ubiquitin-protein ligase SspH2; Provisional;
                     Region: PRK15387"
                     /db_xref="CDD:185285"
     misc_feature    224289..224354
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224415..224480
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224481..224561
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224565..224630
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    <224628..>225335
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="E3 ubiquitin-protein ligase SspH2; Provisional;
                     Region: PRK15387"
                     /db_xref="CDD:185285"
     misc_feature    224631..224714
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    224808..224873
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    225000..225140
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    225141..225251
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    225312..225380
                     /gene="MSV257"
                     /locus_tag="MseVgp257"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     gene            complement(223832..224029)
                     /gene="MSV258"
                     /locus_tag="MseVgp258"
                     /db_xref="GeneID:1450000"
     CDS             complement(223832..224029)
                     /gene="MSV258"
                     /locus_tag="MseVgp258"
                     /codon_start=1
                     /product="ORF MSV258 hypothetical protein"
                     /protein_id="NP_048329.1"
                     /db_xref="GeneID:1450000"
                     /translation="MFNIFRLVNIFKTLILLSSQLILLDISNTCKLVNLLKKSKNLIL
                     HELQFKLIKFGNLKSSISSDK"
     gene            complement(225221..225490)
                     /gene="MSV259"
                     /locus_tag="MseVgp259"
                     /db_xref="GeneID:1449999"
     CDS             complement(225221..225490)
                     /gene="MSV259"
                     /locus_tag="MseVgp259"
                     /codon_start=1
                     /product="ORF MSV259 hypothetical protein"
                     /protein_id="NP_048330.1"
                     /db_xref="GeneID:1449999"
                     /translation="MKSSYEYLHSLIFILINDSGKVCFIMLQFIDIVNSFKLYKFFKQ
                     SSFMIYLHVLISNSINDFGKSSIFILIIPGKHNVVNLFKSLILKV"
     gene            227136..227417
                     /gene="MSV260"
                     /locus_tag="MseVgp260"
                     /db_xref="GeneID:1449997"
     CDS             227136..227417
                     /gene="MSV260"
                     /locus_tag="MseVgp260"
                     /codon_start=1
                     /product="ORF MSV260 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048331.1"
                     /db_xref="GeneID:1449997"
                     /translation="MSENHWIKFDYFPKSLIKLNCNVCSIIDNSFFKKLNKLKELDVS
                     GNIEIDIKKLPKSLIKLNIIECKIKNGNYLKELKLYRNCNIKIPALSIF"
     misc_feature    227175..227303
                     /gene="MSV260"
                     /locus_tag="MseVgp260"
                     /note="Leucine Rich repeats (2 copies); Region: LRR_4;
                     pfam12799"
                     /db_xref="CDD:289563"
     misc_feature    227181..227246
                     /gene="MSV260"
                     /locus_tag="MseVgp260"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    227247..227306
                     /gene="MSV260"
                     /locus_tag="MseVgp260"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     misc_feature    227307..227354
                     /gene="MSV260"
                     /locus_tag="MseVgp260"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275378"
     gene            227470..229344
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /db_xref="GeneID:1449998"
     CDS             227470..229344
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /codon_start=1
                     /product="ORF MSV261 leucine rich repeat gene family
                     protein, similar to Amsacta moorei entomopoxvirus Q3 ORF
                     SW:P28854"
                     /protein_id="NP_048332.1"
                     /db_xref="GeneID:1449998"
                     /translation="MTLNYYSFIEVVKYLDNPDKIHEFVSLNKIYKKYIIESGLPIYY
                     KHIIDYNEEYYPFITNLDCNNCPDITIDFLNKFTNLKVLNISNNSHLSESIDDLKLPN
                     LINLNCSSCNIKSFNFLRNFNNLQILDISNNKYIWCYELPESLIKLNISKCYIENDRY
                     LKNLNNLQELNISNKLDLDFPNEIDINNLPKSLIKLNISNCNIINANSLKNLINLKEL
                     DISNKLYLDFSNEIDINNLTKSLIKLNISNCNIINASSLKNLINLKELDISNNYNINI
                     SSLPKTLIKLNISSCNIKNTNFIINLDNLKELDISRNFNINISSLPKSLIKLNIRTCY
                     IKNTNFIINLDNLKELDISRNFNINISSLPKSLITLNINSCYIKHTNFINDLYNLKEL
                     DISRNYNINISSLPKSLIKLNISDCDIKNTNFINDLDNLKELDISNNYNINISSLPKT
                     LTTLNISSCNIKNTNFIINLDNLKELDISKNFNINISSLPKSLITLNINSCYINHTNF
                     INDLYNLKELDISNNYNINISSLPNTLIELNISSCYIKNTNFIINLDNLKKLEISKSS
                     LYDMILHNIFTFNYLKLLDKSNTSFTFYYKIKSKFVKIIVNREECKLLKSLYLICSLK
                     "
     misc_feature    <227632..228258
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:227223"
     misc_feature    227647..227706
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    227707..227775
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    227776..227841
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    227842..227967
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    227968..228045
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228046..228111
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228112..228255
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228256..228381
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228382..228507
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228508..228633
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228634..228759
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228820..228885
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    228886..228954
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    229075..229137
                     /gene="MSV261"
                     /locus_tag="MseVgp261"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     repeat_region   229120..236120
                     /note="right inverted terminal repeat"
                     /rpt_type=inverted
     gene            229505..229972
                     /gene="MSV262"
                     /locus_tag="MseVgp262"
                     /db_xref="GeneID:1449865"
     CDS             229505..229972
                     /gene="MSV262"
                     /locus_tag="MseVgp262"
                     /codon_start=1
                     /product="ORF MSV262 155 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048333.1"
                     /db_xref="GeneID:1449865"
                     /translation="MYSCKMEIDLECVVLCKNCNVSSYQYTDGICINCDFPINIKLDI
                     CNKCNKINFVHDGVCGECYANKIVCNGDNTKSTCYIIIINDQKVIEEGVVESSKDIFI
                     SDKFTYNIINVVIISNNKILQINNIDKKYEKVFNRYLIFNYDHVILTQQIDEI"
     gene            229563..229745
                     /gene="MSV263"
                     /locus_tag="MseVgp263"
                     /db_xref="GeneID:1449856"
     CDS             229563..229745
                     /gene="MSV263"
                     /locus_tag="MseVgp263"
                     /codon_start=1
                     /product="ORF MSV263 60 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048334.1"
                     /db_xref="GeneID:1449856"
                     /translation="MYHLINIQMVYALIVIFLLILNLIYVINVTKLILFMMEYAVNVM
                     LTKLYVMVIIQNLHVI"
     gene            229999..230268
                     /gene="MSV264"
                     /locus_tag="MseVgp264"
                     /db_xref="GeneID:1449857"
     CDS             229999..230268
                     /gene="MSV264"
                     /locus_tag="MseVgp264"
                     /codon_start=1
                     /product="ORF MSV264 89 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048335.1"
                     /db_xref="GeneID:1449857"
                     /translation="MAEKRNVKVKLVEPDVNKSLSTIIEALQNEIQKSIQDQSNILKQ
                     NLSEDIMNEVEKFESQVTELTNMLKNYVISTIEEKIDNYVNSLIS"
     gene            232644..232832
                     /gene="MSV265"
                     /locus_tag="MseVgp265"
                     /db_xref="GeneID:1449858"
     CDS             232644..232832
                     /gene="MSV265"
                     /locus_tag="MseVgp265"
                     /codon_start=1
                     /product="ORF MSV265 62 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048336.1"
                     /db_xref="GeneID:1449858"
                     /translation="MFLYLISQNINNVSKISISNTQSMFLYLISQNINNVSKISISNT
                     QSMFLYLISQNINNVSKI"
     gene            233334..233522
                     /gene="MSV266"
                     /locus_tag="MseVgp266"
                     /db_xref="GeneID:1449859"
     CDS             233334..233522
                     /gene="MSV266"
                     /locus_tag="MseVgp266"
                     /codon_start=1
                     /product="ORF MSV266 62 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048337.1"
                     /db_xref="GeneID:1449859"
                     /translation="MFLYLISQNINNVSKISISNTQSMFLYLISQNINNVSKISISNT
                     QSMFLYLISQNINNVSKI"
     gene            234162..234350
                     /gene="MSV267"
                     /locus_tag="MseVgp267"
                     /db_xref="GeneID:1449860"
     CDS             234162..234350
                     /gene="MSV267"
                     /locus_tag="MseVgp267"
                     /codon_start=1
                     /product="ORF MSV267 62 amino acid repeat gene family
                     protein"
                     /protein_id="NP_048338.1"
                     /db_xref="GeneID:1449860"
                     /translation="MFLYLISQNINNVSKISISNTQSMFLYLISQNINNVSKISISNT
                     QSMFLYLISQNINNVSKI"
ORIGIN      
        1 atacaatata aaatacatca aatacaattt aaaatacatc aaatataatt attatagcat
       61 tatatctaaa atacatcaaa tacaatttaa aatacatcaa atacaattta aaatacatca
      121 aatacaatta ttatagcatt atatctaaaa tacatcaaat acaatttaaa atacatcaaa
      181 tacaatttaa aatacatcaa atataattat tatagcatta tatctaaaat acatcaaata
      241 caatttaaaa tacatcaaat acaatttaaa atacatcaaa tataattatt atagcattat
      301 atctaaaata catcaaatac aatttaaaat acatcaaata caatttaaaa tacatcaaat
      361 ataattatta tagcattata tctaaaatac atcaaataca atttaaaata catcaaatac
      421 aatttaaaat acatcaaata taattattat agcattatat ctaaaataca tcaaatacaa
      481 tttaaaatac atcaaataca atttaaaata catcaaatat aattattata gcattatatc
      541 taaaatacat caaattctat ttaaaaattt gtaatatgta catacattag tatttaatat
      601 ttatttattt ttttacaact aaaatcaaca attatattaa tgctaattat taaaatagta
      661 ttttaacata ttggatataa aaatattgat tggattttgg atatttaata aaatatatca
      721 atattgatat tagatataaa aatattgatt ggattttgga tatttaataa aatatatcta
      781 taatggtatt ttataatatt atataaaatg tatcaatatc aatattggta taaaatatat
      841 aaaacataaa ctagactttt atagtatgta aatatatcat atatcaaaac atttattgag
      901 tattatatta tatcatataa taaaatatac aattttcgat tttcgattat caattttcga
      961 ttttcgattc tcgattatca attatcaatt ttcgattttc gattatcaat tttcgatttt
     1021 cgattatcaa ttttcgattt tcgattttcg attatcaatt atcaattttc gattttcgat
     1081 tatcaatttt attagtttta gtttataatt tttttttttt tattttgttt tatgtctctt
     1141 acaattatta tatattatta attttatcat tttaattaat atttattata acattatatt
     1201 tattattatt tattaataaa attcattatt tgatttatct gttatatcaa catataactt
     1261 ttatatattg atatattttt tcatttttct atgtattact gttatatcaa catataactt
     1321 ttatatattg atatattttt tcataattat atttatatat aaaaacaacg atattttaac
     1381 atatcagata taaaatcctt tattgaactt tagatattta ataaaatgta tcgatattga
     1441 tattagatat aaaaacatta attggacatt ggatattgat atttttgata cattattaat
     1501 attttaacat atcagatata aaaacattga ttgggtatta gatattgata tttttgatac
     1561 attattgata ttttaacata tcagatataa aaacattaat tggacattgg atattgatat
     1621 ttttgataca ttattgatat tttaacatat cagatataaa aacattaatt gggtattaga
     1681 tattgatatt tttgatacat tattgatatt ttgtgatatc agatataaaa acattgattg
     1741 ggtattagat attgatattt ttgatacatt attgatattt tgtgatatca gatataaaaa
     1801 cattgattgg gtattagata ttgatatttt tgatacatta ttgatatttt aacatatcag
     1861 atataaaaac attgattggg tattagatat tgatattttt gatacattat tgatatttta
     1921 acatatcaga tataaaaaca ttaattggac attggatatt gatatttttg atacattatt
     1981 gatattttaa catatcagat ataaaaacat taattgggta ttagatattg atatttttga
     2041 tacattattg atattttgtg atatcagata taaaaacatt gattgggtat tagatattga
     2101 tattttgata acattattga tattttaaca tatcagatat aaaaacttta attgggtatt
     2161 agatattgat attttagata cattattgat attttgtgat atcagatata aaaacattgt
     2221 ttgtactttg attatttata tttttgatac attattgata ttttgtgata tcagatataa
     2281 aaacattgat tgggtattag atattgatat ttttgataca ttattgatat tttgtgatat
     2341 cagatataaa atcctttatt ggacattgga tattgatatt tttgatacat tattgatatt
     2401 ttgtgatatc agatataaaa tcctttattg tactttgatt atttatattt ttgatacatt
     2461 attgatattt tgtgatatca gatataaaaa cattgattgg gtattagata ttgatatttt
     2521 tgatacatta ttgatatttt gtgatatcag atataaaaac attgattggg tattagatat
     2581 tgatattttt gatacattat tgatattttg tgatatcaga tataaaaaca ttgattgggt
     2641 attagatatt gatatttttg atacattatt gatattttaa catatcagat ataaaaacat
     2701 tgattgggta ttagatattg atatttttga tacattattg atattttaac atatcagata
     2761 taaaaacatt aattggacat tggatattga tatttttgat acattattga tattttaaca
     2821 tatcagatat aaaaacatta attgggtatt agatattgat atttttgata cattattgat
     2881 attttgtgat atcagatata aaaacattga ttgggtatta gatattgata tttttgatac
     2941 attattgata ttttgtgata tcagatataa aaacattgat tgggtattag atattgatat
     3001 ttttgataca ttattgatat tttaacatat cagatataaa aacattaatt gggtattaga
     3061 tattgatatt tttgatacat tattgatatt ttgtgatatc agatataaaa acattgtttg
     3121 tactttgatt atttatattt ttgatacatt attgatattt tgtgatatca gatataaaaa
     3181 cattgattgg gtattagata ttgatatttt tgatacatta ttgatatttt gtgatatcag
     3241 atataaaatc ctttattgga cattggatat tgatattttt gatacattat tgatattttg
     3301 tgatatcaga tataaaatcc tttattggac attggatatt gatatttttg atacattatt
     3361 aatattttaa catatcagat ataaaaacat taattgtact ttgattattt atatttttga
     3421 tacattattg atattttgtg atatcagata taaaaacatt gattgggtat tagatattga
     3481 tatttttgat acattattga tattttgtga tatcagatat aaaaacattg attgggtatt
     3541 agatattgat atttttgata cattattgat attttaacat atcagatata aaaacattaa
     3601 ttggacattg gatattgata tttttgatac attattgata ttttaacata tcagatataa
     3661 aaacattaat tgtactttga ttatttatat ttttgataca ttattgatat tttgtgatat
     3721 cagatattaa aacattgatt gggtattaga tattgatatt tttgatacat tattgatatt
     3781 ttgtgatatc agatataaaa acattgattg ggtattagat attgatattt ttgatacatt
     3841 attgatattt taacatatca gatataaaaa cattgattgg gtattagata ttgatatttt
     3901 tgatacatta ttgatatttt aacatatcag atataaaaac attaattgga cattggatat
     3961 tgatattttt gatacattat tgatatttta acatatcaga tataaaaaca ttaattggac
     4021 attggatatt gatatttttg atacattatt gatattttaa catatcagat ataaaaacat
     4081 taattgggta ttagatattg atatttttga tacattattg atattttgtg atatcagata
     4141 taaaaacatt gattgggtat tagatattga tatttttgat acattattga tattttaaca
     4201 tatcagatat aaaaacatta attgggtatt agatattgat atttttgata cattattgat
     4261 attttgtgat atcagatata aaaacattgt ttgtactttg attatttata tttttgatac
     4321 attattgata ttttgtgata tcagatataa aaacattgat tgggtattag atattgatat
     4381 ttttgataca ttattgatat tttgtgatat cagatataaa atcctttatt ggacattgga
     4441 tattgatatt tttgatacat tattgatatt ttgtgatatc agatataaaa tcctttattg
     4501 gacattggat attgatattt ttgatacatt attgatattt taacatatca gatataaaaa
     4561 cattgtttgt actttgatta tttatatttt tgatacatta ttgatatttt gtgatatcag
     4621 atataaaatc ctttattgga cattggatat tgatattttt gatacattat tgatattttg
     4681 tgatatcaga tataaaatcc tttattggac attggatatt gatatttttg atacattatt
     4741 gatattttgt gatatcagat ataaaatcct ttattggaca ttggatattg atatttttga
     4801 tacattattg atattttgtg atatcagata taaaaacatt aattgggtat tagatattga
     4861 tatttttgat acaatattga tattttgtga tatcagatat aaaaacatta attgtacttt
     4921 gattatttat atttttgata cattattgat attttgtgat atcagatata aaaacattgt
     4981 ttgtactttg attatttata tttttgatac attattgata ttttgtgata tcagatataa
     5041 aaacattgat tgggtattag atattgatat ttttgataca ttattgatat tttgtgatat
     5101 cagatataaa atcctttatt ggacattgga tattgatatt tttgatacat tattgatatt
     5161 ttgtgatatc agatataaaa tcctttattg gacattggat attgatattt ttgatacatt
     5221 attgatattt taacatatca gatataaaaa cattgtttgt actttgatta tttatatttt
     5281 tgatacatta ttgatatttt gtgatatcag atataaaatc ctttattgga cattggatat
     5341 tgatattttt gatacattat tgatattttg tgatatcaga tataaaatcc tttattggac
     5401 attggatatt gatatttttg atacattatt gatattttgt gatatcagat ataaaaacat
     5461 tgattgggta ttagaatatg atatttttga tattttaaca tatcagatat aaaaacattg
     5521 attgggttat agaaaaggaa aattttgaat atttaacata tcagatataa aaaccttgaa
     5581 tggggtatag atattgatat tttgatattt aacatatcag atataaaaac attgattgga
     5641 cattggatat tgatattttt gatacattat tgatattttg tgatatcaga tataaaaaca
     5701 ttgattgggt attagatatt gatatttttg atattttaac atatcagata taaaaacatt
     5761 gattgggtat tagatattga tatttttgat acaatattga tattttgtga tatcagatat
     5821 aaaaacattg attgggtatt agatattgat atttttgata ttttaacata tcagatataa
     5881 aaacattaat tggacattag atataaaaac attaattgga cattagatat aaaaacatta
     5941 attggacatt agatataaaa acattaattg gacattagat ataaaaacat tgattggact
     6001 ttatatattt aataaaatgt atcgatattg atattgatat aaaatccttt ttaagaaatt
     6061 aatgagttaa cataattatc aattttctct tcaatggtgc taataacata atttttaagc
     6121 atattagtta attctgttac ttgagactca aacttttcaa cttcattcat tatatcttca
     6181 cttaaatttt gttttaatat atttgattga tcttgaatac ttttttgtat ttcattttgt
     6241 aatgcttcaa ttatagttga taatgattta ttgacatcag gttcaactaa ctttacttta
     6301 acatttcttt tctcagccat tttatatcaa aattttaaat ataaaattat atttcatcta
     6361 tttgctgtgt taaaataaca tggtcatagt tgaatatcaa atatctatta aaaacttttt
     6421 catatttttt atcaatgtta tttatttgta gtattttatt attagaaata attacaacat
     6481 ttataatatt atatgtaaat ttatctgaaa taaatatatc tttactggat tctacaacac
     6541 cctcctctat taccttttga tcatttataa taattatata acatgtagat tttgtattat
     6601 caccattaca tacaattttg ttagcataac attcaccgca tactccatca tgaacaaaat
     6661 taattttgtt acatttatta catatatcaa gtttaatatt aataggaaaa tcacaattaa
     6721 tgcatatacc atctgtatat tgataagatg atacattaca atttttacat aaaactacac
     6781 attcaagatc aatttccatt ttacagctat acattatgat tggattaatt tttcaaaaaa
     6841 aaaaaaaatt atttcatatt ctgttaatat aatttgatta tttatactaa tcatattatt
     6901 attaaatttt ttttaacatt aataaaaata ttatccattt ttcattttga gtattaacaa
     6961 taatgacaaa atttactact tcaatgaaca tataagatac aatgacttta gtaatttaca
     7021 ttcttcacga ttaacaatta tttttacaaa ttttgatttt attttataat aaaatgtaaa
     7081 tgaagtatta cttttatcta ataattttaa ataattaaaa gtaaaaatat tatgtaatat
     7141 catatcatat aatgaacttt tagatatctc taattttttc aaattatcta aattaattat
     7201 aaaattagta ttttttatat aacacgaact aatatttaat tcaattaatg tatttggtaa
     7261 tgatgaaata tttatattat aattgttaga tatatctaat tctttcaaat taattaaatc
     7321 atttataaaa ttagtatttt ttatatcaca attactaata tttaatttga ttaatgattt
     7381 tggtaatgat gaaatattta tatcataatt attagatata tctaataata ttacccatta
     7441 tagttatcaa aaatcaatgg atatatatac caataatatc cataccaata acaataataa
     7501 tagaaatagc aatagtgaca aaatttagta tttaattcag aatcaataaa catattacat
     7561 tgaatgcatc tttttgtaaa caatctttta aatagatatt tatatttgca ttcttctgaa
     7621 caaatattac ttatataatc atagtttcca caaataatac atttaattct atatttttta
     7681 tacattaaaa ctccaatata agcataataa gatttattaa taaaattaca atttttacat
     7741 ttgccattta attcatctac ttctgttata tctgtacaat gtgaacagta cataaacact
     7801 ttatttttgt aacatatttc acaaatttca aattgattct gaaatgtaat taactcacat
     7861 tctttacaat attttttttt gtaattcata ttatgttttg cacgttttat atttaattgc
     7921 attttgatat aatagtttaa taataaaatt aaaattatta tttcagataa tgtatatata
     7981 aatttaatta ttgaaatagg taacacacat tcagaaatat taggattata gcaagttaat
     8041 tttattattg attttgataa tttatcatct atatttaatt ttttttttaa attataacca
     8101 caatctaaag attttatata ttcatatatt attttagtat tataatcctt aaataaaatc
     8161 ttcatcttca tcttcactac aacttgacat attatttaat gattcttttt gtacattaat
     8221 taataaattt aaaaaattat tattaatatc atatttataa tatattaatt tttttaatga
     8281 agatggtatt ttacaaatat caatatttga acatatattt ttatatattt ctaattcttg
     8341 taaattaatt aatcttttta taaatttaaa atttgtaata ttgcattttg cacaatttaa
     8401 ttctattaat gatattggta atttactttt ataactattt gaatttttgt tatcacgtat
     8461 atttaatatt tgtaaaatat gcaaattttc taagaattta caatctaaaa tagtacatga
     8521 ttcacaattt aattctatta atgttgatgg taaattacat ttagaaatat tttaaaaata
     8581 gttacaagaa atatctaaat tttttaaatt aactagtgat tctaaaaaat taaaattttt
     8641 aattcttgcc aatgaacatt ttaaactatt taatgataat ggtaatttac atttagaaat
     8701 atttgaattt ctattattag atatatctaa tatttctaaa ttatataatt cttctaaaaa
     8761 tttaaaatct ataatattac aatattgaca ataaaattca attaatgata atggtaattt
     8821 acatttagaa atgtttgaat ctctattttc ggatatgtgt aatattttaa gattaattaa
     8881 tgattccaaa aatgtaaaat ttttaatatt acaagaaata cattttaatt ctattaatga
     8941 tattagtaat gtacattcat atatatttga atttttatta ccagatacat ctaatatttt
     9001 aatattaatt aatggttcta aaaatttaaa atctataata tcacaatctt tacagtaaaa
     9061 tccatttatt gatattggca atttacattc agatatattt gaatatgtat tatatgatat
     9121 atctaataat tgtagattag gtaaattttc taaaaattta aaatctataa tattacattt
     9181 ttcacaattt aaatttttta tatattcggg tttataatgt gaaaaatagt tatattgtat
     9241 tggtatattt aattgataat tataatattg aaatatttaa catgtttttg ctaatttatg
     9301 cttattctca ttatctaaat atgttaatat atcctcataa caatataaat taatattatt
     9361 cattttttat tattaatgta aaatatgtaa aatttcaaaa aatattgtat ttatatataa
     9421 tggttttaaa aaattaaagt ctataatatt acatttagga tttttaaata tatctatatt
     9481 tgatttttat tttttcacat taagtaatta ttttatttaa tgatggtggt aatttatatt
     9541 tattaataac ttttttttta tattcagata gagttaatat ttgtaagttt attaatgatt
     9601 ctaaaaaatt aaatttttct attttatcac ctctacatat taattctatt aatgaaattg
     9661 gaaaattata tttataaata tatgaataag atatatctaa tttttttaag tttattaatg
     9721 gttcaaaaaa tttactatca tgtattttac aatgttcgca agttaattta attaatgatg
     9781 atggtaaatc aaaattataa attttaaaac ctgaaaaatc taactcaatt tatgaacggt
     9841 gggtaattaa aatgatttaa aatattaaat gagtaaaaat cattaacaga tatatctaat
     9901 ttttgtaaat taattaatgg ttgtaaaaaa ttaaaatttt taatattaca tttgctacaa
     9961 tataattcaa ttaatgatat tggtaattta catttagaaa tgtttgaatc tccattatca
    10021 gatatattta atttttttag attaattaat ggttccaaaa atttaaaatt ttttatatga
    10081 caactataaa ggtctaatac gattaatgat gtgggtaata tacattgtga aatatttcta
    10141 ctagatcttg aacttaatgc taaacttttt aaattaatta atttttctat aaatttaata
    10201 tttttaatat catattcaat aaaatttaaa ttaattaatg atgtaggtaa tttacaaatt
    10261 gatatattag aacgtgaatt catgtatatt gttaatgttt ctaaattaat taatcgttct
    10321 aaaaatttaa aattcgtaat atcacaatac tcagatttaa atttaattaa cgatattggt
    10381 aatttacatt ttgatatatt tgaatatgaa ttagaactta tatttaattt ttgtaaatta
    10441 attaatggtt ccaaaaattt aaaatcatat atataacaat atccacaatt taattttatt
    10501 aatgatactg gtaatttttt acaatctgat atatttgaat ttttattata agatatattt
    10561 aatattttaa tattattcaa agtctctaaa aatttaaaat catatatata acaaaattca
    10621 caatttaatt ttattaatga tactggtaat ttacaatctg atatatttga atattcattt
    10681 gaggatacat ctaatatttc taaattaatt aatgattcta aaaatttaaa atcaattatt
    10741 ttacaagaaa tacattttaa ttctattaat gatattggta atgtacattc atatatattt
    10801 gaatttttat tataagatac atctaatatt tctaaattaa ttaatgattc taaaaattta
    10861 aaatcaatta ttttacattc attacaattt aaatttttta acaatgatga taatttacat
    10921 ttgtaaatat ttgaattttt attataagat atatctaata tttctaaatt aattaatgat
    10981 tctaaaaatt taaaatcaat tattttacat tcattacaat ttaaattttt taacaatgat
    11041 gataatttac atttgtaaat atttgaattt ttattataag atatatctaa tatttctaaa
    11101 ttaattaatg attctaaaaa tttaaaatca gttatattac aatcactaca atttaaattt
    11161 tttatatatt ctaaattata ataagtaaaa tatttataat atattggtac ttttaatata
    11221 caattataat atttaaataa ttcatatata atacctaaat tattcttatc atcgttgtct
    11281 aaatatttta atatattctt ataacaatat aaattaatat tattcatttt ttattattta
    11341 atgtaaaata tttaaaattt caaaaaaaaa tatttaatta gatatagtta ttattctaag
    11401 attatttgat gattttaaaa aattaaagtc tgtaatatta caattaatac aaacaaattt
    11461 aatcaattta aatggtaatt cacaatttga aatatttgaa ttattattac ctgttataaa
    11521 taattttttt aaattataca agtttttcaa aaatttaaaa tctaaaatat tacagtatga
    11581 acattctaat tctgtaagtt ttatcggtaa gttacaatga gatatatttg aatttttatt
    11641 accagatata tataattttt ttaaattata caaatcttct aaaaatttaa aatcagtaat
    11701 ttcacattta ttacaacaaa attcaattat tgatattggc aatttacaat cagaaatatt
    11761 tgatttttta ttattaatta taaataattt ttctaaatta tacaaattct ctaaaaattt
    11821 aaaatcggta attttacaat taaaaaatac tattttcttt aaagatattg gtaatttaga
    11881 ttctatcttt gatgcacaac atattgttaa acattctaaa ttaattaatt tttctaaatt
    11941 gtttggaatt ttaccactac attgtaactt tcttacatgt tttggattat aatattttat
    12001 atgattttca tgtaatggta tatttaatat actattatat tttctatata atttattacg
    12061 tgcagctaat ttatgtattt tatttaaatc attatttaat ttttttaatt tttctttata
    12121 ataagttaaa ttattcattt taatttaagt aataatattt cttttttttc aaaaaagcat
    12181 aaatatgtga aatatttaaa tattataatt atcaataaaa aatttatatg taaatattgc
    12241 aatataaatt attaacaatt caaattgcct aattattatt gaagtatcaa gacctatatt
    12301 ctaattcaat taatgaattt ggtaaattat atttaatatt tctaaaaatg taaattcttt
    12361 ttatcaatca taaattccac tatcactatc actatcacta tcactatcac tatcactatc
    12421 acttgtaaaa tcgtaaacca atttgtgtaa actattatta atatattcaa aatcaatatc
    12481 atgtttagca taaaatatag tttctaatgt tggggaaaga ttacaatata ttatattgga
    12541 agatccgttt ttacatatat ttaatatttt taatgatttt aatggttcta aaaatttaaa
    12601 atcagatata taacaataca tacaatttaa ttcaattaac gataatggta atttacatat
    12661 agatatattt gaatcatgat ttccacatat atttaatttt tgtaaattaa ttaatggttc
    12721 taagaattta aaatctgtaa tattacatat tgtacaatct aattctatta atgctgtgga
    12781 taatttacat tctgatatat ttgaattagg attattattt atatctaata tttttaaatt
    12841 atataatttt tctataaatg taaaattatt tattttacat gttgaacaat ttaattcaac
    12901 taatgttgat gttaattcac atgtagaaat atttgaagaa aatgtatatg aaatatttaa
    12961 tttttgtaaa ttaattaatc gttctaaaaa tttaaaatct ttagttttat aacaatctga
    13021 acaatttaat tcttttaatg atattgataa cttaaattca gatatatttg cttcataatt
    13081 ataagataca tctaatattt ctaaattagt taagtgttct aaaaatttaa aatctgtaat
    13141 agcacatcta gaacatataa atttctttat tgtttttgat aatttacatt ttgatatatt
    13201 tgaattttta ttttcagata tatctaatat ttctaaatta gttaaatttt ctaaaaattt
    13261 aaaatcagta attttattaa aagatatatt taatattgtt aaattaatca atttttttag
    13321 taaagtatta ttttttataa aacagttatt gcaatataat ttttttaaag atattggtaa
    13381 ttcacattca gatatattta atttatgatt ataagataca tctaatattt ctaaattaat
    13441 taattcttct aaaaatgtaa aatctgtaat agcacatctt gcacatataa atttttttat
    13501 tgtttttgat aatttataat ttgatatgtt tgaaattata ttattagata tatctaatat
    13561 ttctaaatta attaattctt ctaaaaatgt aaaatctgta atatcacatc tatcacatat
    13621 aaatttcttt attgtttttg gtaatttaca ttttgatatg tttgaaatat aattttctga
    13681 tatatctaat acttttaaat tatttaattt ttttaaaaat gtaaaatctg ttatattaca
    13741 tttttcacat ataaattcct ttaattgttt tgataattta taatttgata tgtttgaatt
    13801 tatattataa gatatatcta atacttctaa attaattaag ggttctaaaa atttaaaatc
    13861 tgtaatatca catctaacac atataaattt ttttatttta tttggtaatt tacattttga
    13921 tatatttaat ttttcattat tagatatatc taatatttct aaattattta attcttctaa
    13981 aaatgtaaaa tctgtaattg ttaatccaaa tctatctgac gaattaaaat ttcttatata
    14041 tttaggttta tagtaatttt tataatagtg attaacacaa atatttaatt gataattata
    14101 atattgaaat aattcacata tactagctaa attatgtata tcactatctt ttaaatattt
    14161 tattaaattc tcataacaat ataaattaat attattcatt ttttttttta taatacaaat
    14221 ataatatttc aaaaataatt taaaaagata cttttttgaa aatatatata ttaacaatga
    14281 tattataaaa aaatgaataa tattaattta tattgttatg agaatttatt aaaatattta
    14341 gatgacaaaa ataaacataa gctagctaaa gtaagtaaaa tatttcaata ttataattat
    14401 caattaaata taccaataca ttattcatat ttttcacatt ataaatccaa atatataaag
    14461 attttaaatt gtgaaaaatg taatattaaa gattttaaat ttttagaaaa attatctaat
    14521 ttagaaatat taaatatatc tgataataaa aattcaaata tatcaaaatg taacttacca
    14581 aataaaataa aaaaatttat atgtgttaga tgtgatatta aagattttaa ttttttagaa
    14641 agattattta gattacaaat gttagatata tcttataatt atataaaatc aaatatatct
    14701 aaatgtaaat taccaatatc attaattgaa ttgtattgta aaaattgtac taataataat
    14761 ttctattttt tgaatgactt acctagatta gaaatattag atatatcttg taataataaa
    14821 ataataaata taaataatat tagattatca aaaaaattaa ttaaattaaa ttgttcaaat
    14881 aataatatta gtgatattaa atttttagaa catttatcca atttagaaat attaaatata
    14941 tcttataata aaatatcgta tatttataat tataaattac caaataattt aattgaactt
    15001 aattgcaaat ataataatat aaaaaatttt aaatttatag aaagattaca taatctaaaa
    15061 aaattaaata taagtaataa taaaaaatca aatatatcta aatgcaaatt accacaaaca
    15121 ataatcaatt taaatataaa agcgtgtgat ataacagatt ttagtttttt agaaccatta
    15181 aataatttgg aaaaattaaa tataacagaa gaaaattatg ataatgaaac aaatcttagt
    15241 aaatgtaaat taccagtatc tttacgagta ttaaaatcta cagattttaa tgtgtgtaat
    15301 tatttatttt tagaaagatt aattaattta gaaatactat atataaatga ttttttcgat
    15361 tttgaaagca tattaattag atcattacca atatcattaa aagaaattaa tttaagttct
    15421 tgttgttata ttgatgatat taaattttta gaaccattaa ttaatctaaa aaaattaaat
    15481 atatctgata atagaaattt aaagataact gaatgtaaat taccaatatc attaattgaa
    15541 ttagattgtt catcatgtga tattactgat tttaaatttt tagaaccatt aattaatcta
    15601 aaaaaattaa atatatctga tagtagaaat ttaaagataa ttgaatgtaa attaccaata
    15661 tcattaattg aattagattg ttcattatgt gatattaatg attttaaatt tttagaacca
    15721 ttaactaatt taaaaacatt aactatatct tttaatacta atatattaga atgtaattta
    15781 ccatcaaatt taaaaataat taataaataa tatttttttt tgaaaatgta ttaattatta
    15841 cttaacaata aaaaatgaat aatattaatt tatattgtta tgaaatatct aatatctgta
    15901 agttttttag tttttctaaa aacttaaaat tagtaatctt agaactttta catttaaatt
    15961 ctattaattt atttggtaat ttacactcag atatatttga attttcatta caaaatatat
    16021 ttaatatttt tagattacat aaggattcta aaaatttaaa atcaataata tcactaataa
    16081 tacaatccaa ttcaattaat gatattggta atttacaatt agatatattt gaatttttat
    16141 tatatgatat aattaatttt tttaaattat gtaatttttc taaaaatgta aaatcaataa
    16201 tattacaaga tgaacaatct aatattttaa ttgatgaagg tatataatca aaaatatttg
    16261 aatctgaatt taaagatata tttaatgtta acaaattagt taatggtttt aaaaatttaa
    16321 attctataat attacatgaa atacaaataa atttaatcaa tgataatggt aaagtacatt
    16381 gagatatatt tgaatatgta ttatatgata tatttaatat ttctaaatta gataattatt
    16441 ttagaaaact aaaatctaat atattacatt tttcacaatt taaaaatttt atatattgat
    16501 atttataatg taaaaaatat gaataatata ttggtatatt taattgataa ttataatatt
    16561 gaaatatttt acttacttta gctaatttat gtttattttc gtcatttaaa tattttaata
    16621 tattctcata acagtctaaa gtaatattat tcattttttt atttattatt atttctataa
    16681 aatttcaaag agtttaaaat atatttgata atgaacaaaa aaataaacta attattaatt
    16741 atatttaaaa attcaggcaa tctacattca tttaaatttg aattatgaat atatccagga
    16801 tctaataatt ttaaattagg taaacattct aaaaaactaa aatcttcaat gttacaataa
    16861 cgacatagta atacaattaa tgatgcaggt aatatacgtg tagatatatt tgaattatta
    16921 tttttttcaa tatttaatgt atgtaaatta tttaattctt ctaaaaatgt aaaatcttta
    16981 atattacatt ttgaacaatc aaatgtaact atagttgtag gtaaattaca atatattatg
    17041 tttgagaaag aattttcacg tattattaat atttttagat taattaattt ttccaaaaat
    17101 gaaaaatctt taataaaaca tgaagaacaa ttaaataaag taattgatat tggaaatatt
    17161 attttattta ttttttgaga tatattataa ttatatgata tatttaactg ttttaaattt
    17221 gttaatggtt ctataaattt taaatcattt aagtaacatt ttgataaatt taattcaatt
    17281 aattttttag ataaatcaca atctgctata tttgaatttg gatttttgga tacatctaat
    17341 acttctaaat ttataaattt ctctaaaaat ttaaaatctg taatatttct attactacag
    17401 tttaattttt ttatatattc tggattatat ttttctatat cttcataatt tatgtaatcc
    17461 attttttata tgtacgatag actatactaa aatttcaaaa taaaattatg ttattcatta
    17521 tctgataatg gttatttatt caactctaga gaatttaaaa aattaatatt ataaatatct
    17581 tttttatcat attttaattc aatcaatgat gatggtaatt tacaaagatg aatttctgaa
    17641 taattatttt tatatatatt taatatttgt aaattattca atggttctaa aaatttaaaa
    17701 tttatgatat cacaattgct acaatttaat gcaattattg atattggtag tttacattct
    17761 gatatatttg aatctgcatt tttagatata tttaattttt ttagattaat taaatattct
    17821 aaaaatgtaa aatctttaat atcacatgat tcacaataaa attcaattaa tttatctgtt
    17881 aaataatatg tagataattt taaatcatta ttataagata tatttaatat ttctaagtta
    17941 actaaatctt ctaaaaattt aaaatcagta ataccacaaa attcacaatt taattttatt
    18001 aatgatactg gtaatttaca ttctgataaa ttatttttat aattatatga tacatttaat
    18061 ttttctaaat taattaatgg ttctaaaaat ttaaaattag taatattgca tatatataaa
    18121 actaaatatc ttaatgatac tggtaattta cagaatgata tatttgaatc tttattatga
    18181 gatatatcta atatttgtaa attaattaat ggttctaaaa aattaaaatt agtaatataa
    18241 caacatctac attctaatcc ttttaaagat actggtaatt tacattctga tatatttgaa
    18301 tctttattat tagatatatc taatatttgt aaattaggta atttttctaa aaatttaaaa
    18361 tctgtaatac cacaagagct acattttaaa cgtattattg atgatggtaa attacaatca
    18421 gaaatatttg aatctttaat gccagatata tctaatattt ctagattagt atattgttct
    18481 aaaaatttaa aatctttaat attattattt ttaatatgta atcttgttac atcttctgga
    18541 ttataatatt ttaaatgttt atcatataat ggtatattta acaattcatt aaattctcta
    18601 aatgtttcac attgttctga taattcatgt attttatcta aatcgttatt taaatatttt
    18661 aaaataagtt tataacaatt taaattaacc attttttaat atcaattatt atttgctatt
    18721 ctttcaatat atttaatatt aatgatattg ataaatataa aaaaaaatga taaattatta
    18781 aaatattttg atgataataa taaacataat tagctgaagt aagtgaaata tttatcaata
    18841 tattatgcat attttcagat tataaaccaa aatatattat aatatatata tctcaaatta
    18901 ttttatgata aaaaaattaa gtttttaaaa ccttattttt ttttatattt aaaatatttt
    18961 aaattaatca atctatctgt aaatttaaga ctatcttttc tgacaccgca aagtatacat
    19021 tccaattcaa ttaaagatat aggtaaatta catttataaa taaatgatga tttattatta
    19081 ttcatatata aatattttaa tatagataat ggttcaacaa atttaaaatc ttttatatta
    19141 caatttttac actctaaacg tattaatgat tttggtaata tacaattaga aatatttgaa
    19201 tctttattat aagaaatata taaatctttt aatgattgta atggttcaac aaatttaaaa
    19261 tcttttatat tacaattttt acactctaaa cgtattaatg attttggtaa tatacattca
    19321 gatatatttg aattttcatt ataagaaata tataattttt ttaatgattc tagagattct
    19381 aaaaatttaa aatcttttat attacagcta gtgcaatcta attcaattaa tgatattggt
    19441 aatatataat tagaaatatt tgcatttcta ttacgtgata tatttaattt ttttaaatta
    19501 actaaattct ctaaaaatgc aaaatctaaa atactagagt gtgaacaatc taatttaact
    19561 atagaaattg gtaaatcata tatttgtata tttatatttt ttgaaaatct aatatctaat
    19621 gtttgaagat taataagatt tttaaaattg gaattattaa aattaaaatt ttcatataca
    19681 tgcattgata ttgaattcaa tgatgtaggt aattcgtaaa ttaaatcatt agaagatcta
    19741 actgatatat ttaatatttt taaattaatt aatttactta aatttttaaa gtcatttata
    19801 tagtaacaac tataatataa atatttaata gtatttgata aattacattc ataaatattt
    19861 gaatttgaaa tgtctcctat ttttaatgat tctaataatg ataatttttc taaaaattta
    19921 aagtttaaaa tgccacaaga caaacaatta aaatttatta attttgttga tgaaatataa
    19981 ttataaatat taggatcata attaccagat atatttaata tttctaagtt atgtaaattc
    20041 tctaaaaacc taaaatccat tatattacat gatttacaaa taaaattttt taaccttggt
    20101 gtaagtttac atttagaaat atttgatcgt acattgtatg atatatttaa actttctaaa
    20161 ttatgtaatt tttctaaaaa tttaaatttt ctaatacaac aattgcttac atttaaagta
    20221 gttaatgatg ttggtaattc atcattatgt atttttggtt ttttattata agacatatct
    20281 aatgatttta aatttattaa tttacttaaa aatcccaaat cagatttatt acatttactt
    20341 atatttaaac tagttaatgt tgttgataat ttaatattat ctatatataa tgggtcattg
    20401 aaacataaat ttaatatttg tagattaatt aatttctcta aaaatttaaa atctaatatt
    20461 atatcttttt ttttactaca atctaaattt attatacttt catcatcata atattttata
    20521 ttatcataat ttattggaat ttgtaattca atattataat ctctatatac tgtacttatt
    20581 tcacaaaatt tatgtatatc attaatatct aaatattgta ttatattctt ataacaatat
    20641 atattaatca ttttttttaa atatatttac agtaataata taaaaattca aaaatattta
    20701 tttaattaaa ctatatataa ttgaaactga tggtggtaca tatttacata tttctttata
    20761 atgaggatca gttataaata cttctaaatt aactaatctt gttaaaaatg aataatcttc
    20821 tatattaaaa tatacacatc ttattttagt caatgataat ggtaaattac atttagtaaa
    20881 attactaata tcataatcat tattaacata aataaaatta aatgatacat ctaattcttt
    20941 taaattaatt aaattttcta aaaatttaaa atttgtaata ttattacata tgcaatctaa
    21001 tacaactata gatacaggta gattacattt atcaatgttt gaatttatgt cattatgtcc
    21061 tatatctaat ttaattaaat tatttaattt ttctaaaaat ttaaagtctt taataatatt
    21121 acatgaacaa ttaaaatcta ttagtttatc tgataattta atattagata aatctgttat
    21181 attattaaga aatatattta ataattctaa attgaataag ttttctataa atttaatatt
    21241 tgatatatta cattctttac aatataattt ctttaatgat tgtggcaatt cgcaatcaca
    21301 aatattagaa ttaatatttt cagatatatc taatatttct agattagaca acatttctaa
    21361 gaatttaaag tctgaaatgt tacattgtat acaatataat tgttttaatg attttggtaa
    21421 attacattca taaatattag aattaatatt tttagatata tctaatattt ctagattaaa
    21481 taaatgttct aaaaatttaa aatctgaaat attacattct ttacaatata attcttttat
    21541 tgattttggt atatattcag atatatttga atcattgtta tttgaaatat ctagtatttc
    21601 taaatttaca aatttatcca aaaacttaaa atctttaatt tttctatgac tacaatctaa
    21661 actttttact tcttcaggtt taaatttttc tatatcttca tattttacat aaaacatttt
    21721 taatatatac aatattttac attaaaaatt caaaaatact ttatatatag atattatgat
    21781 ataatttaac atatgatttg tataaatctt tattatattt aatattctca cattcattat
    21841 ttgataagtt aaattcatta gctattaaat gtaaaatatt ttcatcatat tcatattctt
    21901 tatcattatt accagcctgt aaatttgaat taattatagc atctattatt ttaatagctt
    21961 ttcttaattg ttttctaata tattttttag gtttaacatt tataatatta acatctttta
    22021 gctcaaatac agaaatatta tttattaaat atattaattt atcatttgat attaaatctt
    22081 taaaaaaata ataattatac aatatatttt catcattaaa tatatatttt attcttgaat
    22141 ataatatttt attatctata tatcttctat tttgattaga attttgtgtt aattcatttt
    22201 tatatttatt aaataatatt ataaatctat ttactcgttt tttaatttta tgttttaata
    22261 gaaaactatg aaataaagtt tgtatttgat cattaattac attatattta ttatctaata
    22321 aaaaagtatt tatttcaata ttatttatat tattagtttt taaaggagtg attgatatat
    22381 ctaaaaataa aaatttacat ttatatttat ctttttctat aacaaacgta tcataatgtt
    22441 tctttaaatt gcatgcaaat tttattgtat aataaaatct aattaatata aatttattat
    22501 cgacaatgtt tacattaaat tttaaattat tattaaattt tccatatttt atattagata
    22561 ttacattata aactttatta tatgcaccag caatatatat attattatta tatttagatg
    22621 atattggaac catattatta aaatcaatat tatcagatat ttgttcaaat tctattttat
    22681 aattttccat tatttgtgaa atatcattaa ttaatttttc atcattaata tattcaaata
    22741 tatcagttat tttatatgtt tttttatttt tattttttat attatctaat attattttat
    22801 tgaacttatt aggttcaata tttattgaaa tatctaaatc tcctcttata ttataattat
    22861 caatttgtgt aattaattgt gatgcaatac cacctttaac tatcaattta tctttataaa
    22921 atatattttt taatacatta tataaattat aaagtaatct aaaatttgca ttcatgttat
    22981 taaatatata atcagtaatt atatcattta ccattttatt agttaataga ctaaatttct
    23041 cattatacat caactccaca aaatcatcat acattattta ataaatataa aattgaaaaa
    23101 atattcatat taatataata atggaaaatt ataatgttag tcatattaca aatatgttta
    23161 atttattaaa aacacctata aattataaaa gattggaaaa atattttatt aaaaatgaaa
    23221 atttttcaaa acatcaattt aaagaattat tcaattttat gcaaaaatat atttacaaaa
    23281 tacataatat aaaagaatta tatttattca atgattgtat tgatacatca aatataaaat
    23341 gtgaatatat tgattataaa catataacta ctataattaa attattagaa tatcctataa
    23401 attataaaag tttagaatat tattttataa aaaatgaaaa tttttcaaaa tatcaattta
    23461 aattattatt tactcatatg agaaaatata ttttaatatt aaataacata aacacattat
    23521 attcattaaa acgcaatgtt aaactggaag atattataaa acaaaaaata ttaaaagaac
    23581 atgaaaatct tgataatcaa acattacaag agctaaaaaa tattattgat aatccaatat
    23641 atgactaaaa ttggattatt ttttagaaat tgatttatca atagtagtaa gtgaatattt
    23701 tatataattt aataatattt tttctattaa taaataatat tctctaattt cttcaactgg
    23761 taatgtgtta atttgaagta ttaaattctt aaaatcactt gtttttaaaa tacaccaagt
    23821 agtatttgct aattcactca ttgataattt aataacttca ctattaagca tttctctatt
    23881 ttcatcactc atttcatgat attttaattt tttaaattta attctattag tggttaaaat
    23941 agtttcaaaa ttatctttta aattttgata ttctgtatat aaattatttg ataataaact
    24001 tttatcaata ttttccatag cattagtgat aacatttaaa tcacaattaa gatatggata
    24061 attaagtata tatggatata attttttata tatataattc tgaattgaaa atatattatt
    24121 aactttatat atttttacat aataaaattg ttcaaatttt aatctgttac tgttcatttt
    24181 tactaatttt ccaacaacat catttgtata tcctatttta tatatgtttt tttctttata
    24241 tattaaatta gttgcaatat acatatatcc tgatttaata gctaaatcac attttaatcc
    24301 ataatgtaaa aattgtaatg tgtttaaggt aattacaatt tctgatttat tcaataaatt
    24361 taaccaaaaa tcattaaacc atattcccaa atttatattg tagttattat gatgtataaa
    24421 ttcaaatata ttcatcatta tgatttattt tctatattat aatttttcac ttaatcattt
    24481 tttaataagt tttaggccac atttaacgca tatatcattt gatttatatt ctctataact
    24541 cattttattg caactataac atctatatat atatttattg tcatatgtaa cactataacc
    24601 acagatatta caattaccat atgaatctat actaattttt gatctacaat tataacatgc
    24661 atctggtaaa tatgataatt tgtaaatata gtccattatg atattaatat tatgtttcta
    24721 ataaacatat tttttcaata aaaaaattaa atttataact tattactata atataattta
    24781 tatccaatag gacaattatt tttcatttca ttccaaaaat ttattttttt attaatttta
    24841 taattaaagg tttctttaaa atatttttca aagtctttac gtttaattaa tgatttattg
    24901 tattttataa atgcttcttt aattaatttc tttttttcat tagaagataa attatcaaaa
    24961 atgttatttg gtctattatt ttcaaatatt attggattaa caatactttt tttatttata
    25021 gaatttatat aaaattcttc atgtttttgt ttaattatat ttattaatac atcattagaa
    25081 tcaataacag catttaatac atattctaag tctggaaaat ataatttata taattcaaca
    25141 tttattttat tattatttaa taaaacattg tatctattca ttaaataatt aaattctttt
    25201 tcaatcttat taccatcata aacattttta taaaatacat aataatatgg atctgatgct
    25261 ccagtattat atgttgataa tctgttttta attgaattaa tattagtttt accaatttta
    25321 aatatattat ttgacaaatc agtattatta gttaatacat aaattatttc atttttttct
    25381 aatttctgta atctattaca atattcttta tattgttctt ttaattgttt ttcttgttct
    25441 aattgttctt tttctttatt taattgctta cataactgtt ctttttcttt ttttaattgt
    25501 tctttttctt gatttaattg tttctgtatt tgttctttta aatataataa attttgaaat
    25561 ttagtagtta ttttttctat tttattattt tcaatttctg gcaaattttc ttctttaatc
    25621 caattttgaa atttttcagc ctcatgtttc tttgatttaa acattatata atataatcca
    25681 gaattattaa cataaatagt tgattcataa tttattttat gttcattttt tacatatttt
    25741 ttaataaaat aatcaacact tttataattc aatatatcag ctatatcttt agctttataa
    25801 tatgaacaat tattatatgt aataatatta attttagata ttaaatccat tttattaatt
    25861 atattaactt ttcataatgt tagtgactta taaaaatttt ttgatttggt gtatgttaat
    25921 atagcaatat gtattttatt aattatttta tatatattat tctttttact atttggatta
    25981 aatctaatga atttacaatt taaatattgt tgaattaata attgactatt tttgtctttt
    26041 ttatcactat caactgcaat attaaaatct aaaaaatata aatcaatata atattgagat
    26101 actttataat ttattttata attatgatgt ttaaaacaat aaataatttt atcaatatag
    26161 ttattttcta taaattttat aggtaaatct aaattcaaat taaatttatt tattaatcca
    26221 ttaattacca taggtgatac tattgtagta ctctctttta ttaattctat taatcccagt
    26281 ttgttaatat aaaccatttt atttttttta taggataaat ttgtatttga aatattctta
    26341 tataatgttt tattacaatc agatattttg tatttaattg ctctatatat atttttatgt
    26401 tttaataatt tagctatatc aattgcttta aagtataaat tatcattata attaataaca
    26461 tgtattccct gcattaaatc cattttttaa tattatatat attttttcaa aatatataaa
    26521 aattaatgta aaatgttatt taaaatatta ttatgtattt gattaatgac ataatatata
    26581 ttaaaatcta cactttttgg attaaatttt ataaatatac aatttagata tttatttatt
    26641 atatgatatc tataattata atataattta ttttcattaa tatgattgtc attacaatat
    26701 tcaacagcaa tattatgatc aataaaatat aaatctatac aaaattcatc tataatataa
    26761 ttttctttat atctatgatt cctaaaacaa gaaatgatta tatcaatata tttttttttt
    26821 tcaaataaat ccaaatttaa attaaagtta tgtattaatg tattaattgt attagtagat
    26881 actattgatt tatgttttat tattaactca gacaatccca atttattaat atatatatca
    26941 ttattttttt caaattttat tttgttattt ttggatacat tatttcttat agcaccataa
    27001 gtatttttat attttaaaat tttagcacaa tcttctcctt taaaatacaa acaattatta
    27061 acattaatag ttttaatgtt agaaattatg tccattttaa agtaaatcta cacataggac
    27121 atgtagagtt attcattaac catatattta tacaatgttt atgaaaaata tgattacata
    27181 aggtttttac aaatattgac ttgttattta ttaaacaaat gggacatata acactttcat
    27241 taaatttaat ataatattta ttcaatattt ttttataatt taacttatgt aaaaataatt
    27301 ttataaatgg taaagataaa ttttgatatt tagatatatt attccaatcc aatttatttt
    27361 catatttttc aataaataat tcagacaatt tttgatattt tgatataaca ccccaatgaa
    27421 tattattttt atgtttttca ataaaatttt cagataattt ttgatattta gatatattat
    27481 accaatctat tttatcttta tatttttcta taaatttttc agataatgat tgatattgag
    27541 aaatatacac ccaatcaatt ttatttttaa atttttcaat aaattcttca ttcaattttt
    27601 ggttttttga tatataattc catttaacat attttttatt tttttcaatt aatttttcgg
    27661 atagttttat atgttttgat atatataacc aatctaatct atctttaatt ttattaataa
    27721 atgattcaga taatgattga tatctagata tattatacca atctaaatta tccttgtatt
    27781 tttctataaa attttcagat aatatttgat atttagatat aacgtaccaa tccaatttat
    27841 ttttatattt ttctattaat ttttcagata agttttgata tcttgatata atataccaat
    27901 ttaatttatc tttattttca tctatatatt cctcagataa aaatttgtat ttagatatat
    27961 tattccaata attttccatt ataaaattat tatcaatata tataatatta aaatttcaat
    28021 tctaaataaa tgattgattc agatgaagaa gacaaaatta ctattgaata tttagagaac
    28081 gaactattaa aacttgaaga aagaataatg agtttagaat tagaagtatc aaatctaaaa
    28141 tataaaaatg aaaaagaaaa agaataaatt atttttgaat tagcaaattt atatcattaa
    28201 ttaaattatc taaattaaaa aattcacttt catgattaaa atttatatat ttatcatcta
    28261 atgcaatttt tagataatta tgttttttat attgatcata cgattcataa tcatcacaat
    28321 ttattcctat attataatct ataaaatata aatcaatttt ataattagaa attatataat
    28381 ttcttttaat attaaatttt ttataatatt tttcaatata gttaatgata tcaaactttt
    28441 ttttataata tatcattgtt tgaacacctt tagatgttat aaatatatca ttgtttgata
    28501 tgtttttata attatattta tatttggttt tactaaaaat acatttatct tcatatttta
    28561 ccaatgataa taatttttca aatgagggat tcattattat atattaaatt ttatttttca
    28621 tataatattt ataaaaaaat taataaaact atattgcatt gaatataaaa tactgattga
    28681 ctagaataat taagcgtatt ttaaattaaa taatatatga tattatagtg ataatgatag
    28741 taataattat actaatatgt taataatata atcattttgt tgaaccctcc tccacccctt
    28801 ctccgcctca aatcatatta agagatagat tataatttta tatatttttt ttcatgcagt
    28861 gattataaaa ataaatttta ctttattaat aatttattat tacatatagg acatttttga
    28921 tctgtatata tactctcaat aatatatgac acatgaacaa aatgatagca ccttgttaca
    28981 acatatttat tatattgaca ttcggataat atgttattta tattaaaatt aggtttacga
    29041 catccaaata ctgataatat aaattcattt ggtaattcta tattttgcaa tatacaacat
    29101 aaatcaagat taaatctata ttgatatata aaactatatg ataaatcttt acgtgttgaa
    29161 ataatatccc agttaagatt ttcattaaat acattacatg tttcataatc taaaaagtga
    29221 tattttgata caatttccca attaacatca tttttaaaat tatttaaaaa atttatatct
    29281 aaatatggtt gttgtgatac acaatcccat attaattttt ttttatattt tgtagcaaat
    29341 tttatagtca tatttaagta tttagatata atttcccaat ctactttttt ttcattgtta
    29401 ttaataaatt tatatatatc atattcattt tttgtattta taattttatt atatgttaaa
    29461 attttccaat ttaatttatt acttaatttt ttaattattt tattagataa tgttaattct
    29521 gatattttat ctatatctaa tattttaata ttggaaataa taaaatcttc tgggagaaca
    29581 ttataattta ttttatctat atgtatatat tttttaaatt caataatatc attaaatgat
    29641 aaatttggag ataaatattc ccaaaacaaa ttatcagcaa attctttaat aaatttactt
    29701 tcaagtttta attttgatat attttcccaa tcttttatag aaaaattata taaaatatat
    29761 tttttaatgt tttcattatt attagaatta caaaatacat catgtatttt agaacaacta
    29821 taataatcat aatttatgca attcatgata gtggttattg attaaattat tttttcaaaa
    29881 aaaatcctct tcaaatcgta tttttcaaaa catttatgta tttttaatat aaaaatttaa
    29941 atttttttta gaaatattaa tgttcaaata aaccattaca tattgatata ttaatttata
    30001 taatatatat cccaattaag tttatcttta aattttaatt attagaaaat aatcaaaatc
    30061 caataaacaa tacacattca ttgaattaca gaatcaataa taatttttat gctttgatca
    30121 actataacac tattataacc aacaaattgg tatcttgaag tactttctga tactacaaca
    30181 tttggtcggt tttcattatt tttagtatta taagctggtc catcaaattc aattcttttt
    30241 ggtgccatag gtgcaatata aaattcaatt tgtgaataat tattaccatg aacattttta
    30301 atttttgatg tattttcaaa tgttatggat tttggatttt ctggatcttc taatagatca
    30361 tcaggcaaaa aatcagctgg caatgtattg tttcgttcaa cataaataat tttactgtta
    30421 gaatcaacaa tattttgata tataccaata ggtacatcgt tttgagtaat taaaagttta
    30481 acttttacaa tagccttttg tatatataag gtcaaatgta tttttttatc attgttactt
    30541 tcaattttaa attttattag gttttttgat tcatcaacaa aagatataac tcctaataat
    30601 gttttaaatt tttctatttt gtcatctttt tttttgtatg gtttgttggt agacataact
    30661 ttatatgaag acatagtagt tggttgttat ttatttagta ttatttcata ttttatagta
    30721 catttatttt tttctaatat ttcatcaatt ttagcaatta acattaattt aaattcatta
    30781 aaatatgtaa aatcagtttg ttcatttata gaataattaa ttatattata catattaata
    30841 tttgtattaa aatatataga taatatatgt attattaatg caattattcc aattatacta
    30901 tatatatcaa tttctttaat taattcatat tttaatttta ataatattgt gctataatat
    30961 gctaaatcat tattattatt atccataata tatgattctt taaataattt taaatatttt
    31021 aacatttttt ttgatttaat atatttttta tattttttgt atatccttat aaaattttca
    31081 ttgttatgat tattatctaa tactggaatc atttataact tctttttttt ataataaata
    31141 tgaaacaagc aacatcatac ttagtacaat tagctaattc actaggacgt gaaataaaag
    31201 taattgatga agatgctatg agtacatcaa ttattattcc aaaagcagaa tcattagata
    31261 ttgtaggtcc agtaaatttt aaaagaagta ttacatttaa tgatgacata acatttaaaa
    31321 atgatgtaag atttgatgga tctgttactt ttggtggtga tgctacattt aattttttaa
    31381 gagcaaataa aattgaaaca ttggaagaac catcacatat taaaattaca ccagataata
    31441 atgaatctgt tcaagaattc gttgatgaag aaaaaaaaat taattcattt actattggtc
    31501 cagatgttac agaaaaattt aataatattt ctattttaga aaataattta ccaaatgatg
    31561 gatttaaatt tagtaataat gtactatttt atcaaaatga tactactgat attaaagatt
    31621 taaaaaattc atttttaatg attgatacta gtattgtaga taaatattgt atatatcata
    31681 ttgtatttac tattaataat ggtgaaacat atatttatta taaattttat tttaaaccaa
    31741 cttctaaagt accatttaaa attttacaac aagaatcaat taacgataat gacaataaaa
    31801 tttctattaa agaagaagat agaaatctaa aaattaatta ttctttagaa cgaaatatta
    31861 ataatatctc aataagagct tattattcaa ctatgtaatt agattttata aaaatgttta
    31921 tttatacatt aaaattttta aatttttttt gatatttaat aataaaggaa cttgataatg
    31981 gataattatc atatatattt aaccaattta ttttatcaat ataagtttct attatagttt
    32041 ctgttaaatc atttctagaa gataactcat cccaatttaa gttatcttta tatttttcta
    32101 taaaatctat acttaatggt tgattttgtg aaatatatgt ccaatttaca taatctttat
    32161 atttttctat aaattcatca aataatggcg ataaattttt tgttacaata tcccaattta
    32221 agttatcttt atatttttct ataaaatatt tattatatga tatgtttgaa atgtcatccc
    32281 agttattaat attatcaaat tcaaataata aatcatattt taaatattta ttttttaaca
    32341 aatattcaaa attaattttt tttttatatt tttttataag atttaatgat aaaggataat
    32401 ataatgaaat agcatcccaa ttaactttat cattaaattt acatatagta tcttctttta
    32461 ttatattttc tttatatatt ctattataat cccaacaaat taaatcatgg aatatattaa
    32521 ttatattatc tgttaaattt ttttgaaata atgttacttt tttccatttt aatttatcat
    32581 aattatttat tataaaattt tcagataatt cacattgatc ttttgatata atatcccaat
    32641 caacataatt tttatatgtt tcaataaacg attcagataa attttttatt ttagaaattt
    32701 ttgtccaatt aattttaatt ttattattta ttttattata tatcaattta tgtaaaatat
    32761 tttgatcaat aattagttta tctatattaa aaactttgtt taatattttt aaaatatcat
    32821 tatcatttaa tttttcagaa tagcttttaa caattatttc ttccattatt tttacaattt
    32881 aatataaatt ttcattttta tatattttca aaatatattc ataatgtttt tgttttaaat
    32941 tcacattcat aatcaacgta tataatttaa cataagtatt aatgttttcc aatatatatt
    33001 ttaaaatatt attaaatatt ttgtaatttt tatatttatt atatagtata tttataatac
    33061 actcattatc tatatttttt aaaaatattt catatatata tttataatat ttattaaaca
    33121 tttttggaat aatattttga tataataata aatttaatat tatattatat tcatttttat
    33181 atttttcaaa tataacatag atagtattaa taggtagttg tattatatta attatatata
    33241 ataatctatt aatatcatta ttattaatat attcattaat tatattttta tatattgggt
    33301 ggttttttat tgagttaaaa taaaagtata tactaatact acttacatta ttacaattaa
    33361 ttaattcaat tatctcatca taatatttat caataatatg attagatata ttttgagttt
    33421 gtaacattaa tgataatata tttttatcat tatgtatatt taaaatatta gatatataat
    33481 attcatttaa attaaaatta aatattaaaa ttttagtata ttctatatca tttgatataa
    33541 tatttaataa tattttttta attttatgat gcgaaaaata aactttatta attaataata
    33601 atgcgtttaa tatattatat ttatttttat taattatatc actagatata tcattatata
    33661 ataacatttt aattaataca tgtttatata tattgttatt taaaattaaa tttatttgtt
    33721 catcatttag ctttacaaat ggtaaaattt tattaatatt aatattatgt tgtattacag
    33781 aatttgttaa tttattacat aataatgtat ttttatattt tttatatata tttttatata
    33841 ttgtagattt aatattataa catgataata tataacatat aacatcactg tgtaaattaa
    33901 taatactatt aggaattaaa aatctagtaa taataaacaa aataattttt tcatgatttt
    33961 tatatttata aagcaaattg ttaatatttg aatatgataa ggttaaatta ttaagtaatt
    34021 ctattaaatc attattttca aaatactttt tatttttcaa aatataatat ataatattat
    34081 cattaatacg tttactttta aatactttat atatagataa tatatctcga taattattac
    34141 acttatctaa aaacacttca caaatatcta agaaatgtaa aatatattta aatttcatgg
    34201 ttaattttat aaaaatcaat aattatatta attaattatc ttatacattt tcattttttt
    34261 ttgtattttg ataatttttc agttatttct ttgtcatcta ataactgact aacatctgtt
    34321 attaatttta taacatatga ttcaatacat attctaattt ctgatatatt aaaattatta
    34381 agatttgatg gtattattat catttttttt gatatatctt taatatatga aatattccat
    34441 gatttatcaa taggtttcat atatatacca taaatatata gaaatctatc accttttcta
    34501 attttataat caggatattt ggcattaaat ttattaacag taagttcaat tatattatct
    34561 attgatacat attttccaga atatctttta gtaacagcaa aatccatata attaagttta
    34621 tctaaattat cgactaaatt tttaataagt tcatcaatat atttaataac tacattttta
    34681 gaattattat ttttattttc tattgatttt tgaataattt caattatagt tttataatga
    34741 tgtttatgaa agttactata atcacgtttt attaaagatg ttcctttact ttctattttt
    34801 gcttccaatg tatcataatt aataatatca tatgatatat attttttctt ttctataaat
    34861 aacatccatt ttttaacacc gccaaattct aagttaaata atttaggaaa tataccagta
    34921 tttgatatag tatttgatat aaatatacca atgtctttac ataatcttaa catatatgta
    34981 tcattcaatg atttattttt aaaatgaaca ataataaata cactgtctgt atcaccatat
    35041 actatttcta atgtaaaaca ttcttgtata ttactattat atttagtttg tatatgtgtt
    35101 ttagtaaaaa tattaataac attattaaca gtaaatatac cattaatatt atatgaatta
    35161 tttaatatat ctgcagtata ttttatacat tttcttccta atgcagtaca aaattgagca
    35221 caatatttag aattaaacat aaatgtttca gatgccataa gaccgtatat agaattaata
    35281 aatatttttg ttgtatattg catactatta taaacattat ataaaatatc atcatttgct
    35341 tttttggcat cattcatctt ttttttataa aatgatcttt tttccatacc ttgttttaac
    35401 attaatggaa ttattccatc ttttctacaa tctgttatta taaatgttgt taatttatta
    35461 ctgtttgtaa tatctatata catgtattca ggataattgt atgtattaaa tatataatta
    35521 tctatttttg cattcattat attatcatta gaagtgatca cttttataat tttttctgga
    35581 ctagcattta tttgtctcat aattgttgga tatagtgatg tataatcttc aagtattata
    35641 ggttcagtaa tatatttttt tttgactttt ggatcaaata catatgcacc ttcatattca
    35701 tctttttctg ttatatattt tttaaacatt tgtttttctt gtaataaagt atataataat
    35761 tgtccagttg ctgtatttga tgatgtaaaa ttaaatactt gattttgtgg taataaatat
    35821 tgagatgagt aaccagtaat aacttcatga attaaatcag tttcaaataa tttattacac
    35881 aatactgtat catgaataca ataatttcct atttcattag ctttttcaat tgtataattt
    35941 tcatatgttg atttatcacc aatatctata tcatctttgg ataatgctac aacaatatta
    36001 ccagttatat tacaattttt tacaataaat ggtacaccta ttgattgatt aattgcatct
    36061 ttatcatata atttttgcat attatcaata atatcatttt tatttatttg atatgcaata
    36121 tcattaataa aacaataatt agctgttcta attacgctat aaaatatttt taatttattt
    36181 tttgtatctt taggaattat ttttacatta ttagtatttt caataagttc agctattgca
    36241 tttatattaa attttgtttt acatacagtt tctaatttat attctggtaa tacatatgtt
    36301 tttttagtat atacatataa atcaaataat atagatgaat actcaatatg tgtatatcta
    36361 ctggatgcat cacctttaat tacattaaga tttggaaaac caaatggatt taacattcgt
    36421 aattttaata gattataaat atccatgcgt gtgtttatat aaggtatatc aaattcatga
    36481 ccattaaatg ataatatata atcaaattca tgaaataata aacattgaaa aattattaaa
    36541 atattttttt cagaagtata aattttaata acagaactgt tcatatttaa tattttttca
    36601 cattcattca tatcatatac ttttttattt ttttttgcat ttttttcata taaattacaa
    36661 tttgttaata ttaatatttt attttttttt ggatcatcat aaaagcattc tacacatata
    36721 tgtgatatag gcatatattt aggatcaggg aatgaaccag tttgtttaca ttcaatatca
    36781 aaagataatc tagatatttt gcatggtaat ggatcaattt tattcataaa taatttttta
    36841 ggattagata cataatatgt tttaaattta aaatgtatat tagtcacaaa tattttacaa
    36901 ttatcggatg taatatcaat attataacac gctgaaggat ctatattatt taatacataa
    36961 aaccatctat agtctaaaaa tgaatgatta aattcacttt ctaattgtat tttaaatatt
    37021 gttttaaata aatataaatt tcgatattta gcaatattta tatcagtttc ttcaaaatta
    37081 taatagtctt ttggtattaa atctacatca agtattttta aattttccaa tatttcatat
    37141 tcacctattt tatattcatc aatgatatta attaagtctt ttaaatcatt attattatta
    37201 actagttctt ttgaacaaag aaaataatga taaaagtcaa aaatgaaaaa tattaattca
    37261 tctgtatcta tatttttgca tttacaaact atatatcttt ccaatttgct ataattatat
    37321 tgataccaat taattatatg tattctaata ttttctatat cattagttaa ctctttaaat
    37381 attgattcat catatgttct ttttttaata taatgaatgg catgatcact atctatatat
    37441 tcatctgtgg ataatgtcga tttaaatatt ttattattaa atactgacat tttttattta
    37501 taattattat ttttcaataa gtaaaaaaaa atgtttaatg aaagaaattt tatatataga
    37561 ctttctagtt cattaactat atcatttaat ttattaatat atgtatatat taattaatca
    37621 tagatattat aattatataa aatatttatt taactcttaa agtggtattt cgtaaaataa
    37681 ataattatta tttttttgat aaattaataa agatgaatat aatttaattc tcagagtttt
    37741 ctaaaataga cataatttga ttactataaa gctcatgttt agtaaaaaaa tgttttcaat
    37801 ttattcatca ttattgataa ttttttgaat ttttatatct aaaatatcat ctattgaata
    37861 tctttttaaa ttgctaaaaa agattatttt gttaattcat tatattatta taaaaaactt
    37921 tttttttcaa aaaacaataa ttacatagtt aatttatttt ttttctgatc tatcataaat
    37981 aatatatatt ttaattgaat acaaatttgc aaatctttag tgttatcaat ttttattttt
    38041 aaattattat agaaataatc gagtaaatct aaattatttt caaaattttg atattctact
    38101 aaagatgaaa ataatttaat tgtatcaagg tttatttttt catcatatgt atctataata
    38161 tattccaaaa gttttttaga taattgatat ttagaaataa catgtttaat tatatattta
    38221 ttattaaata ttttaaaaag ttttctaaaa ttttttactt tattactttc aattgtttca
    38281 ataattaatg aatctatata atttttaaaa tcatcaaatg attcatccat aattttattt
    38341 tattgttaat agtattattt caaaaaaata tttataaatt atttcttaaa agcaattcca
    38401 gagaataatt tgattattct aaagatcatg tttagtaata atattatata tttaaatgca
    38461 ttatttgttt acctttggta gttattatga ttgtaaaaat gaatttatgt catttatagg
    38521 atttattcct aatatgaaac ctgtatttat ttttgaaaaa caaacgttta tacaagattt
    38581 agaagaatgt tatccttgtg tcacaattgg tattattaca attgttccag atatcgaata
    38641 tgaaaaatta aaatataata atccaaacgg attttattat attgatgtga tagatgttaa
    38701 taataatatt tatacttgca aatatttaaa aaatattaat attaaaaata taaaatttat
    38761 atttaatgaa ttaattatta aaaattatat gtataaatat tattatgaat cattaaaaag
    38821 ataatattat aattttataa tacaattatt atcataatat atttttttct tttcattatt
    38881 ttgtttataa actaaataaa aatttatatg attagatata cttttactat tataaaattg
    38941 ttttccacca attattataa tattaaaata taaattattt aaattatatt ttaacattgc
    39001 agctttaaaa gattcaacta ttatttgaaa acaatattta cctctatttc taaatgaaaa
    39061 tgctgtacca atatatttac aactatatct agatgcataa tacattacat cttttcttaa
    39121 tacattatca ttataaaaat tataaattct aacttcattt ctgtttttta aaaaaataga
    39181 taaaatctct ggttttgttt gtttaccatc acaatttatt acatattcat attcatcatt
    39241 tatattgctt gtattgatat gttttaatat agaattatct aaaaatgttt ttaatccttt
    39301 tccaaaatat atacatccat gtttaaaatt tgatggtgct atataatatt cataagtatt
    39361 atgatttact gtatgtaaaa cagatcctgg atataaaata tcattcattt acaaacaata
    39421 atcttttaat gtataccaca tcaaatcaat aactgtatat gctatatgaa atattgcttt
    39481 attattgtaa gatttatctg atgtacataa ttcagataat aattttactg gttttattga
    39541 attatcataa aatataattt ttaataaatt gggtgatttt aaataaatat attttctgta
    39601 taatttgtaa tcagaaacaa ttattaattt tgttttatta agtatattat cacagttatt
    39661 caaatttaat tctattgcat tgaagttttt tttcaataaa gtttcatatc ttttaataaa
    39721 cgtatttgat gaatatataa ttataccatc aaaattgtca ataattttag gtttataata
    39781 tatcaatcta tatttgtgaa atttattatt aattaatctg gcttcaaaat ctgctctttt
    39841 taacattgat aaaattttat aattttttgt aaaatcagtt atagattttg ataaaatatt
    39901 aataatatta acatttgtat gaatacacat atgaaaatta atattccaac atattatatg
    39961 caatacatct attggtatta tagatttaaa agtatcaaat actatttttg cacctatttc
    40021 tgaatgtcca agaaaacaat ttgtatcagt aaaaggctta ccaatgtcat gaaataatcc
    40081 tataaattgg aatatattta aattacctgg caatttttgt gttttatata cattatatat
    40141 tttcatgtca tattttatca tatgcatatt caatccattt gcagttttac ataaatgttc
    40201 aactaaggtg tatgaatttt ttttactcaa agatgatggt tttttatttt tttcatattc
    40261 atatataata gtataaattg gttttggtaa atatgtttta aaaatcgata atgcatcttt
    40321 tacaataagg ttatgtaaaa agaatatatt attattcata ttaatgcgta aatgaaaatt
    40381 acatatattt ttataatttt tcaaattatt taatatctaa tttattaaat gatatatctt
    40441 ctctaatttg attatttata gaattctcta aacttttaat aatatctata tatttcatat
    40501 tatcaaattt atttgtagat ttgagtataa acccagctat caatatatca tttttattta
    40561 taattctata atttttatta taataataca ttttttcttc aaataatata gattcttctt
    40621 ttgaaaaatt tttaagtata atattttgtt ctgatacaaa tattctcatt tcagttgatt
    40681 gtggtccaca aaatggttgt aaaaatttaa taccatctac atatacttca ttttctattt
    40741 caggaggaaa atcatcagga aatgggtatc taaattttaa taatgaatat aatggtctga
    40801 gatttaatac aatattattt tgtattttat agtcatctat aagatttttt gttctaggtt
    40861 cacttccatc agtacttcta atatcagata taaataacaa tggtttttta tttttaaatt
    40921 catttatatt tttttcagta aaataatcat tatttatact aacatattga gacattcgtt
    40981 ctaatgaaat acaatgtcct gatggatcat aaaaatacca tttaatatta taatctttat
    41041 ataaatctaa taattttatt aaatgatatc ctcttcctga tcctatatat aatacatata
    41101 ttggacgatc ttttgaattt aatgcatcaa tattacaatt attaaaaaat tgtaattcag
    41161 tcattaataa ttttaattga ccaggatgtt tattagatac attatttggt ttatatttta
    41221 attgattatt aatattatca aatattaata cattgggttt tttaaaatca ttaattttca
    41281 tatatatact cattttgatt ataaaaaata ctgtaagatt tcaaaaatct tctataattg
    41341 gtgattttat attaacttct tcttcttctt ttaattcaat ttttatacta tcatatctat
    41401 ttaaatttaa atatggttta taatatgatg cacccaattc tggttgttta tttaaaaata
    41461 atgatgaata actatcttta gctggatcta aaatattatt atatgcagca ttaacaattg
    41521 catcttgatt tccatgaata gcatgtttaa ttatactatt tttaccatct cgtaattttt
    41581 taatgctaac catatcagca gtttcacaca ttaattttgc caataaatta taacatattt
    41641 ccattgatct ttcattagtc gattctacaa gtctatttct tataacatat tcagcatatt
    41701 gaataccaaa taattcatat gcaaaccatt gattcattct aatatataca tctcttgtat
    41761 caaatctaga taattcagtt atactattta tataaaattg taaagaatat ccatcttgtt
    41821 catttaaatc aaaatcatac attttaatag gtactatttt taaatttttg ttattaaaat
    41881 ttccttttcc gacagcacct ggtaaacttt caataaaata taaagaattt atttcagttg
    41941 gttctttaaa tttaacacca ataataacat caatataagg atcattaaaa ttttgtgtta
    42001 tccaataact actaataata ttacaattat ttaaaaaatt attatacata ttaatatatt
    42061 gataaattga tattttattg tttatataat ttttattaat tctgacatta atatccaaat
    42121 atggattatc tttatttatt tcttttaaaa tagttatcac tggatcaaaa tattttaaac
    42181 atacaaattc taattgcatt ttaattattt ccaatttttt ataatgtaat gaattagcta
    42241 ttacaatatc tggtttattt tttttactaa gttcaactgt atctttaaat tcagtaaatc
    42301 ctaattgtat tgctactgca cctgattttt tacttgtatg aaatgctgat aatgcttgtt
    42361 gtgtaaattt ttcttgaata gtatgtgcat attcaaatcc aatagcataa cctggactca
    42421 ttgaacataa taatttaata ttaattttat caaatatata tgataccaat aatgatgtta
    42481 attttttatt atatgattct actgtatatc tatctaaata tgtcattaat acatatttaa
    42541 atatatccat cttttgagta taaaagaatg attcaacttt aactttttca acatattcat
    42601 ttataatatt tatcaattca tcattagata attcttgact attatcatta tctattatat
    42661 atgattgtat ttcagcttga atatttattg gaaatactgt ttcttttgta attgatgtaa
    42721 atgattcacc aacaagataa atttttatta tattatatat ttccattatt tcattataat
    42781 tatgcatttt attatttggt aataaaatat ttattcggct catatcacca ccaatcattc
    42841 tataataatt tggattttgc caaataacat aattatttaa tactgctcta ttataatgat
    42901 caattttaat tccttccata aatttaacta attttcttcc tgtacttcct gcagatgatg
    42961 tttcacatgt tatttttaag atttttttaa ttgaattata ttttgcatga gcacacattt
    43021 cagcaaatga taaacctttt aaagttgatg atttaataaa tcctaatgat tccatatcaa
    43081 tatttccagg tacattaaaa tcaaatattc tacccattac actaggtttt ggaatttcat
    43141 ttgaatctaa accttgttgt cctgtacatc caataatagt tgctaattca ttatcattta
    43201 ttttatatct agtatttttc attgttataa tgctatttaa ataatcatct ttaaatacat
    43261 ttccaatgcg tttaattact tcatttatta ttattttaga attatctatt ctaatatttt
    43321 caagttcgtc atacgataat aatatattat tattatttaa ttgatttgag ttataatatt
    43381 ttaataattt ataatgtgct attttacaac agttattaac aaatttatac atatcttcaa
    43441 tataattaag ttttggtatt acatcatgta atgaaacact aaatccatat aattttataa
    43501 catttctagc tatatataat aatatatcta ttaaatgtac accaaataca ttatttttta
    43561 attgtgacat taaatttgct aatgcattat atgattgtga tacaagatat ctagaatcaa
    43621 tcattggtaa tattaattta ccattttgta ttacattatt atatgttata ttatgtggaa
    43681 aaattaatga caataattca actcctgtat atgatttttt attaatatca cgtataaaat
    43741 aactatattc acctaatata tatatagcat catttaatga tatttctttt atattatata
    43801 acatatgaat tgcaattaac tgatcttgaa ttaatccaaa ggcaggtgaa aaattataat
    43861 tattttttaa aattgcagat gataacatta gaaaacatgc ttcgatgctt gatggtgatt
    43921 ttggcttata aatatttaat tcatcaccgt cataatctaa attcattgaa tttgctattg
    43981 cggttggtgt tgagaatgtt tgtgctttat gaattaaaca aaatgcacat tgaatattaa
    44041 atttatgtaa tgatggttgt ctactaaata atatcatact ataattttgt aatggaattt
    44101 cgattctatc accatatttt atttttaata aattgtttat ttttgcttca ggccttactt
    44161 ctaatattgt tgctggtttt agagcttcat aattgtataa aactataaat tttacatctg
    44221 gtgaattata tataagatca cgaacttttt gttcagtaaa tctattataa tatattgatt
    44281 cagttaatgt tgatgcaaca atttctggaa ttcctaaata accaattttt gcaataattg
    44341 gaccagcaac acctcttcca gtattatcag accttctagc taaaatatat gatctaagta
    44401 ttccttcttt tttatttcca gcaacttcag tatttaatgt atcaaataat gttcctctag
    44461 aatatggtga ttttggttta acatgatcaa tatcattata tattttttga atatcttcaa
    44521 tttctttttc tttaattatt gatccaacta attgatttaa ttttgtagtc ataatatgac
    44581 tatctttatt atcataatga tttggtggtc tagctggatt taccattatt aaaatattat
    44641 ttgtataaaa tgcttcatat ggtgtaaaat ttccaataga tagtggactt ttaatacatt
    44701 tatatacaat atgaggaata ccaattaaca ttttataaat ttgttcatta gatattactt
    44761 tatcttttat tacttttata taaaattggg cttttattgt attatattta tatgttgcta
    44821 ttggtaattg acaattaata ttattacatt ttgatgcaga ttgtttattt aattttatca
    44881 atgtaagaat ttcttttttt aattcagtag gtggatcaat tttattatct tgaacatcaa
    44941 tattgtattt ttttaaaatt ttatataatg cttcattatc acgaaacatt ttacaatttg
    45001 aacatatttt taaggcattt aatgtatcta atacagattt aataaatgca ggtttaataa
    45061 ttgccatttt ttttaatggt gttcgtccag gatgtcctaa atcaccatta tctttagtta
    45121 atctacatgt tgaacataca ttaaatttag taccacctaa tttagtactt ttaacattgt
    45181 tatcagcatc attactaata gaatttatta ttattggaat actgtcaatt atactattag
    45241 gaatcatgga aaataaaatt tcagtattaa ctttagccat tatttataat taacattttt
    45301 ttttcatata taacaaatag gttatatata tgtctaatat accatgaagg aatattattt
    45361 tcaattaaac cactaataat tatattttta tatatatttc tatttggtgc atcataaaaa
    45421 tattgatttt tatcatttag tatataagct tgagtagata ttattttatt agataataaa
    45481 tctaatacat taactttagc taaagaatat aaatttttat gaacaaattc ttgtttgttt
    45541 attttattca ttatagaatt gttaaaatta tataatatac caaatacaat accattatca
    45601 tcttttttaa ttgaggcaac aactgaatca attatattag aatatgttaa ataaaaacta
    45661 tatccaacta acaaacctat agatattgaa ttatttgata tttttaattt atgcatatgt
    45721 cttaaataat ttgtattaac attagcacca tatccaaaat aattgtacat ttaaatataa
    45781 aaattttaag ttttttaaaa accaataatt catgtttaaa tattaaacaa tttcttttct
    45841 tttttctaaa tttacatgta tggtttcata atgtcaatta atgcatcata tttttaattt
    45901 tgtaattctt gactgtgtct tttttctact tcttgcacgt tattttctaa ttcttgaatt
    45961 tcatttttta gttcttgcag ttgattgtct atttgatcta atgtatataa tgtatatctt
    46021 ttttgttcat cttgcatttc ctctagaatc aataattgtt catcttgcat ttcatctaga
    46081 atcaataatt gttcattttg catttcatct agaatcaata attgtttatt ttgtatttca
    46141 tttaaatttt gttcattttg catttcatct tgaatcaata attgttcatt ttgtatttca
    46201 tttaaatttt gttcattttg catttcatct tgaatcaata attgttcatt ttgtatttca
    46261 tttaaatttt gttcattttg catttcatct tgaatcaata attgttcatt ttgtatttca
    46321 tttaaatttt gttcattttg catttcatct tgagacatta attgttcatc ttgcattttc
    46381 tcttgaaaca ataattgttc attttgcatt ttttcttgag acattaattg ttcattttgt
    46441 attttctctt gagacaatag tttattttgc agttccttta ttattttttc attttgcttt
    46501 ttcaatttta attgtatatg ttgtaaattt attgattttt ctggtaattt tggtttttca
    46561 tctgttgtat tgttttcatt aggtgagtta tttttttcga gtagtatttc tagttcttcg
    46621 tcttttgtat tgtttttatt agttggttta tttcttttgt gtggtattgg ctttctattt
    46681 ttcataattt tagaagactt tgtattaaca cgtttgtgaa aaatttgatc agaattttca
    46741 tatgtaatag attttggtga atcataatta gtattttttt taaatgattg tgatcttttt
    46801 cgtctttgta gttctttaat aagtgcaatc cttgccttag ttttttcatc atttgaatta
    46861 gatcttattg gtgtttcaca gtttgattga tgttgaaagt ttctttcatt ttctgttgtt
    46921 agtataatat ttgatttctt atcagaattt tttgatctta attcaacagt tgtataatta
    46981 tcatcttcaa ctttaagact tgtatattgt attgtatcgt tcatatattg gagttctttt
    47041 ccagaagatt caacatcaaa acattttctt gcaattgatt ttttttttgt aacatacaac
    47101 aacacacata atactgcaaa caaaagaatc aatacactca aaacaattaa taatatatta
    47161 tatatttcca tacgatattc gtattgtttt ttatattctt ttatagcttt agcaatataa
    47221 tcagtttcag aatccattgt atctatgcaa atagataact taataatatg tataaaattt
    47281 caaaatacat aaaaacattt ttaagcttga ttacgtaaaa taacgtagtt tctatttttt
    47341 ataataatcc atatttcgac agatataatt gttattatta ttatatataa aatcacataa
    47401 ccgattattt ttagtgtata atagactata ggttttaaag tattccatag gatttcaatt
    47461 ttattaatat ttaactcaca aaagtcaata tattcactat tattatatgt ttctaaatta
    47521 actaaatagt ttacacatgt atatgatatt ttgttttctt cattaataca ataaatacca
    47581 gatgtataat ttttatttcc atatacatta atacatttat caaatgtatc atttttatca
    47641 cactttgaaa tataaatatc tttatctatc ctggtatatt catatataca attattatat
    47701 aaataaatta tattttcagt attaacaaaa tattcaatag tatgtatata attatcagat
    47761 aaatctacaa tacatttatt acaatttata tttttatcaa atttaaataa atgattaaat
    47821 cttaaagata tttttttcaa atattgtagt ttatttatat tttcaataat agatgtaaaa
    47881 ttgtatatta ttatattatc catataaatg tattcaattt ttaatgaatc aattgtatat
    47941 aaataattta ttttgttata tgataatatt atgctaaaaa tattattaaa acatgataaa
    48001 ttaaaataat ttatattact tttttctaaa tttaatactt taacattttc tgaaagtaaa
    48061 ttagaatttt gtaattcatt tacattatta tttgatattt ctaaataata tgtatcattt
    48121 actatttctg ataataattt aaaatcaaaa atatttaaac tataatttct tataactata
    48181 ccatatatgt catttatttt tacatttttg atttcattgt taaaaacaac tatattttta
    48241 tcagtatata cacaactaat taataatgac aaatatatta atttaatgtt tatcattatg
    48301 tttattaata taactattat ttcaaatatt attttctatt aatggtttaa gttttttata
    48361 attatgtata tttaataaat atatttctaa agtatgattt aatataacat tattagtatt
    48421 gtgattaaat aaaattattt caccagattt atcataacta acattatgat aaaagggtaa
    48481 tatagctggt attatattaa catatatatc gcttatattt tgtatattaa aaaatttaaa
    48541 ttcatttacg taattagata aattttcatt acaaactcta ggtgttccta caataaatat
    48601 acatatatta tttttattaa ataatttaaa caaatcatat gaagctattg ttaatattcc
    48661 tccacctaaa ctatggccta aacaaaatat tttttttggt gaaatatatg atattatatc
    48721 tatcatatct gattttatat tggaatatat ttcataaaaa ccttgatgac attttattgt
    48781 ttcatttata ttaacttggg atatttttaa atcatattca aattcattat atgtaagtgt
    48841 tcctcttatt acaaaccaca aataattatt attatctaaa atcatttttc cgattttttt
    48901 attcccaaaa tataaataat atatattacc attcattata tatgattcat ttgatatttc
    48961 tttattaaaa tttataagta gattgattaa atatttatat atttcaatat taaaattatc
    49021 tatattaaag tttgaaggat atattaattc ttcagaatat tcaatattta catctctact
    49081 taatgtttca tatatagttc tttttatatt aagtattatt ataaaaaaag caatacatat
    49141 taatataaca actactataa tccaaaatat aaatgaagta gtatacattt atatattaat
    49201 ggtattttta taaatcatat atttatattt tctttagaat ttgccaatat atacattgct
    49261 atatatttat caatatcatt aataatatca aatgtatatg tatttccact aaatttaaat
    49321 gtaatagtat ttttaataac atcaaatgta atatttcctt gagctttata tatagtatta
    49381 tttgacataa ataatgtaat aatttttaat ttattatcat tatacttttg atttatatca
    49441 ttacttggat cataagtata ggatttagat actaattcat atatacttaa aggaaaatat
    49501 ataataatta atgatattac aaaagctaca attataataa cttgtacaac aaatttaatt
    49561 accatttatc aatataataa atgaaaccat cattatcatt aataattatt actataatat
    49621 atattataac agttataata ttttgtataa ttgcattcta taaaaaaaaa gaaccaccta
    49681 tatcaccaat taatgaaaat gttaaatata taatgaatga taatgataat gatatatcaa
    49741 ttatgtcatc aaataattta tcaatagcat tatatgtagc aactaataca acagtataca
    49801 cttcaatgca aaatataaat actgcaataa caccaagacc agatattgtt ttcatttcag
    49861 aagctaatta taataatgaa gctgctgaat taaaatttaa ttcagttaga atagatgtac
    49921 caagatcaaa tattgataat cataatttat atgcacaaac tgaaattcct ggatatatta
    49981 gctattcaaa tttaaataat aatcattcat atattggcgt aaatagtgat tcaatatttt
    50041 cttatcatga taaagctaaa tctgaattat atgataaaat ttgtgataat aatggtgcat
    50101 tattatcttt tccagtaaaa attatatctg gaacatttaa agacaaatta cttagattaa
    50161 ttcatatttc acaaccaaaa ggtacaaatg gatatgaaaa tatggaatca tttaaaataa
    50221 tatattatct ttttaattat attatggaaa aatttaaaga tgatttagta ataattgctg
    50281 gtaattgtaa tataagaaat gaattaattg atcttgctat gaaaaaaact ggattaaata
    50341 aaaaatgtaa attatatcca ccaaataatt atattacaac taattatgtt aataatgtag
    50401 ttaatataaa tgctattata gttgactata aattaatatt agataaacat gtaactattt
    50461 caactcattc accttggtta tatgaaaata gatatcatta cattttacta ttaacaatac
    50521 ataatttcaa ggataaaaat tacttaagaa ataaagaata ttatagaact aaatgggcta
    50581 ttactaaaaa tggattaaaa gctaacaatt ggtcaattcc taaaaaattt atagatctgg
    50641 aaaaaccaga tgaaaaacat attagagata atgttaaatt aactgatatt gtagataata
    50701 caaaattact tcaaagataa aaatataatt tttaataaca aaataaaata aaaatataat
    50761 tgaaatatag tgtatcaaac aatataaata cattaaacat aaatttcttc taaatcttct
    50821 atatcaactg tatcatctga atcataatta gtttctatat aaatttcttc aatttttata
    50881 ggtattctag acttcataat atttctttat caattaaatc atatatatct tcaatattac
    50941 tattaaatgg atcaatattc attaattttt tataaatagt aattgattta ttttttatta
    51001 tttttatttc attgactata ttgattatat cattaacatt gtgtattgat tgtatattta
    51061 attttccttt tccaaaaaat ctaatctgtt tattattagt atttattgga tatattaatg
    51121 atgaatcaaa taaatgaaaa tcacaatata atcttagatt aaatatatca tctaaatata
    51181 tattttctaa acagtataat tcatatatta ttttaaaata taacattata tctttaattt
    51241 gattattaaa tgtatcaagt gtttcatttt tttgcttaga tacgataact tgaatatgat
    51301 tagcatatat aattattcta gatctatttt taagagatat actaatagaa ttaggtaata
    51361 ataatcttcc ttctgttatt attttatcat tatcaagttg taatattaat ttataatgtg
    51421 ttattaaatt ttttgtaata ttatcataag tattttctat ttcataatat gtattcttgt
    51481 acattttttt ataattttct gtacattgct catttaataa ttttattcta aatccttttt
    51541 tatttttttt ttttaatata tattgatcaa atgatgtttc attatttaat atatgatatt
    51601 ctattttttt agaattatac ccttcattaa ttatatttat tttaacattt ttaggttttc
    51661 ctttatatag tataggtgtt agattattta tattaataaa cataaatatt ttattacaat
    51721 ttttatcaat aatacatgat ttaatttcat ctatataatt aattttattt aattttaaat
    51781 tatcatatat attattttct aaaatatctt ttttaatatt attaaataaa ttgtattgtt
    51841 tttttccatc tatagaaaat atataattta ttatagttct tttcatagaa tttttataag
    51901 caatatcttt aatttcatac aattcattca tttttatatt tatctaaata ttcacaattt
    51961 attcatatat agattttgtt atataaacta atttatcgtc ttttataaaa aatttatata
    52021 tattgttctc atctaatatg agtttagcta taggtatatt attactatat attattccag
    52081 tttttttatc taaatatcca ttataaataa tatttaaatt atcttcacta caataatata
    52141 ttggactaac tataattttt gttataacat tattttcatt aacatcatca attttagtat
    52201 gtcttatatt attaaaaata tattcatttt ctacaggttc agcatattta tatttagaat
    52261 gtatttgttc aatagatatt actttcataa aactatttaa aacatttatt ttatcttgct
    52321 tacttttaat taaatcaaat atttctttat ccacagattt gccatcaata gtggaagcta
    52381 taataaaatg cacattaaca tatctttttt caattggtaa ttcttcatgt gaatttaatc
    52441 taatagaacg accaataatt tgtttaatat cagattcttt ccagggtaaa tctaatatta
    52501 ttatatcatt gattgatgaa aatgaaattc cttcagatcc agcagcagaa aatatacaaa
    52561 ctttaatttt attaccatac aaattatcat atttattaaa tatatcaata ttataatctc
    52621 ttgtagattc agttttacta gaatattcaa catatgaaat attaaatata ttaaaatata
    52681 tttttaatgt agaaattcct tcaaatgata ctaatggttc atataataat actttaccat
    52741 tagaatttaa tataatttta catgcttcta tatatttaca tgaatattgt tttattttat
    52801 caaatatttc tatttcacta gatttagcat tagaaaatga atcattgttt ctaaatatat
    52861 caataaattc attagaaaat ttaaaattac caataataga tttaaattca tttaattttt
    52921 ctgataccat tttattatat tcaatttgtg acatcgatcc tttaattttt atatcataaa
    52981 aagcaaatga tgatactaat cgtctcattg tttttaaacc acctaaagct gatttcttat
    53041 catgtttatc agcaatatta aatatattac tttgttctgg tgtcattgtt acattatggt
    53101 aaaatatatt cttagatgca aaaccttctg tatatgatgt attagtaaaa ctatctgctt
    53161 cagatatttt ttgatacgat gttatagata ttaatccatt ttttaattgt tcatggtttt
    53221 ttaatgtatt atttacaata aaatcttctt taaattctat aattttaggt ctaagtaaat
    53281 ttattaaata tttaaattct aatacattat tagtaatagg agtagcagac atacataata
    53341 atttattatt ttcagaattt gctaatttaa ctattttatt gaaaattgat aaaaaatttc
    53401 gttgagtaga tgatgatttt tcaatagttc tagatattac ttgatgaact tcgtcaatta
    53461 ttattaatat cctattttta gtattaattg aactaataat tgttctatat aatacattaa
    53521 attgtttaag actagaagat gaatcatata atacaaattt aatattttgg cctttcatac
    53581 caagttttga taatgtattt aaccatggat caacatataa cgatttcttg ataaaaataa
    53641 caaaaaacca ttgtggaaaa acaagtttta agtgtttcat tatataaaca cttgttaatg
    53701 ttttaccata acccgtatcc caaaataaca ataaactatt taattcagaa agtcctataa
    53761 atattctgga tactaaatat tgataatctt ttagtattat aatctcattg gtaatttcat
    53821 tatttattga tttaggcaga tcttttgttt tttcaagtgc ataattaaaa tgacgtgcaa
    53881 caatgtgttc aattgaatgc atttattata ttcatcattt tgattttttt tgtgccatca
    53941 aataataacc ttctaattgt gaatcaccta acctattttg taattcacga gttaaagctt
    54001 gagatgagga actttcttta gtattatatt tttgagtatt tgatgtacta tattgttcgt
    54061 cacgactaac taaatataaa ttatcactag ttgcattaaa ataattattt ttttcaattg
    54121 atgacatgga tctttcaata aaagattgat tatatttaga cattattaat gagattcaaa
    54181 atttaatttt tgagattcta atgtaatata atatattttt atttttatta tattttttca
    54241 tatattattt ttttattaaa aagttattta ttgttattaa atcattgtca agtttaacgt
    54301 tataattatt tgaaaaatat ttaataatag attgattatt atctataaca gatactgtag
    54361 taaaatctga tgataaaaat gtagatgctg atttatcaat atatatttta taattattta
    54421 tattaatagt atcattatca acagttatat tatttccact aatgtgatgt atttttgata
    54481 tagttgttaa atatttatat aaaattataa tactagtgtc attatgtatt attgcaatat
    54541 tatctttaat ataagtgtta atattatctg ttaaatttac atcaacagtt attatattat
    54601 atccacattg tatatataat ttatttaaat acatatatgc taaatgttcg gataatgttg
    54661 aaataattaa atttttatta tatttaaaaa tatattcttt aggtttaaaa atactaaaat
    54721 ctgacctatt tattaattta atagtagtat cagttattat aggattacta tattttatta
    54781 tattttgtaa ataattatgt ggtattaatg atgcataata ttttattatt ttagctgatt
    54841 taattatatc attataatta tttttattat aatatttaga tatggacaat gaattgttaa
    54901 atatcaaatt tgctatgtag catattaata aataattatt ataagcattt tcttgtttta
    54961 taggtataat attaagatat tttgttattt tgtaaatata ttttgtacta aattttttaa
    55021 gtgatttttt atttattata tcattatcaa atattatatt attattatta aaaatatgaa
    55081 gtaggacata aatatctaga tgtttaatta tattcaattc attaagttta tatttacttt
    55141 taatatatct atcactagat aatccaacta atctatggat cataaataca taaaatgcat
    55201 tttcaatgtt atctatttga atagtttcac tttttaaata aaaatattca tttaattctg
    55261 tattattata tatatataat attgaaatta ataaaattgg atttatatta ttatttttaa
    55321 taatagatat catagatggt atcatatttt ttatagtttc atcattataa tatatagaat
    55381 aatatgaata atatgatctc aatatatcat atattctatt tggatgatct tttaattcat
    55441 caggtttttt taaccattga ttaacaaatc gatcaagtga ttctattgct aatatattta
    55501 atttatcttt atttgaaaaa aaatatgctt ttaatgatga tagtgatttg ttctgtgggt
    55561 tttcataaaa agttatatat aatataacta ttactattat tattgatatt aatatataat
    55621 ataatatata tatgatattt ttcatttatt acatataaat gagtaaacag gaagttacga
    55681 atgtttatga agatatggaa ataactaaat taaataatgg cattaaaata atttataaac
    55741 caaattacga aaataatatg tcaataggat ttttagaatt tggacacaat gtagaattta
    55801 gttataaaaa aataggtatt gtacatttta tagaacatat tatatcttat atattacaaa
    55861 aaatattaaa acaaaatgta tcagcattta cttcatttca agaaatgtat attaattttg
    55921 aaaaatttga tattattaat cctaatatac ttgataaaat aattgattta ttatttttaa
    55981 ataataaaat acacatagac ggtaaatatt taacaaaata tgatataaaa tatataagac
    56041 atcatataaa taatgaaatg gaatacagga ctattaataa ttattcacgt ggatttttat
    56101 ttatttattt attatcagga tatgactatg caggtggaac agggtttgat attaaatatg
    56161 atatagtatt atttaataaa ttattatcac ttatttctac taaaaatatg gtttttattt
    56221 cttctgataa aaatgtatat aattatttaa tatcaaaact aagatctatc aaaaaaagtc
    56281 ctaaatctaa aatcattata cgatataatt tacctaaaca acaaattaaa aatgcacaat
    56341 caacattatt agtatcaatt actgaattat attatactgc tacaattttt atacctatgg
    56401 ataaatcatc actaatagga gcatttataa tgtgtaattt tttatttaat gattttatga
    56461 tgaatacttt taacgataaa attgcaattt caatatataa acatactatg aataatttaa
    56521 tagcagtatt aactttttta aaaaaaaaag aaaatttata tgaattagtt atagataaaa
    56581 atgatgtata tatattttat caatgtatat tatacaatga ttatatagat acttttaata
    56641 tttttgatat actttctaaa accaattcat gtgaatattt taaaaatgat atacaacata
    56701 ctttagattt aattgttaat agttataata aatatgattc atttttttta aatataccat
    56761 ttttcaataa atataatttg tataatgata aaactatttt agattataac atatttaaaa
    56821 ctgaagtagt attaaatatt cccaattttg cattagataa atttacatct actatttata
    56881 aaataccatt acaattatta atgaaagatt ttaccaatga tacaaatgtt tgtttttttt
    56941 tattttcaga ttgttcttat caattaacaa aagatggtat aataatgcaa aattttaaaa
    57001 atgtatatat tgataataaa tattatattt tacatcactc attttacttt gataaaatac
    57061 ctatatcaat atatttaaaa tatatattat tattcttatt aacaaatatt ttttcatcat
    57121 tgtatgatat aattacatat tatcattata ttaaaatatt atattataat tcaaattatg
    57181 taactataaa ttcatttaga tctaatattc atttagatag taaaataata aatattaaaa
    57241 cagaatataa ttttatagta tgtttaatta atattgaaat atcaaatttt aaaaatatta
    57301 attttttaat aaatgaaata tcacatacat taatttctaa atttttaata tatctagtaa
    57361 aatatcatat aataaataat tttttagttg ctgaagctat aacaaataat ccaaataaat
    57421 ctagcaaaat atgtcaaaaa atatttgcaa aacataaaat acaaaattat ataatagtag
    57481 tatcaaataa atcaaaaact ataaatgtag atgaattaat aaaaagcaaa gtaattatgt
    57541 ataaatagct agtcataaca aattgtataa cttctattat tattactaca tcttctatat
    57601 gttcctcgac tatcacgtcc agttacacat tgacttggtg gatacatatc acatggatta
    57661 atatttgatg gatttgtgct atataatcca gcactatatg atctacttcc atatccatta
    57721 ttatatccta atgaatatga agttgttcct gaaccatttg ttgttcctga accatttgtt
    57781 gttccattgc atgcacatgg attagatgta gtttcaccta aatcagccaa atttgaagtt
    57841 ggtacaccaa ctgctgctga aactcgtgtt cttaacggaa cactatatga tacagacatt
    57901 tgtttttcag tattaatact tggtccacta tacgtactat aactcattta taagtattat
    57961 taatattatt attagaagat ccatatgtgt ttaataatgt taaatctaat tcatttttaa
    58021 aatttttatt atcaattaaa ctacttattt tatcatattt tactcctgta catttaagta
    58081 ttaattgtcc taatcgtgaa tgcatatctc ttaaaaaaat atataaatca tatatattat
    58141 tttcataatc attttcaggt ataattttat gtaatttttc aattaaacta aataacgatt
    58201 tatccattta tatcataaat taattataaa aatattttta tttttttaat aatttttcaa
    58261 atttacgttc tgattgatcc atttttataa tattttctat tctatcatat gcatttacta
    58321 attttattaa acaatctttt ggtaatccat gagtacgtaa aactacacac atattttctt
    58381 tatcaatttt aatatttaat cctatatctt ttgctatatt tgatacagtt attccatttt
    58441 ttccaataat cttacctata acttcttgat aaatacttat atatatacac attgatgttt
    58501 ctttatttat atcaattatt tgagaatatg gtttataaat taatgatatt ccattatttg
    58561 attcttgttc catattttat tttatattca ttattattaa tatattattt catacagtat
    58621 tagttattat caacaattac atcaagtgct gtttgacatg gattatttgc ctcaaaatat
    58681 ccactaaatc ctaataaatt atacatatct aatccacaag aaacacttgt atatgcgttt
    58741 tttaatattg tatattgaca aaattgttgt gcactaacat caatttcaga tgctttttta
    58801 aattgccaag gaccaccatc accacgtaaa ataaatgttg gtaatgcagt agttgaatct
    58861 aatttaactg cagcataata agaaccaaaa tcataacaat taaattcaaa tgctgatgat
    58921 ggtaattgta atattttagc ttttcctcta gttatttcaa ttgcagtttt ttctgttatt
    58981 gatttaatcc aacttccaat attattttta attcttttaa atttttccaa ttgtattaat
    59041 ggatcccatt tatatgtttg aataacaaaa aataatgttg atattattat aaatattata
    59101 gctaaaatat atgacatata tcctttgtaa tttttaaatt gtgttgagtg ttgtgtataa
    59161 taatctatat tattttcacc aatttcaatt attgaactgt tcatttaatg aaatatgagt
    59221 ttatgaaaat aaaaaaatat attatgtcat ttttaattga atcagaatgg caaaatatta
    59281 aatctaatat aataaaagta aaagataaaa atgtaacaaa atataatatt aataatatta
    59341 ttaataatat aaaaaaaaat gattatacta aacaatgttt tattaatgaa ttaatgttat
    59401 ttcttaaaaa tggattaaaa tataataaat gtactattac tgaacatgaa tgggttaaat
    59461 attataaaca attattatac gatgaaaaat taatatcatc tttgcctcaa attattgatt
    59521 ttgatggatt agataatatt aatatttttg aattaaacat tcttatggaa aaatgtaaat
    59581 taattcaata tgatataaat ttacaaacaa aacttttaaa tttatttaat gaatgttgga
    59641 aatataaaaa aataccagat gagtggttaa tatctaaaat taaatcaata cataaaaatg
    59701 gagataaaaa tatttgtaat aattatagag gtataaattt aataaattgg gcatgtaaat
    59761 tgtattcaaa aattttaaat aatagattaa aaccaataat ggaaaattta atttcagaag
    59821 aacaatccgg ttttagaaaa aatagatcta ttaaagataa tatatatata ctacatgaaa
    59881 taattagaaa tagaaaaaag gaaacatatt ttgcatttat tgattttaaa aaagcatttg
    59941 ataatgttga tagagaaatt ttatggaata taatgcattt acatggttat ccaccacatt
    60001 taattaatgc tattaaaagt ttatatgaaa atactagaat tattgtaaaa tcaaaagtaa
    60061 taaaaataaa taaaggaatt aaacaaggat gtgctgtttc actttcatta tttaatattt
    60121 atatcgatca tattatgaat gaatggaaac aacataatat taaaggtata gaattaaatg
    60181 ataatacaaa tttaaattat attttatatg cagatgattt agtaattata tctacaaata
    60241 aaaatgattt tatacatgga atagatatgt taaataattt atcaaaaaaa tataaattac
    60301 cgatatcttt tgaaaaaact aaagttatgg cgtttaaagg aactgaaact ataaatattg
    60361 aaatatatat agatgataat ctaatacaac aagttgattg ttttacttat ttaggatatg
    60421 aaatttcata tacaaataaa ataaatttat tatataaatt aaatcaattt gataaaatat
    60481 gtaatttaat aattaattca ttaaaagata aagttgatat aaaaataata atacatgttt
    60541 ataaaatttt agcagtacca atattcacat caagatttat attttatgaa ttatcatctg
    60601 aagaagaaaa tataattaca cgacatgaaa tgcatttttt aaaaaatatt ttagatttta
    60661 atttagaaga tgatattatt agacaaatat tagatgtata caaattagta gataaaatta
    60721 atgaatctaa atataaatgg aaagaacgtt tatcttctat ggactatgat agacttccaa
    60781 tgaaaattgt taatttccat tagttgtagc attatttcca ttagttgtag cattatttcc
    60841 attagttgta gcattatttc cattagttgt agtattatta attttttcta taatatctga
    60901 taatttaata acttccatag tagcatcatc atctattaaa tttacattag cattttcata
    60961 attattatct aattcagaaa tatctatttc actccaatta atattagata aatcatatcc
    61021 taatgattta atgttttcaa atatatttaa acttaattta tcattataca tattgttata
    61081 tttatttttt ctatttttat tataaattgt tgcatataaa actaatttat atgatggcat
    61141 tgcattttct aataatctaa ttccaaatct aacaccatat ggacataatc gtttatctaa
    61201 tactataaat gaagattgta caactttttg attattatca acatatgata ttgcaccatc
    61261 ataacatgat gatactattt ctttaatatc aaatattgtt tctaaagctg attgtataaa
    61321 tttactatta atacctaatt gaccactaat aataaatttt ttatcattaa tataattagt
    61381 tttaaaaata ttaaatattt tacataatat tgtataataa tctttatcaa caaaatttaa
    61441 agctatatat gatatattta taattattat ttcttccatt ttaaacatta tattagaaat
    61501 aattattgaa ttacgtacag gtatattatt tgtatatcct gtatcataat cagaaattaa
    61561 aaattttaat aatatttctt catcatttaa acattttata ttactatcat ttgctctaac
    61621 acatatccaa ttatttctac cacttattgc aacataccaa cccccaaata tccaatatat
    61681 taatttattt gaaaaattat tgattggtaa ggtattgcta gatatattat accaatcatt
    61741 gacaattact ttttctacat aattagataa aaatacaaat gttggaatta tttttaaatt
    61801 attaaatgca ctaaaaaaat tattatctaa cacttcttga tacatacttg cattgattac
    61861 cataaagtct acaatagatg tattatcaaa attatcatta gtaaatttag aaactgataa
    61921 atttacataa taaaatataa ataatataat aataataata attagcacta ttactacaaa
    61981 atatacacca ttcatttact ttattcaaaa ataacaaaaa tagtcttata atataaatgg
    62041 attatataga aacttttata aatcctcaag ttatattttt atataatgaa aataagaaaa
    62101 taattaaaac aatatttcta tcaaaagatt caatgataga agatagtcat gtaatgacag
    62161 tctataatta tttattatca tctcatagtg atatatttga aaataaacca caatttatta
    62221 atgatcatgt tatattaaca tttacattag aacaagcaag aggatatatt aaaaatatat
    62281 taggattatc tgatgatata atattatttt caatatggaa taattttgat tattatttaa
    62341 aaaatggaat atttgatcca tataatatac aaaatatgtt attagttgaa ccaaatgatg
    62401 ataaaagtat attatataat atatatcaaa atattgtaga aggtgctgta ttttgtgtaa
    62461 ctacaaataa aaatatagga tctcaattag ctagatctaa tgtatattct agtgtatata
    62521 gagattatat ttcagaaatt attaataata tatacaaaaa tagatatgca atgaaatctt
    62581 caataataga tgcaatggaa tattctataa atattgattt tcaagattta cttagaatat
    62641 ctaatatacc agattataat aaaacattat gtatttcagc atataataat ttttatataa
    62701 aaggaaataa aataactata ttggataatt ttgattcaat gtatgaatca aaatatttaa
    62761 aaatatatga taaaaatata aatattaata tttatgatga tgtattatac gttaaaaaat
    62821 taagtgattt tactgatata cttaacaagt ataatattaa aagtataaat attaaatcac
    62881 tcaaaccaaa aacaacaatt tatgtttatt ttaatacatt tttaaatcca aatttaacta
    62941 tagaatttga ttttgatttt tttattaatg atactaaaaa aacaaaaaac atatttattg
    63001 atttaactgg taaaattaat ataatgacat cacaatctca tatttcttat agatcatata
    63061 atatttcaac agatttagca aaatatttta cattatttat tttaggatat tcacatatat
    63121 ttaataaagt acaatctaaa gccaaaataa aaaaaattga tgaattatat ccatctagat
    63181 attgtcaaaa ttataaagat attaaacgtc aaccaatatt aattgatcat attgatgaat
    63241 ctagattaat aaaaatatct gataattttt atactggtaa agaagatagc actaaaacat
    63301 atcaacgtaa aggaacaaaa aaagtatatg atccattaaa acatggtgat gtatatattg
    63361 atagtaatgg tttaaaatat caatgttcta gtatatatta ttcaaacatg ggatttttag
    63421 gaaatatata ttcagctact ggaatttgtt atccatgttg ttattctaaa cctaaaatta
    63481 gagatacaat atttaatact tgtgtacatg gaacaaaatt tatacatgaa gaaaaaatta
    63541 atccaataat tgtaaattat ggaagattaa tattaaatcc atcaaatcta tcaaatttac
    63601 catataaatt gaatttatta ttaaatagca aaaatcaaat acgtattgtc aaacatacta
    63661 atagaataat tttggcaaaa aattatactg ttattatggc atatcaaccc agtacaataa
    63721 taaaagattt taatgaaatg tataatttta taattgaaaa taatgctatt ttatttaatg
    63781 ataatatgat gtacactcat aaagatatta ttgaaaataa taatataaca ccttcaatat
    63841 ttatattaat tcaaaatagg atacatcaat ttaaaaatat taataaagaa caagataatg
    63901 ataatataac agtatctatt gttgattcta ataaaattaa tttaataaaa aataaatttt
    63961 ctgtattaaa taatattact aaagaaatat cagaaaatgg tataactgtt aaaaatggaa
    64021 aatgctatat agatggtgaa ttagtaaaaa ataaaaatat aacatatttt acaaaatttt
    64081 caaatataac aattagacct aaaagtatta gtgaatatat attaaaatat tttaaaaaat
    64141 atatagatga caatatatat acagataatt attttttatt taataaaata ttcgttacta
    64201 atatattaaa tataatgcat gaaaatgatg ctatattaaa tgattttagt gttatacaaa
    64261 aaaaacttga tgatatgtct agtgactata tagttacaca atctaaaaca tataattaat
    64321 catctaacat tatatcttca tcactttcat tattattatc attacttatt actggaaatt
    64381 tatattcatt tttaaaaatt tctaatgtgt aattaatata tgatatttta ttatgagatt
    64441 tttttataca cattttactt aaatagttta tcatttcttt aatattttca tcaattaaga
    64501 aatgcatttt atatgataat aattgcaatg ctatataaat ataattttca atttttttat
    64561 atattttaaa atgagtaggt atatttttaa tttttaaatt tatattttgt tgcaaattga
    64621 atataaatat tcgtccaatt atatcatata aaacatcata aaatttaaaa aagttttgtt
    64681 gattatgcaa agttaatata taacaccatc ctttaattag atatgatata ttatttctca
    64741 tattatcata atctatatta ttattttcta tttgacttgc taaatttaca attgatgata
    64801 tttttttata tttaatatct attttaaaaa tatatttaca tccaaaatta gatagtataa
    64861 tattatctaa agataagtaa tataatgaaa tataacatgg taataatgtt ttaattttaa
    64921 attgtgataa tttatttaaa ttaacagtta aaaatctatg tactttaaat ttagttttat
    64981 tatctattaa agataataat ttagtaatat tggaaaatat atttttatac tctaatggat
    65041 aatcagtata tgcaatataa tctttacaat cttcttcata aattatacat tcatttgaac
    65101 attcagtatt aaattcacta atatttatgg atttttcaaa caaatttaat atatccatat
    65161 ttatttttta ttatatacct tttcaaaaaa aagatatttt aatataaata ataaaacaat
    65221 attataaatg gatattattg aaaattgcaa atattgcggt tcatttgata ttgaaaaagt
    65281 taaagatata tacacatgtg gtgattgtac acaaacatat acaacatcat caaaaagatt
    65341 atcaactaaa agtaaaccat ttaataataa aaaaatgcat ttttcaaatg ttatgcgtca
    65401 aatgagttat aatataatta ttgataaaaa ttatgaagaa tttgaagaac tgttagcaaa
    65461 aaataattta gaaagacgta gccttacaac tactatagta tatgaatttt taaaagataa
    65521 aggaattaaa aattatagac aaacttttgc tttaatgaat aaatcatctg attcaatggt
    65581 atcattaaat gcagatgata caataacaaa tatatctatt ttatttgaag attttattaa
    65641 atttttatat aaaaatggat ataaaagaac tatatcatat ggatttatta tagatagaat
    65701 gcttgaagta ttaaatataa cttcaaatct caaacctaat tatactaaat caaacaaacg
    65761 agatgataaa tctgaattat ggaataatta cgttattgat ttatgtaata gacctaaaac
    65821 aaaaacaatt ccatttatat ttattccaaa taataaaata gaaaatgaat attatttttt
    65881 ataactttta tatttaaaaa tatatacttt aaataaattc attaattcta atacttgatt
    65941 atcttttgta ttttgattta atatattttt ataaaatact gatgttgctt ttcttggaaa
    66001 taaactattg gtttttaata ctagcattgc atcattatta tatatatctt taaattcaaa
    66061 catatcatct aaaataaaat tatatttatt aaaatcttcg attattgtat cataaattaa
    66121 atattcttcc aaccaagtag tcattgttgc atcatataat actttaattt tatcatcatt
    66181 tactttagat atattataat atatattatc ttgtatttta tattttatat tttgattatt
    66241 tattaataaa ttttttattt tattaccatt taaacatgtt attataactt tagtaccatc
    66301 tgttgataaa ttttttaaaa tatttaatat tttattttta gtgtctacat tatatgaata
    66361 atgtatagcc atttgccatt caattaaacc aaaatatttt attttttgtt gagtcatata
    66421 tgttgatttt actttattaa gataatcatg atctaatata gatatattta atgatgaaaa
    66481 tttataaact gttgagttta ctctttttct agtttgtaaa ctattatatc gttcttgtgc
    66541 ttcagataat gcagaaatat ctggatcagt tcctaacatt cctgaaatgc caatataata
    66601 atatttatta atatcaccac ctctaccaat atctatcgat aaaacatgtc tatttgggat
    66661 ttccgcacat aatttagatg ccgctattga tatagcttca gttttaatta aatttgtaaa
    66721 tatatttaat ggtggtcttt gttgttgatt attttcaatt ggttctttaa aatatttttc
    66781 aacattttga tttaaaatta aatttttctt atcatatatt tcattattaa ttttaaacat
    66841 agtgtataaa taatctatac ctacagtatc taatggaaca tatttttcgt ggaaggtttt
    66901 tgaatctaat attactttta atgaattacc ataataattt gatttaaaaa atttagtagt
    66961 tttatctaat ctaatattta caatttttga ttttaaaaat gaatattcaa caatacaaca
    67021 tagtggtgca tataatatat ttttaccata tctattatgt atatttttaa attttaacat
    67081 attaatatca ttgtcataag ttattaaatc attagatttc atttcaactt taagtagttc
    67141 tgtaatattt ttttcatcat tcatatataa attaaatgtc atatatattc cgtctttatg
    67201 tattttattc ggacttttat gagtatttaa acttgcaata acatctacag tattatctat
    67261 ttttaattta taatcaatat tactttcttt atctaataat ataacaccat ctgtaatttt
    67321 ctcatctaaa gatttataat acgctatagc ttcatttaca atatcttttt caataggaat
    67381 aattggttta tgtttaaatg taatatcaaa ttccttattt tttatattat cattataaaa
    67441 ttttatcatt tcatatctag tattatattt ttgtttagaa tcagtactat atatttcagt
    67501 aaatacaaat gggtatattg ttttaacatt atctattttt ttatattcac caaatccttt
    67561 cataactata tgattaggta tatttgtttg tttattttta aatataaaat tatataatac
    67621 tatatcacat ataccatttt ttacagtaaa ttgaacaact tctccatcaa ttttagatgt
    67681 taaaaaatat tttgatttat ccattaaata taatgaatca aatggaagca taaatgtttt
    67741 aacactaggt gaaatatttt ttgtacttaa tgcaaaatta tttaaattat ttatagaata
    67801 tatatatcta aatgcattag taatatctct gtaaaattca tcttttgata atttatttaa
    67861 tatttctatt tctatataat aagatgtaaa ttgtttatat gttaatacat tattaagata
    67921 tgtttgtagc atcattttat tattatcagc tgcacctaat gtgcctttta atttaaattc
    67981 aacacgtaca tttccattaa ttataaaata aatagaagat aatatatgta ttgtaacatt
    68041 tgacattatt aattttttcg gaggaataat catattattt tttatattat cttcttcagt
    68101 attatgtgca ataataaatt tttcattacc tatattttct tctattttat ttattaattt
    68161 ttttattgtc cattgatttg ttaatttttg tatcatataa gtatttgtta tttcaaaatt
    68221 aggataatca tattcatgcc tttgacgtaa tttaattgat ttatcaacat attttataat
    68281 atattctaat tgaagttttt ttttagtttc agtgtatgaa gctatattag ataataataa
    68341 taaattatca aataaataag taagttcaat ttcgttatgt acattatcta ctggattatg
    68401 tgtactataa aactgccaaa acttatcaat aatactatta atattaaact ccatttatta
    68461 tataaatgat atattgctat attttattag cagtatttat agtatttatt cttatgctat
    68521 atttttcata tacaatttca tatcttccat tatatatacc aaatgaaatt gtaaaacaag
    68581 gcggaactat tgatatttca gaatttattg aattacaaga agaacaaata aaatatgaag
    68641 gattaataaa tgatttacaa aatagtatat attcatctaa tgaaataata aataaatata
    68701 ataatactat agatatacaa gaaactacta ttgaaacatt aaaaaatact ttaagacaac
    68761 tagaagaagt tattgatcaa caacaaaata tacaagaacg tttatataga ttacaagata
    68821 caatccagcc attagtaaca ctaatgttaa ttgaacgtca aataaaaata tatatatata
    68881 ataaaattaa atatgattta tcattaatta ttatattatc aagattttta ccaatatcac
    68941 cattataatt attttctttc atcaacaata tgtacattaa ttatattatt atcatatgtt
    69001 acttttttta caattgtcat accaataatc atgtattgtt taaataaact tctaggatca
    69061 gtatcaggat aatgtttcca attaatacat atactaattc ttctaaaatt tttatcatta
    69121 tctgcaatta atctagatgg ttcacttaat aatatactat gttgattaaa tctatgaata
    69181 aatattgaag gatatgattc atcattaatt ggtgtaactg gatatacaca attagaattt
    69241 aaataaaatt cgtaatttgg tctatcacta ttaatatcat gaattgtttc attagaatta
    69301 gttttcaatg tactagtaaa tattcctaaa tctttagata taaaatccat tccaaatata
    69361 aaattatcat aaacaataac atccatttct ttcattttgt ctgaacgtaa atcaccagtt
    69421 gatgtatttt cttctgcatt ccatatttca ataggaatac ttacatctga tattgatata
    69481 tcatgtttta catctataaa ataaattcta tcttcttttt ctagatattc acctaaaata
    69541 tatttaaatt tgttagaaat attatattca tcatttttat tacgtctact gaatgataaa
    69601 atatttttat gataatataa tttcatgcct tcaggaattc ctttaatatt aattatacat
    69661 tgattattca catcatgctt aacaacatcg aatggtttaa tttctacaaa tttacatttt
    69721 ttattatcaa attttcgttt tgcataaaaa ttattattaa aatcaactat aagcaaatct
    69781 tgcaatattt tatcaacata agatttaata aaactttctt cagtttctgg ataatttgga
    69841 tatgaaatga atgattttcc attaaaatta tctactttaa tactccataa tacattagta
    69901 attgatgaaa aatctggtgt ataatatatt tttttattac aattagtagt acaattatct
    69961 tgtgttagaa ctaattcttc taaaaatcta tttttgattt cagatcctgt agtgttatat
    70021 ccagtaaatg aaatatatgg ttgtaaatca atatttgtta tatttttcaa actattttta
    70081 agatatattt tatcataaac cattacattt ttaaaatctg ttaattttaa tttaatttgt
    70141 aatttggttt ttggaaataa tctaagacaa gtatgtggat taataaattg attatcaaat
    70201 atagtaatta atggaaaata tatttctctt gatgtaaata taatatcatc agcagtataa
    70261 cctgtattaa atgaacataa atcaatatta ttaccaataa tttttgaata tttactacct
    70321 gatctattga attcaaatag taattctagg cctgattttt taataattgt attaactgtt
    70381 gaatcattat caatagtttc aattacaaat tcttctatta atttatatac aaaatttgat
    70441 tgatatctaa tagaaccaat gcctttaatt tctggtaaag ttattattaa tccaaaatta
    70501 ttacatcctt ctagtttact atcagttatt ttatatataa gatatccatt ttcatataca
    70561 cttgaagatg atgtaaactg ataaggaata ttataatttc cttcattgca ttgtaatgta
    70621 taaatattta atctactgga attactatta tcatataata taagtgatct gttcatttaa
    70681 taatataaaa aatataatca atgattaaaa taataaaaat atatttatta ccattattgc
    70741 acaaatcatt acattataaa ttaacaaaat tagtatctaa acgtataatt tataaattgc
    70801 gaaataagtg tgaaatagat gatatagaaa acttagattg cttattttat acacatgtta
    70861 taaaaataaa taatagttat tattatgtat ataataatta tcatttaatt tcatttaccg
    70921 ttgatactaa taataaacaa gatttgtata ataaattaaa aacatttgat ttttgctatc
    70981 ataataatct taatgaagaa atgatgaaag cttactgcca agtaaataat atattatgaa
    71041 taatatcctt ttaaattttt tattgcactt tctttaactt taccatctaa ataatttagt
    71101 atacatatta aaaatattga taataaaatt ataataaaaa aatattcttt catttaatta
    71161 taataattct tataaattat ggaaaatatc tataataaat ttgtaaaatc aatgtttgat
    71221 attctagaaa gtaataaaga taaaattaat attgctttag atgaaattga ttatgaacaa
    71281 gatagtgtgt tattagatag agtaatactt acaaataatt taattaaaaa ttttgcaaca
    71341 tatgacaata atcaatggga aaattcatta aaatatatac cattaagtac attttctttt
    71401 tataataatt ataaaggtga tattaaatat atttataatt ttggaacttc tgaacaaaaa
    71461 aaagaaatgt tagaaaatta taaacaatta gtgtataaat tgtatggtaa aagattaaca
    71521 aaagaaataa taaatactgg aagaaatata attaatgaat cagataaagt aaattttgaa
    71581 atatctgaat taattaaaga atcatcaaat tataaaaatc ctacatttat tgcacatctt
    71641 attgatttga tagtatataa tgacgaaata agaaataatt ttattaattc taatccttta
    71701 tttgaaaaat tgaatgaaat agatattgaa tcaacaataa gacaattaat tataagtata
    71761 atgaatatac agataacatc agtttcgtat atgcaatcta tgtctgatgt aacctcaaca
    71821 tatataaagg aattatttaa taattctaaa ttattatcgc atattatgga tgaatttaaa
    71881 tcagatacat ctagtaatta taattgtgga tgtaatgaaa tattatgtaa taatatgtta
    71941 aaatgtaata aaatatatga tgatattaaa attgtagaaa aagatccatc attatataga
    72001 ccgtcacata ttaaaaaaca tattagacat gtaatactta aaattataaa tatattgtat
    72061 attatgaatc agacacaaat gttacataat aaaaagattg aattatttga atatattaaa
    72121 caaataagtg aatcaaatga tgactttata gaattattag ataaattaaa tatcaatagt
    72181 acaacgcaaa tgaaatggtc agaattgata attaaaatat atgaaaatag agatataatt
    72241 tttgatatta caaataagta taaagaacca ttttttaatt ctattattga gtatattaat
    72301 aaaaatgaac aaattaatga tgaattaaaa tctacaataa tagaatttat taaagaacat
    72361 attgagacaa ttgatttaga tgaatgtaaa gaatatataa aaaatattga tatcaataca
    72421 ccaaatatat caagagtaat tgatactatt gaaaaatatt taagtgtacc actaaaaaaa
    72481 caattatata aaagaatata taaatgaatt attgggaaag taaatctata tgtactgtat
    72541 tcacaaaata caatgacaca gaaataatta ataaaattga tccagttaaa tcaaacattg
    72601 atcattcatt atataaacaa tatacaattg gatatatgtc aaatttcaat attgtaaata
    72661 tttgtaaatt tgtcaataaa cattcaaatt atatatttga tatagataca ttttcttggt
    72721 tagtattaaa tccattttct gatccatcat ttaatattgt attgtatgat aatgataaaa
    72781 tagttgcaac tattgtagga atattaagat ctataaaaat taaaaatgaa atacataaaa
    72841 taatacatac tactttttta actgttgacg aaaattatag gaaacaagga atacattttt
    72901 acataattga taaattaatg gaaaatgcat ttaataaagg tgtattatta ggaatatttt
    72961 caacaatgaa aaaaataaaa aaaataaaat gtgttaatgt tcaagataca tatattataa
    73021 aatctgattc taaaaaatat aaagaaaata ataatgtatt tgattataaa aaattaaatc
    73081 aaaaaaatga tgatttatat tttatatata atgatatgga aattgaatat tggtttaata
    73141 aaaaatattg tcatataata tctatatata ataatttatt ttgtttttta aaaataaaat
    73201 ataaaaacaa tgaaaattta aatattttaa ttgaacaata tatacataac aaaaatatta
    73261 ataaatattc aataccaaat aatagtataa tgttttcaca atatatacaa ttgcctcaaa
    73321 taaaattaca aaatcaaata tatacttata tatataattt aaactttaat aatcttaaat
    73381 gtaatatttg tatgttttaa cccaattcaa ctgcattatt atcactactt acaacattat
    73441 caacatcata attatcttct gtatcattat gattagcaac atttacacca gataattgac
    73501 atttattgta tgaatgtgga tgtgtatgtc cacatgatga ccatgaatga tgatgatgga
    73561 aagtatttgc atgattatgt gaatgtgaat gtgttaataa atgtgaatgt tgatgtgaat
    73621 gtggataacc atcagcccaa ggccaatatg gttttctaca tcttttcaat ggcaatttta
    73681 cacaagtaca gccttttgga catctattaa aaaacaattt tctgcatggt cttacacaaa
    73741 cacagccttt tggacatcta ttatatggcc atggccatgg ataaggataa ggcaaaattg
    73801 tttgatgtgt atcttcatct acaactggat tttcattact atctaatgga acatcatcaa
    73861 ctgttgatcc agatctaata aatgctgaaa aatcacatga attgaatgtt gttaatttaa
    73921 ttagtttaca tatatcattt ttctgtgata aaaattgtgt actatttcta aatcgtctaa
    73981 ttggactatt ttcactatca tgcaacaata aaccacctgg accatttttt tccataaatt
    74041 ctagaattga tgaaataact gattcactaa tatcattatc accaatattt ccaaatgaac
    74101 cagttccact aattacaact ttatttgtta catcattact attttgactg ccaagtaatt
    74161 cagcaattaa attaagtggt gttgttgctg aatttgcaac acttgaacca atgtcattag
    74221 attcagtttg attaacattt gataattcag aaattatcaa taatggtttt tgatatgcac
    74281 gatctttcat taatgctgca catccagttt tacgccaatt tttaataaat tctttaatta
    74341 aaccacgttg tttgcaatat ggcaataatt gatcaccatc tgcaaattct gattcatatg
    74401 tcaatgaata aaatgcacgt tttcctaata cacgcaattt ttcgttaatt ttcttaaata
    74461 ttctagcaaa caaaaatatt aaaccaggat atttacaaag tgtatctttt atactaaaat
    74521 taataaaatt accaccaatc aataaactta aaattccttt aactatatta tgataatatt
    74581 tactattact atttgtaaat gcaataactg cattatgtat atcagttgct gatcctgata
    74641 atttacatac taaccaatca ggaagtggta aatcttgaat attaactggg tcaactgaca
    74701 atgcaagtaa tccattattt gcattaaaat tagattttgc caataatgca ttattataat
    74761 aatttactgt atcagaatca ccttttgtat ccaaaatatt ataaaatttc ttattaccaa
    74821 cagtaatatt accatctaat gtaaaattag cacctttttt caaaactgca ttaagccatc
    74881 taagttttaa tgctttcaat aatgaaattc catttccttt acatttaaac aaattcaaac
    74941 cattttcatc ataatatata ctatctctaa catgtattga tggaccaact aatgacaatt
    75001 ttaatgtagt ttcatcatct tcatctgaat ccaaaatttc accaacaaca tataatgtaa
    75061 taactggtct atttgagaaa atataaaatt tagataatac tttatatttt ccttctgatt
    75121 catattcaag ttcagcaaca taatctttcc attttatata tgatggattt atttgatctt
    75181 tttgtgaacc caaatacaaa tattttacag cataaagtcc aattggtaat ctagtattat
    75241 ttgtaaaact atatgatgta ttattaaaat cttcacattc tattgacaaa tcaaatcctt
    75301 caccccaatt aacatcatct tcatcttgta atcttatttt tagcaatgat tttattttac
    75361 tatataattt gaaatatatt gatggcagta ttttagttga tcctgattca acaacaacat
    75421 aatcatcatc atcagaatat actgaaaatg gatgtacaac tttaccatca tataccaatt
    75481 ttggttttgg ttgtactttt acaccatttt gattaacata aaatgaatat gttgtatttt
    75541 cttttaaagg caaattgcgt ttatatacac aacctgtatc agcatttact atatcaaatc
    75601 taccaatttt ttgcattaaa ctaattattt tcttttgtgc agtttcagac aattcagaat
    75661 cagctgatac aaatgttcct aatgatacac ttacattaac accttgatgt aaatctaata
    75721 caagatttac tacatttgct acatcagtat cagtttcaga aacgtacaaa aatgtttgtt
    75781 tataaggcaa taaacgttgt gcaggaacat gcaattcagt tgtgtctttt ggtacaacta
    75841 atgaatgatt aactatatca gaatttgaca ataaaaattt aacattattt tgattatgta
    75901 caactaacca aaaattatga gtacatgcat atgtattatc aacaacacca ttaattaata
    75961 cattagtatt caatacaacc gattttccat tcaatggtgc taaattagtt tttattaatg
    76021 acgttaaata tgatgaaatt tgatcactat caacagtact attaaaacta aaaactagtg
    76081 taaattcaga tgcatcattt tcaaatgtta aatactttgt ttgactaccg tcagaaatta
    76141 ctacatttgt gtctgatgtt tcaatattaa caaaatcatt attatattct gggacaacaa
    76201 aattatattt tccattaaat ttatatgtat caaatggtga tccaaatcgt acattccatg
    76261 tactatcatt aacttgtgtc acttctacta ctttcaaagc tatgttcatt tactataatt
    76321 attttatttt ttttttaaaa ttcttacttg tattagaaaa tgaaaaaata atatcattta
    76381 ttaagtattg tattatcatt atgcacaatc atgcatgtga taaaattatt ttcaattttg
    76441 gcatttttta tgccatatgt tgtaccttca ccattgccat acatttgcaa tgacaacaaa
    76501 gaacattatt tcaaattgaa taataatttg gaacattctg attttgaatg caattatgat
    76561 tctgctgaaa ctattaatgt atcgatttgg aagaaaacaa atattgttgt tgattctttt
    76621 atttttacat tttttaaaat accttgcaat gctttagatt tgtttatatc tggtgcattt
    76681 agcttttatc aaaatcaggc tattagttta acagatataa atgtttatat caaaaatgtt
    76741 tcaactatta taattgatgg cattgaatat aaatttaaaa atatggctgg tgaatttcat
    76801 acatgcaata ttaaagacca aaaatatgga atttacgtta aatatgaaaa atgtcaacat
    76861 gttttcaaag gcaaaaataa ttatataaaa aagtttggtt cccaaagaaa aaatgatgaa
    76921 tacagtaata tttttaaaag acattgctcg aatttaaaat atgaaattgg aaaatgtatt
    76981 cttgtaaatg acctacaagt caaagaatat tatatttggg ataacagtca taaatttgat
    77041 ataaaattca gtgaacaata ttttataacg ccatatatat ttgtttcaaa tactggagtt
    77101 cttactaaat ttgaaaatgg atttgctgaa ttatattcta tctcatcatc aaatcaaata
    77161 ataaaatatg accatgttat aataacatgt aaatctgatt ttattattaa tattgaaaat
    77221 ggatatttta tcagtatgcc atttaatgaa ggacaaacag ttttgagtgg tagagagtta
    77281 gtaaactggt cacaaacttt tggaaagaca atttgtagaa acacagaaaa taaacatttt
    77341 gttctaaatg taactcttgc caatagtttg aaaaatgaat atataaatat agccagattt
    77401 caagaagttt tagataaaaa acttaaaata attaccaaaa atttggatac attatgtaaa
    77461 aattatgtaa tttacagaaa aatctataca gaaatttgca aaaacaatcc acaatactgt
    77521 atgaaatatt ttttgaatca ctataatgta aaagcaagat acattggagg aaatataatt
    77581 ggaatcaagt attgcataga aataactgat tttgaaataa ttaaagatta taattacaaa
    77641 acagataaat gtgaaatatt tgttccaatg aagataaata taaacaatac aaaatttatt
    77701 ggatatatga atccatcaac aaatgaagtt tttacagaat caccaaaaaa tgattattgt
    77761 gattctatta catatgttga tataaatgat acactgatgt acatctcaaa caatcaaatc
    77821 aatgtatcta cacaaaaaat tcacacatat ggacatgaaa cattgttgac aaataaaaaa
    77881 ataagtccaa tcattttgaa aaatataaat atttctgatt tatattttga acaaagcact
    77941 ttccaagatg tttatgatat agcatatcat cattttgacg aattgataaa tccaaaacaa
    78001 acttataatt ttgatacatc atctatttgg gattttttga attttcatgg catatttcat
    78061 ataattttca taggttttgt gatttttgga atattcattt tagtaagata cgcaagtcag
    78121 atatttagta attgtgcaag tattttcaga aaaaccaaag ttatttatga aaatattcca
    78181 atgaaaaatt taaatcaatc ctcgtaatga actttttgaa aatgagattt ataataatct
    78241 attttttttt agataaatgg aatgcagtaa ctgcttaaat tataacatac aaaaatttaa
    78301 atatgattac aataaattat ccaattcaat aaatatgata ttcacttgtg ataaatgtaa
    78361 ttatgataca gaatgcgtat tacatattaa atcacataga aaaaaagaat atcatatacc
    78421 tggttataat aattgtggac ctggtacaga tgttatttat aatattagaa atgatatatt
    78481 accaaggaat gaaacagatg tacattgttt ttttcatgat attgcatatt atatttataa
    78541 agataaagaa cgtaggaaaa aagctgataa aatattatat aaaaatttat taaatttaaa
    78601 aaaaccacat tcaatttcaa ttccaataat aaatgcaata ttaaaaatta aaatgataaa
    78661 taatatgtat taatattatt atgctttcat aaatgggtaa tttattacca cttcctatta
    78721 taaatggtac ttcaaagtca cttttaatta aaaataataa tatacaattt tcattaattc
    78781 aaggatatag aaaaactatg gaagattttt attcttatta tattgataat aaatatttat
    78841 atttggcatt atttgatggt catggcggca gttatgtatc atcttattta cataataatt
    78901 ttttaaaata tttagcaaaa tcaataaaat catataatat agatagttat aaatctatag
    78961 atctattata taatgatatt ggtaaagtta taaaaaatgt atatattgaa attgataaat
    79021 taatatatga taatattgat tttagtaaat cacaaggttc aactgttgta tcaacaataa
    79081 taactaataa ttatataatt ttttcacatt gtggtgattc acctgtttca gcatataatg
    79141 gtaaaaatat aatatataaa tcaatagatc ataaaccaat taataaaaaa gaaagagata
    79201 gaataattaa atctggacat aaaataatta ataatagaat agatggaatt attgatattt
    79261 ctagatgttt aggtgatttt aaatttaaag gattaaaaag tgctattatt cctattccag
    79321 ttgttaaaat aattaaaaaa gatacatgta aattttttat attaatgaca gacggtataa
    79381 caaattttat ttcaatttct gaaatatgta attacataga atataaatta caaataagtc
    79441 aagatatttc atctatatgt gatagtatat taatgcgtgc aatttataat gaaagttctg
    79501 ataatatatc aatatgtcta actgttatac aaaaatatat gataaatgat acattaaaaa
    79561 atgaatatga taattttata aaacatgtta ataaaattgt agttaatgaa attaaaaaaa
    79621 aaccacaaat atatttaaac aaagatccta aaataattcg aatattaaaa ttaataaaat
    79681 cattggatag caaatctttt aaatttagtt tagcatatga atttagatta atttctgata
    79741 tattagataa acatgaaatt ttttaatggt ataaatggct gatattgatg aaatccatat
    79801 aaatgatcta tatataaata ctgaaaataa tacatcaaaa tcattgaaaa catttttatc
    79861 tactcttcaa tcaaaatatg aaaaaaatcc tgataattat attaaaaata tttcagcagc
    79921 tggacataaa agaaaacgaa ataataataa taattcaggt gaacgaggtg aaaaacatga
    79981 attatctgat acttctatta tacctccaac acattgcgtt agttgcaata aagaaactaa
    80041 aaataaaaat aatggatttt taattaaaaa taaaaataat tatagattac attctatttg
    80101 tgatgtatgt aataaacaaa aatcatcatt tattggtgca agtaaggtac ctgaaaaatt
    80161 atataataaa attaatgaaa aaaaacaaaa ataataagtg aaatcatgta tgaacaggtt
    80221 aaagaattta taaaattaaa taatattaca ttaagtgaat catatcttaa tcagttaaat
    80281 gttgatataa ataaaatata ttatgtaata atatcatgtg aagaaataaa agataaatct
    80341 ttatatgatg aaaatacatt aattatatat aatgacgatt ctatatctga atatattatt
    80401 aataaactat ttgaaattat tatacaatat gatcatataa aaatattagg taattgtaca
    80461 aatataaatt taactgataa aaaaaaatta aaatgttatt atataaaaaa agataaaaac
    80521 aaaaaattag atgattttat aaaattgtat aaagcaatat taattttgaa aaattaatag
    80581 aataatcaac attcctttta tttggtggtg gtttagtttt agatttttag tttagttaat
    80641 taagttttaa catgcttatt aaacattcca ttgaagacat tacagaaata gatcctgaca
    80701 ttgttaatat aattgttata ttgacaaatt agtaacgttt tcctttaact tgtctatttc
    80761 atttgtaaga aaatgaattt catctacatt ttcttggatt attatttcta aatcttttat
    80821 attattttct attaattgat attcttgtaa taattcatta tattgtgcaa ttaaattatc
    80881 tactatgttt tttatttcat ttatgtcacc ttctttatac tcatttaaaa caagtggttc
    80941 gtatattaat gatgataaat attcgttact taattttctt aatatatttg attcatattg
    81001 agaataatta atcattaata taatcattat taatgatgaa actaaaatta ttaaaataat
    81061 atataccttc atttatatct aatcaattaa atataatgga ctcattgata ctatataata
    81121 tattttatta taccgacata ttaaattaga tttttcaaat gataatttaa aaaatggatc
    81181 accatcataa ttgtttaaaa taacaaaaga acaattaata tttccttctt cagtttcagt
    81241 aatatttata catctacatc taacatttaa tttgtgaaat atttcagtta acctataagg
    81301 aaatatgtat ttatcagaat ttctaatatt atcaataaat tcatttaata atataatatc
    81361 tgatgtacta ttatttatat atatactaag atattctacc atattaattt catatttatt
    81421 gaactttgaa tataataatg atatgtattt atctatatca atatttatat tttttaaata
    81481 attcaaagta ttttctattc tagatggatc atctggtttg ataaataaat cattataata
    81541 gtccatatta ttatatttaa aaactaaaat gtattcccat aaatactgat aattaatatg
    81601 tttaaatgtt gtttgtagta aatctttact atatgttcta atatatgttc ctttagatat
    81661 acgtcctaca cgtccttttc tttgaatata catactttct gtaatataca ttgttgagcc
    81721 agtaagaaac tttttttgat acattttacc attatctata actaatgttg catttgtaat
    81781 agttattgat gattctaaat aattagtact taatattata tgtatatgtt ttttatcatt
    81841 ttgtaattta ttaattattg catttatatt tgtaattttg ctatgaatag tatatatttt
    81901 atatatttta tctattaaaa tggactctaa tatttcttta tattcattaa ttttcttaat
    81961 tgtttcataa aatattatta cactttttcc aacagaaggc atataatttt ttaatatact
    82021 aattacatct ttatcttcac attcaatttc ttttactgga aataaagata cacctggaat
    82081 atatatttca actatatttt tgaaataaat tctaatatta tcaatatcac tttctattgt
    82141 tgctgatatt aatactatat ttctaatatt atattttttc ttttttgttc tagcaatagc
    82201 aatagctata tcaccaaatt tatcgtgttc atggatttca tctataataa cactattact
    82261 atgtttaata ttatttattg ttattctgtt aactgataat acaaatggat ataatattgg
    82321 attattatta taatattctt tttctttttt aacatcttta tattttaata taatcggtga
    82381 tcctgaaata ttatcaaatc ccaagctttt tatataattt atacccattt gtctaattaa
    82441 tgcttttctt ggtaaagaca atattgtttt atttttttca aaattgggtt taaaaataaa
    82501 atcattaata tttttatttt cattagaagt attccaaaat tcatatccat caaataataa
    82561 attaaaccac caaaataatt taggaattac agttgttttt ccaatacctg tacctccaga
    82621 tataatacaa tttttttttg atataaaaat ctcaaatatt ttcaattgta catcaatcat
    82681 agttgaacgt aattctgatt tagtaaatga gaataaattc ttatcaaaat atttattttg
    82741 tttatagcta gataatattc ctaaataatt agcactttca attattccat atatttgata
    82801 tttatttaat gatgatatat taattgtaat ttgagaaata attgtaacat atgaataagc
    82861 tgaatatgaa atttttaaat tttttccatt aattataatg ttatcatctt caaatttcaa
    82921 ttcattatta tataataaat tataaactgt attaatagaa atattatttt taaattcatt
    82981 agataaatat ataaatctat tatttaaaca tatattaata ttatgccagt ataatttata
    83041 aactggatat aaagctatag caaattgcat aggatattca aatacttctt tttttgtaat
    83101 ataactatta aatattgtcg cattattggg aaacaaaaga taagccatat aattatattt
    83161 attaataata ttaggatata aagtagtttt tttgtcaatt ttatataagt cggtaatatt
    83221 ttgcatatcc atttataaac attttttgta aatataaatg gatgataata gtataactaa
    83281 aaatattaga acatattaca ttccagatat atgtatgaat tgtaaaaagt tgaatcctga
    83341 aaaagtatta gttactgatg gaaaatttaa aacaaatttt ttgtcatttg atcaatttaa
    83401 taagaatgat acaacatttt tagaatatgc tagtggagga tcatcaattc caataaaatt
    83461 gttttttaat aatggtcatt atagataata ataatattta taaataaatg gctgatgcta
    83521 ttattgtatt aactatggat aaaatagcat ttaaatgtga agattgtaca gaaataatac
    83581 catatagaat agttatgaat attatattca ataataaagt ggtgtataaa aaactgtttt
    83641 tgttaaatta tgatttatac aatatatcag tagataaaaa taaattgttt tctactataa
    83701 ataataaata ttatttttcg acatttccaa caaaagaaca caaaggtaag tacgttatta
    83761 attttattaa taaattaaat aaagatcctc aagacgtcag aaattttata ttaactatat
    83821 attttttgtt aaaatatgta tataaaataa taccatgttg gtatatatat gattataatg
    83881 atttgaagtg gttaataaat aattataaag gttataaaat ttataatact aatagattcc
    83941 atgtgtcatc aataataata aaagataaat taccaaacat tccatataat gcggaaataa
    84001 taaataatat gattgtaaat tattgtaata ctcaaataaa taatactaat ctggtgaggt
    84061 atgtagataa aatagataat atatcatcat tattagaatt atatcagtca tttttaagtc
    84121 tttagttatt gcctagttat tgtcattata tttctttagg ttcaatcaaa tgttctaaag
    84181 ccacatatgg ttgatttaga ataacttttt tgtattcatt tggtattaaa tgttcaaatt
    84241 cttttataaa tttttcatta ataacaatta tttctatagc ttttctagat cttgttaatt
    84301 tttttattgt tgaataatat ctattataat tgcattttat attgtgcatt tttatatttt
    84361 tattagtatt attaaaatta attgatgata ctaatgtcag cattttatta ttttgattgt
    84421 cttcgtttgg agtatccatt tttttatttg tatttgtagt tttaataaat ttttctggtg
    84481 tgtgaataat ttttaattca tctaaatgat atttacgtac ccattctttt aatatgttaa
    84541 ataatgctaa tgaaaaatct ccattttcga ttttatttga aaaatttgga tttctaggtc
    84601 ttataaccct tgtatctaat atattgtttc tatcttttaa tatattttca ttgactgaat
    84661 ctatttttgt actattaata aaataactat gatctatatt aattacagct aatcgttcta
    84721 aaattgcatt atcagttata tcaattgaag gaaatatatt agtatcaatt atttgtgttg
    84781 cataattatg ttgatcacct tcattactat taagtactcg agatattatt attctttcag
    84841 tcatatgttt tatagtttga gaatcaaatt tatcacatgc attactttct gaagcaaaac
    84901 ataccaattt tccatttaat tttcccaacc atgcatttgg actatgtgga ttgtgttgtt
    84961 taacataatc tattattgga attgttaaaa ataaatttcc aaataaagct gctaataata
    85021 atttaattgt tgttttacca cttttagtag gtccaactaa aaaagttata gtttctttag
    85081 aaatttgtaa taatgaagaa ctaatattac attcaaatat ttttctatct ttatgatttt
    85141 ctggtataat attatttata actgtaacta acatattata attttccata taattattat
    85201 attcttcttc agacatttct tctatatttt tatatgataa aggaatataa ttaggtttta
    85261 tatatttttt agcctcaatg ccatatataa atatattatt ttttagatca aaaattccat
    85321 tacacatttg aattaaatac ggattagtat tatacgtatc agtactgtca gataaatcag
    85381 ttaatattct tacttttgct tctttaaaat attttgtact tacatatttt ttatcatgta
    85441 ataacattgt atttttatat tcatctaata attttaatgc tattttacca tatatcatat
    85501 catcaattat aggcatccat ttcattccat cccaatataa ttttaaatct ttatttactt
    85561 ttcgtactat atctaaatct ttaataaatt ttgtaattgc tgtagaatct aatttaggat
    85621 attcaaattt aattattcta caattatgtc tatttccata tttaattaat tgtatgttat
    85681 tttgattgaa aaacaaataa tggtgatttt tatgtgtaat tttaccacaa atacatgcat
    85741 gttgtgtttg taaataaatg tctaatgttt gatttaattc aatagtttct aaatttttaa
    85801 ttaaagtttt tgtattagaa tcaattgtaa tacttgcttt aaataatgtt tgtctaaatt
    85861 tttcaagaaa tacatgtcca ttaaaaactt ttaaatgagg aaatatccca tcttcaacag
    85921 ttaattcaca ttcatctgta tctattgtat caattaaaat attatcttca tcatcatcta
    85981 caaaagttac taaatatttt tgcaaatcat ttacagattc tatttgatca tcatattcag
    86041 tatgataata tttagaattt gattttttgc tgtatataca tcttaataaa gtattatttt
    86101 taaatacttg ttcatcaatt cctaaaataa gttcatttgt tgttcttttt ttataattat
    86161 gaatatggat ttttaatgta gtaaatacac tattagatac taaaatattt gtaaaaaata
    86221 catgtgtaga tattttatta ggatcatttg aagttgttgc agaaattcca tcaaatatat
    86281 gatttttaag gtcatcttca tttagttcta aagttgaatt tatattataa aattcaataa
    86341 atacagatgc aagaaatgat gatatttcat ctttaaaatt ttcaaatgta ctatcaaaat
    86401 aatctgaatt atattttttt tttaattcta tatcaaaaaa taatttaaat ctatcatgat
    86461 actcatttaa aataatttca tggtattctt caattgaatc attattttct attgcattat
    86521 ttattttttc taaaagttca tctaaagtta atttatcaat ttgattaaca tattcttctt
    86581 ctaatataca tttttttttg tctaataatt ttacttttaa tcctttttgt aagtatatat
    86641 atttatccat tatatatatt tacttaatta gtataagtta gtatatctat taacttaaaa
    86701 actaacttaa aactaactta atcctaactt aaaattaatt aatatctatt atattaatta
    86761 taaatatata atttcaaata taaatatggg tggaagtgtt gcaataaatt ttttaggaac
    86821 tagtaatgat aatgcaaatg gaaataaaga tttaataatt ggtctaactg atggatcaag
    86881 aattagatta aaaatgtatg aacaaattaa tactataaat ccaagtgaat atgctggaaa
    86941 agatgaatat gaaatagaat attgtatggc atcaccatat aatggtttag gtgaatgtgc
    87001 aaaattattt aatacagata gttcaacaac atatgcaaaa gaattagata attatataat
    87061 aacaaatgaa ggttcatcat gcatgagttt agcatttaga ccaggaagtg ttttatatga
    87121 aacatctgat tggataaaag atagaatatt taatggaaat aaatgtaaaa taatttataa
    87181 tggaccacca atttatgaaa atgatttatt agaatgttgt actggaaaac gaactgaaaa
    87241 ttgtaatgaa aaattgataa ataattttac aacttcacat tgtaatgtaa ctatgcaatc
    87301 ttattgtgaa aacaatccta atgatattta ttgttataga tggttagaat ctcaaacaaa
    87361 attaaataat gatatcgcat tgaaattata tgcaaattta tgtagtaaga atcatataga
    87421 agaatattgt acatattttt gcattaattc aagaaattcg gattatccag ggtattgtga
    87481 tatagcatta gaaaattatt gtaaaaacaa ttattataat gaatcatgtt attgttataa
    87541 tccaccatca aatattatac caaatgttga aagtgtttta ggaccaaaag aatgttggtt
    87601 agatccatgc acaacaaatt atactaatca aaaatggtta actactgatc aactatcaat
    87661 caaaaaaagt tgcgcaatac aatcatgtat tataacaata gcagctttaa atgcatcagg
    87721 taatagtact ataaatttaa taaataattg tgtagaaggt gcatcgtcat caacagaagt
    87781 tcaatcacaa tatattagta ataaaactat tccagtaatt caaacttggg gttcattatt
    87841 tgatccatcg ttatttatta tatttttagc attattattt ttaattttat taatgttatt
    87901 aaattataaa ccagtgctat cactgtaatg aaattatagt aataatagtt tatacaatat
    87961 attaatctca atgaataata atattacaaa caccaaaatg tgtttggata taatagaatt
    88021 aacaaatgta ttgactgata tttgcattaa atgtcaagaa gtattaagaa caaagtattt
    88081 taaaaaaata tacctcaaaa gtaattatga aaacagtatt aatgaatata atataactaa
    88141 agaaatacaa aatgaaataa caaaaataat tcaacaaaaa tgtaatcatt aaatacttat
    88201 ataaaaatga aatcattaaa tgaatctaga tgttgcatct gattgtaaaa tttatattcc
    88261 atattttaat tatggattac atacgaatta tataaagagc ttattgccat attattatca
    88321 taatgataat ttaaaatttg gtaacattaa agatataatt tataaattta caaaaaatga
    88381 ttttattagt ttgagtacaa ataaattgac aaataatata ttatctttat taaattctat
    88441 ttctgatatt aatttatata aattgattaa tgaatatgga tattatctaa tatctaatga
    88501 aattctttat gatttattta taccatttga ttcatttata atgaacaata aaaaatatat
    88561 tttatatatt gatgaattat attttgataa tttaaatatt aaaaattatg ttataaaaac
    88621 taaaagcaat atattattaa gcataaataa aactaaatat tttaataaca acatacaaat
    88681 agaatttcca gacatcaaac ctcaaattat atcttattat gatgataata tatattactc
    88741 taattatata tcgaataaat taaccataac cgaattttat atgacatatt atgatgatgg
    88801 tatccaatag ttatttattt tttttcgatc tatgatatta tatgaatgga attgattata
    88861 catctcaata aaaaaatgta atataatatt tatatcattt tgtgacatta ttgaattatc
    88921 atttatattt tttttagcat gttcactaca tgttggacat ggtaatgtac tacatattat
    88981 atataatgtt ttttttaatt tttctatttc atacatataa attgatcgat ctttattgac
    89041 tttattaatg aataaataaa ttaattcaaa tataattaac catgcaccag caccccataa
    89101 tttaggatcc atttatataa attataaatg gaccaattag gattagatat atataatcaa
    89161 atatatgaac gatatttaat aaaattaaat agaaatactg caaatgcaag tattaattgt
    89221 aatattgatg ttggattgat tgaaactgaa aatattaata attgtaattt aacatttact
    89281 aatgaatgtg tatcaaattc atctacaaat tttacattat tattagaaag tttagtagaa
    89341 gttttaaaat tattaccacc agaacaatct tctaaaattg aaaaaaaatt aggaataaca
    89401 ttatctgaat tagaaaatgg tgaagataat ggatttgttc aagaatgtaa agctcaagca
    89461 tcagtaaata atagtatatc tgttaatgaa ataaaaataa caaattgtta ttcaactggt
    89521 tcacaaccag cagaatttat atttgttaat tctggtacag ttgaatctaa ttgtggaatg
    89581 agtaaaatat cagaagcatt acaaaataca aatattataa tagaaaaaga agatgaagtt
    89641 gttacaaata tatttggtgt agatttatta ggtattatag tattattagt aacattaata
    89701 ttagcttata ttttttattg tattatagta atgcatatat ataaaacaaa aagtgcaata
    89761 tatttttcta gaaatactat tgtacctgaa gatgaactga tattacataa tattaatatt
    89821 agaagaacaa tacctattat aaatgacaga taaattgaga attacattat gttcaactat
    89881 tttaaatctt gatgaaaatg ataaagaata tttccttaat gaaattttac aaatatttac
    89941 agaaaaaaaa aaactaaaag taaaccagga aaatacaaat ataaatataa taataattat
    90001 aataagtgta ataatagtct taataataat aatactagta atagtttttg tatttattcc
    90061 aagtataaaa aataaaaaaa gatagttttg aaatataata taaaatataa aatgggtggt
    90121 gaatatttga tagttaatca atgtaaaaat aaagttaatt atattgagga tagaaatcaa
    90181 ttaattgata acactgagct tgattcatat atattaaatg aattattaga atataaatta
    90241 gataaaataa aaatagttga caatgaagat aattgtaatg ctgtaataat taatatacca
    90301 tcacatgaag aaaaatttaa tgatatgtat attaagaaaa taattaaaaa tagacatatt
    90361 atattaataa ttaataaaga tataaattct aatatagaaa aagtaataag atatcattct
    90421 aaagatattc ctatttttac attaaaaaat aatatatatt gtttaaatat ttttaataga
    90481 ataatggaaa ataataataa accaataata gacagtgtat atattatgca ttataatgaa
    90541 tctgaaaata gttatgaaaa tttttaaaat aaatgtcaat tgcaccaaat gaatatatat
    90601 ttaatattat tgatacaaat tctaataata atatagatgc atccgaatta acagttttta
    90661 tgaaaaattt ttatccagaa ctaactgaaa atgatgcaca aaatacaatt aatgatattg
    90721 atacaaatgg tgatggatta ataagtaaaa atgagtttac ttcaattata agtaatgata
    90781 tattaccaga agatataaat aatgcttata atgcattaat attaaatggt gaaaataata
    90841 ttaaacaaat gattgactta tttttatctg ttttaaaaat tgaaccatta tataacttat
    90901 ctatttcaga atattcagat ttactatata aaatgattgg agatagtaaa gaaagtttta
    90961 ttaatttatg gaatttctta caatctaaca cataatatat tttttattta taaatggtta
    91021 agacattggt tattgtatat atacccgaat gtaaaatatg tcagatagtt aatgaatatt
    91081 ttgaatatct taattcaata aagtatataa attataaaaa aatttatgct atcaatagta
    91141 tattaaaata taaaataccg atagataaac ttaaaggcat aaaattacaa acacctcaaa
    91201 tatatttaat tgaaaataat tcaattatag cactaaatac tgcaccattt ttaaattatg
    91261 caataaaata taaaaaaact ttagttaaca aaaatgaaac aaacaacttt ttcttgaaga
    91321 aacttatgag gaacgagtaa acctcaaatg taaaaattta attgcaaata ttgctattat
    91381 tgcaattgaa aaaactgaca aaattacaat gataagtatt gcagataaac gtaatccatg
    91441 tttttgaaca tactttgaaa catgaatgtt tgtattgata aaaggtgcaa tatcattcaa
    91501 tgtaggaact gagatgaatg atgaaatatt aaaagttggt ggttcaatgt atatattatt
    91561 tttaaagccc aaatttatta ttttatcaac tttgaaactt gtaacatttc cagtgaaatg
    91621 attgtatata cataaactgt ctggatcatc aaggcataca aatgtaatat cattacaatt
    91681 agatgtatat tttgtagatg agaaaatttg ttcagttttt gtattgtaat agcaatttga
    91741 aatttttgaa ccttgtacta atatctcaac tttaggaaac aatgaacatc catattcttc
    91801 agcacttggt aaaaatttat taattttggc actactacat ttgtttataa gatacttgtt
    91861 tccaacaata ttgacattga tatttgtatc attaattaaa actgaaatgc attgttttgg
    91921 tgaaacagca cataatgcat ataattccat tatagaaata gacatttcat tacatagttg
    91981 aaaaattcta ttaaaatttt cacttgatat atcatataaa tattgcaaaa catcagtagc
    92041 atcacttgaa tcatatgatc tttttgttct atatgtagta attggacgat aataggcatc
    92101 tttcaacatt ttgttaaatt ttattttgta tgcaaaattg cttgtttgga taaaactgtc
    92161 attatctaca ttatttatgt catcaataac aacagaaaca tttgtttttg tgtcattgtc
    92221 aataaatgaa atgtgtgtat tattgttttc atcataaagc atgtagcctt tggtttgata
    92281 atacttataa tcttttgttg cattttcatt aacttcccat gtaatataca aatcattaaa
    92341 aattttgcaa aattgtgaag aatattcaca acttggtaaa gttcccaatt cagtatgcat
    92401 caaatgactt ttataataca ttttaactct ttgcattgta acatatgttt tttctgtagt
    92461 atgttgactg aacaaataac taacacattc atatgttggt acacccaaaa tatattttga
    92521 tgaaagttca ttgtatttta attcttcatt tttgtagtga catgtttcat tcattttcaa
    92581 tatttcattt ttcgacaatg taatgtaatc aataaatgtt tctttaaagt tagaaaatat
    92641 attaagaaca gcatgaactg tacatttgta tacttttgcc gaaacaataa cagcattgga
    92701 ttcatattca tcatcattga tttttttcac agttatatca gtttcaacat attgcgaatc
    92761 tttacaatta acattttgtg gtaattttat tataatatct ggatgaacag attgagtgca
    92821 aatatattct gaatagacct tcaaaataag tatagcaaaa atagcaactt taatcaatgc
    92881 cataatgaca ggcaacaact gaaaatgtta aatattgata tattatttca atattttcat
    92941 aatgaatatt ctaaatcaat tattttatca taatatattt ccatacttat tattgattga
    93001 attaataaaa ttaatgaaaa aatatataat atggaataca aattataaat aaataatata
    93061 cttaaaaata taaattctag tatataatat attaacattt aaaataaata taataaataa
    93121 caatgtcagg atatgatgaa gatcgaattg aattaagtga agatgaaaat gaagaagatt
    93181 tattatataa tgaagaatgt gtatcagaag aagaaaaatc aataactgat ggtactattg
    93241 atgaagatga atatgaatat ggatcatctg aaacaattga aacatctaaa acaatcatgc
    93301 ttaatggtat agttgattta cataaattta aaatggctca aaaaaaaaaa cttttattat
    93361 cttcacaaaa tgaaatactt agtttaattt taaaatttaa tgaattactt agtaaaggat
    93421 ctattccatt aattgatgaa atattgttta ttaaaaatta taacatgcaa ttatttaata
    93481 atccaaaact tggaacacca ttagcatcaa ttattttaat aatattaatg aatgttccta
    93541 tatgttttga aaaatatggt aaaatatata atagagaatg tattaatgat ataactttat
    93601 tagataagga ttatttaata tcttattatg taaatttaaa aaaattaatt agacctgtta
    93661 tatataatga aaatatatta tttaataaag atacattata tgaaatattt ccactattta
    93721 tgaaaaatat taataatgat aatataagta atgaagaatt gaatgaaatc caaaaagcaa
    93781 aatcatttct taaaaataat ataattgaaa aataataata aaaattttaa ataatgtcat
    93841 tttataatta ttttgaaata ttatttgata ttgaattgga aaaatatcta tttaatgaaa
    93901 atgatatttt ttactttatt actaaaaata ctaataaaaa aattatactt cccatatatt
    93961 tagaaaaatt tatagaatat gaaaactatt tatataattg tggttataaa atatataata
    94021 tatatgatga taaacaagaa ttatgtatta atgtatttaa aaaatcatta attcatattt
    94081 atatatatga attacttatt ggattcagat taagtatcta tgattcaatt tcgccttata
    94141 tatatgttat caatgaatat atgttatgtg aaatatcaaa taataaacaa aattataata
    94201 tatatttaaa taattatttt aatgattatt tacataattt tgatcttata ttttgtaaaa
    94261 atattataat aataaatcct actgttaata attataaaaa agcattaaat ttttattttt
    94321 tagataaaaa aaataattta aaacgtaaaa ttgaattatt attctaattc attgaatgat
    94381 ggaaaaaaat acatatatat acaaaggata tatatttaat gataataatg aaacatattt
    94441 ttcaaattca ttaaaaaata aaaatataga aaatttaata tgtgatggtg aaatagatga
    94501 aaatgtattt tataatatac aaggtattaa aaaattacaa ataaaaaata tatccagtaa
    94561 tgtattaaat aaattaatta ttccaaatac agtagaagaa ttaaccattt ctaatatatt
    94621 taaagataaa tgtgaaatag atttaaaaaa attaaaatca ctatctaatt taaaatattt
    94681 aaaaatattc aatataccaa acttatatag tgttatatta ccacaaaatt taatacattt
    94741 tgaatctgat gcaatgatac cacaaacatc attaatattt tcaaataaat taaaaagaat
    94801 tataatacat aataataaat tatccatatg aaataatata tattttttat tatttaatct
    94861 tatattgtga aaatgcagaa ttacttaaga gatataatat ttgaatctga tataatagat
    94921 aaaaataaaa aattaaaata tgataaagac actcaagtat cttttattaa tattgaaaat
    94981 aaagatacta ttaataatag agatactgct tatagtgtag aatctaataa atttgaagaa
    95041 aaacaaaaca caaatatgcc tgaaatatac agaaatattt cacttgaaaa taccaacaat
    95101 gatcaaaaca atatcagata tgatacaaca aatagtagaa attctaattt tttaagattg
    95161 atatcaaaac ctaatgatat catttattct attttgtatg tattgtatga cattatttgg
    95221 tttattaaaa tcattatttt gagcatacaa aaatgtaaaa ttgaatctta cagaaatatt
    95281 attttgatga atgtaatcat tcaatcaata ataataataa atacattatt tgaccttttt
    95341 caaaaaaaat tcaaaaatct gaaaaaatat aattacaccc caaaattgag attgaaatta
    95401 tcaaatgtat taataatgct tgattttaca actgtcgtgt ctgtgatttc atcagaattt
    95461 tatataaaat ctatatcatg tattgatata attgatgatg gtgttttagt tttattatta
    95521 ttgttcaatt ggtttatata tttaataata atttcattta aagactcaca tattgatgag
    95581 tattatgatt tagaatattc aaatcaatca gaacggtcat atgacatttc aaattgagat
    95641 cagaacaaaa aatgtcaata tcaaattact aattttttga aaatatatat taatgattaa
    95701 atgaatatac ttggtattga tgttggcatt aaaaatttgg gcttatgtat tattaatatt
    95761 aaagataaca aatataacat tatatgtata aaaacagata tttcaaaatt aaattattct
    95821 attttagata atttatataa tatatataaa cttgataaaa tggatattgt attaattgaa
    95881 catcaattta aaggcagatt aaatattcaa tattatggtt ttttattatg cttttttcaa
    95941 agtaaacaaa aaaaaataat tagtataaaa ccacctacat ataatgctgg tataaataat
    96001 aattcatatt ataatagaaa aaaatatagt gttaatatat taaaatctat tatagaaaaa
    96061 tgtgataatg ttaaatatat taacaaatat aaaaaaattg atgacattgc tgatgctcta
    96121 tgtttgataa taaaatatct aaaaattaat attaatgaaa atcaatacat tcagagtatc
    96181 caaatactat aattatttta ttataaatga attcatcgaa ctctaataca ataaaaagta
    96241 gaattagtaa tattatagaa aattcaaaaa atcttataaa tattctggaa tatagtacta
    96301 ttatttttat attaccatta ttaggatata tagcaagtaa tatatattca tcacaagcat
    96361 cagaagattg gtataattct attagatttt atataccaga tattacaaca caaagttcag
    96421 gattatttgt taattcattt ttttatttat ttttaggagt agcattatct caattatatt
    96481 cagaaaattt aatgtcaact agtcagacaa aatcatatat tatttggcta ataccaatta
    96541 ttttattaat gatttatata tctaatccaa ttatgtacca atcacagtca atacttgcgc
    96601 ctgctattat ttatacaatt tcacttatat tagcatttat tgtattatat tatatttatt
    96661 ctataaaagc aaatggaaaa attaaatttg gttggattgt atttattatt tggataatat
    96721 atctaacaat attttattat acaggtggaa gtggtgaagg acgtcaagct agtttaatgg
    96781 gtattgaacc acaaaaacat acaattgata catgttcaag tgttaatgtt aatcctcaag
    96841 aaacaataat aacaactaca gaaacaactc atgaaatatc tacataataa atgattctta
    96901 ctattgtttt agaaattcta tcttctcaat gtttttttgc ttcagtttca tatataatag
    96961 atataataaa aaatgttata agtaattatt taacaaaaaa atatgattat gatggatttt
    97021 attataaata tgcaatatat attcaatcta tagttgcaag ttttttgttt ataataattg
    97081 gcataacttt atatagtgtc gttgattatt ttaaaaatta aataataaaa tatatttata
    97141 tgtatatata taaaatttgt actttattct acattacttg tacgtaaata agcaatagta
    97201 cttattatta ttacaaatag gattatcaat aaagcaatcg ctaatgcata atatattttt
    97261 tttgatataa ttttataaga atataattct tgaggttcat gatttttatt aatagctgga
    97321 gtaatatcaa tttctgtact attcttaata aaatagaata tatatatatc atctatatat
    97381 aaaataaata ggcatggttt ataagaaatt ttaaatactt caaaagaata ataacatctt
    97441 tctttaaaat aactagtact tattaaatta aaatttaatt ttttatttaa cactcttgaa
    97501 tatttaactt tatcattatt atcacatgat atgattattg atttattatc atattctatt
    97561 aaaacactgg ttatattatc attattatta attgttaaat gttttattgt ttctatattg
    97621 catagttcct ttgtatattc atctacacat ttattaatat cacaaacact gaaattaact
    97681 aatataacta atataaatat ataccacatt ataaacaaat ataaaacact atattttcat
    97741 tcataggatt aaagttaaaa ttaatgtagg atgaaaaaaa agtataatag taattactat
    97801 tatgcatcta ttatatttag ttttaacatt atatacacct atttatggat atattttata
    97861 caatgataaa aatattacat atgaatgtaa caataaacat gcaattaaca tggctgtatg
    97921 ctatgataat aatataaaat tctgtattat aaaagattct acagaaatat atatacacaa
    97981 tatcattacc aacaataaaa catatataca aaataattta atacatgaat tatttatcaa
    98041 caaagtatta ttttgttatg atgattacat atttttaata tacaacaaat atgtttttaa
    98101 atatgaaaat agattaccta cagtatttac caaacagatg aatttaacag atagcatacc
    98161 tccaattctg tatacaataa agtattatga taagtatttt gttattaata aattaaaaga
    98221 atatagtaaa tctatactaa aaaattttat gaaatattat aaaaattaca aaaaatattc
    98281 taaaattaag tgtaaaaaaa aagcacaaat atatacgtat gatgatgtga taataagtga
    98341 aaaattatat atgataataa tattcatttt aatattattt gttattttta ttgcttataa
    98401 aaaatgagca taacacatta tttatataaa atacgatcaa taacactatt tccaaattta
    98461 ttattaagat atcaaaatga tgataagaat ttacaaaaaa tattatatat tggtaaatgt
    98521 cttttaacat ttataatact atctttgata tttgatatat ttataatatt acatgattat
    98581 gctatatata tctttatata ttctataata ctatcaattt acattacaaa actacatatc
    98641 aaagacatat atagaatgct tgtgacaatc ttaatatgct ttatactttt tgacatattt
    98701 ttaactataa tagattatct atatattata aaaatagttg taaatatatt agtattattt
    98761 ttttctatta aagaatattg tattatgaat gaataaaaat attaattaga attcttaaaa
    98821 ttttgaacat attcatgtat ttcgtttata atattatctt catttattat ttcgtcttta
    98881 ttttttgaaa aatattctac ccaaaaacaa atagatatac aaattctttc attaaatggt
    98941 ttattaataa tagattttat atattcaaaa acatctttac ctttattttg tttaatatga
    99001 tgaataatac atgaatctaa tggaatgtta gaatattcgt cttcgtatat atttaattca
    99061 ttatttgaag ttaaaagatt aagtatttca tgttcatcat tagttaattt ttattgttta
    99121 ttgccatttt tatattatat tattaatatt ttctaatatt tcaaaaaata ttctttattt
    99181 tattatatta tcaatattat tttctaatat ttcaaaaaat attctttatt ttattatatt
    99241 atcaatatta ttttctaata tttcaaaaaa tattctttat tttattatat tatcaatatt
    99301 attttctaat atttcaaaaa atattcttta ttttattata ttatcaatat tattttctaa
    99361 tatttcaaaa aatattcttt attttattat attatcaata ttattttcta atatttcaaa
    99421 aaatattctt tattttatta tattatcaat attattttct aatatttcaa aaaatattct
    99481 ttattttatt atattatcaa tattattttc taatatttca aaaaatattc tttattttat
    99541 tatattatca atattatttt ctaatatttc aaaaaacaat caaaaaatat tctttaaatt
    99601 ttcaatattt gttataaatg aataaaataa tacttgaaga tttaaaagaa tctaatgtac
    99661 cattatatat accacaaata ttacctcatc aattagcaac attagatttt ttaaatgaac
    99721 gttcattaaa ggaaaaaaaa agtgtattgt tatttcataa gatgggatca ggaaaaacta
    99781 taatatcatt gttattttca attatagcat caattgaaac taaaatactt ataatattac
    99841 caaatacaag cattatggat atatggataa gtaaattata tgattcatta ctattgttaa
    99901 ataaaaatga taaatataat ttaaataata ttgaatttac tactagatct agattaaatg
    99961 aagaattact tggaacaaat aaaaatatta atgatataat tactgaaaat attaaaaaat
   100021 atgataatta tattattata atagatgaag ctcataattt ttttggtaat gcttcaggtg
   100081 aattacttat acatattaaa caaaatagta ctgctagata tgttttatta acaggaagtc
   100141 ctatttcaaa tactattgaa tcacttaaag atattgttga attattaaca aatgaaacat
   100201 ttgaatacaa taaatatatt gaaagtgctg gtaataaagt atttcaacaa cgtataaata
   100261 aacaaggcat tgaattatta aaaaataaat taactggatt gatatcatat tatgatgaag
   100321 atagaaaaga tattccaagt cctatttttc aaggaaatat aaaattatta aattatccag
   100381 tagttttatg tccaatgagt aaattacaag aagataatta taatatgatt tcaaatcaaa
   100441 cagaaaatga tatgtttata aaattaatga tgaatgtatc attagttgca ttaggtgata
   100501 aggaaaatta tactaatttt gatttattaa tggctagtaa taaacaaata tttcctaatt
   100561 tttatgtatc aaatggtaag tttataggtc aagaattaat tgatttaaat atatcttcaa
   100621 aacttaaata ttttatgaat agtatattaa catcaccaaa tgctggaaaa cgatttattt
   100681 attttgcaaa tagtacaatt ggtagtacta ttataagaag tgttatgata gctaatggaa
   100741 tatcagaata tgataaagaa attgtaaata attttgtatg tgttaattgt ttaaaagaaa
   100801 ggaattgtaa taataaagaa tgtataccaa tgaaatttgt aattataaca tctaaagaat
   100861 caaataaagg aaataatagt tatattaata aaatacttag tgtttttaat gaagatgtta
   100921 atgaaaatgg atcagttatt atgtttttat ttggatctag aataattgct gaagcatata
   100981 cacttaaaga tataaaagaa atatggtttt taacagttcc tgaaactaaa tccgaattag
   101041 aacaatgtat agcaagagca attagatcat ttgcatataa agataaaaat actagagtag
   101101 ttgtaagaat ttgtttagca acaactccaa atgcacttag taatgaaata tcacaaataa
   101161 ttgaaaaata taaagatgaa tctttatctg atgaagaaaa aacactttta ttaaataaat
   101221 ttgaaatgaa attagttaat tatgctatag atttaccata tgatttacgt aaacaattat
   101281 attcggaatt taaatcagaa aaagctaaag ttgcatataa tatatttata aatcttagta
   101341 tattaactaa taatatatta aatgataata tattaaaatg ttttatcata gaaaaaatta
   101401 gaagatattc atatgaaaat agtagatata aattaaagga tatattgtct tatattaaaa
   101461 aaaatttaaa atttgattat aaaaataaaa ttgaagatta tgttaatgaa tttgttaatg
   101521 atggtgttgt agtatataat aaatcatttg gaacatgtta tattgattgg tttaaagatg
   101581 atatagttgt aaaacaaatt attctagaat ttaataatta tttactaagt tataattatt
   101641 aatataattt attttgtaac tttattaaat aataaatata ataatattta attcataaaa
   101701 caataaaaat ttcataaatt catataaaga ttttgttttt ttttcttttt attaattttt
   101761 tatttcatta ttaaaaccat ttatttttgt ttgaagaaag aatgccataa tgacgtaatc
   101821 aataaaatgt cattattttt tcaaaaataa aatacatcat tcatttttta ttaaatttat
   101881 tattctcatt gtcaaaaata tcattatatt ttaaatattt gtccagattt ttatttttta
   101941 tatatttatt ttcaatttgt tctatatttg aaaacattaa tttttcatta ttttctactg
   102001 atttaagttc ctttaacact tccgagttcg acgttgaact tgattttgcg gttaatacaa
   102061 ttaaacatat taataatgaa tttataatta gagttaatac aatactaatt ataattttcc
   102121 tttcaatggt caccattgtg aatacacagg ttaataatgt acactattat ttcaaaataa
   102181 tatgaaatat tatataaaat ataaaatggg tataaataat cttaatagca atcttaaaca
   102241 ttgtgagaga ttgattaatg tagaatatga tataaataat ataaaaaata gatatatata
   102301 tatggatttt aattgcattt tctatacaca tgcacatgtt gtaacatcag atatagaatt
   102361 agttaattca ataaaaaaat ttatagtttt gtttattaga aataataata aagtttatgt
   102421 attttatgat tctggaaaaa ttaataaaaa aatgcaagaa aaagaaaaaa gaatagaaaa
   102481 tagtgtaaaa tactattcta aaattaaaac taaattaata aataacaata ttattgatga
   102541 agactataat ataataccta aatatgaaaa agtttgtgat catgaaacag gaaaaattga
   102601 attagttaaa acagaattaa caaaagaaga atctaaatca atatattcag ctaaattcaa
   102661 tttattatct aattttaaaa taacaaattt taaaaatata ttatcagaat tagaaaaatt
   102721 agatataact atattaacta aaaaaaatgt tgatgctgaa ttttatatgt gctcatatgc
   102781 taaaaaaatg cataatgata attggcctat atttataaca aaagatcaag atcttatatc
   102841 tttaattatt caaaatactc ctgtacaaat tacaaatatt atgataggta atgaatatta
   102901 taatttaata tctgataatt tatctaaaaa tatatgtata ttaacattgt tatttaataa
   102961 atctgattat atgaatggaa tatatggatt tctatttgat aaaaaaaaat taaatactga
   103021 tttaattaat ttattaaatg cttcttatga accttttacg ataaaatcta ttattaaatt
   103081 gataatagat gtattaaaaa ttacatctta taaaaaatta aataaaataa tggaaaataa
   103141 aaaaataaat acagatattg acatagataa aattattgat acaatatctg atacagatat
   103201 agatatagat acaataactg atacaaatat agatacaata actgatacaa atattgatac
   103261 aactattgaa ccaaatatag atacaaatat tgaagcatta actgatacaa atatagatac
   103321 aataactgat acaaatatta aagcattaac tgatacaaat attgaatcaa atattgaagc
   103381 attaactgat atttatacaa taactgaaat aaaaagtaat ataaataaaa aaaatgtcat
   103441 taaagaaaaa aatacaaaaa aaaataaatt atatgacaga aatactatca gcaacattca
   103501 tagtaactgt gcatgtgctg gaaataatat tccaaatact agcaagtatg taataaaaat
   103561 atgtgaatat atcaatgata ttttattata tcaaaaatgt gattataaat tttatgatca
   103621 cttatccaat aagttaatat catttaatga attattagaa ttttgttcat caattaataa
   103681 taatttattt ttaaaatgat ctttacattt gtcataaaat attttattta aatgtgatat
   103741 taactcaaaa aatgtaaatt catacatatt catataatgt tcattttttt tatttaaatt
   103801 aactaaatat agattattaa aagttaatat taatatatga tctaatgata tacaaaatat
   103861 atctaatatt acaaaatcat gatcaattat taatttatca ttagtatcca ttttatgaat
   103921 tgctatttgt ttagttccta ctgaactata tattattgtt tgttttagaa gaaccattat
   103981 tggtatatta tcataacgta tttgtttttg ttttataata tcattttcag tacattcaat
   104041 atatgttgat aaatctatat cacttttttc tattggtatt gaattttctt tattttttat
   104101 tgcatgagtc gttatgtcat ctggatcatt aataatatca ttaattaatt cattaaatat
   104161 acgatcagat attgaacttt cataataatt attgttttcc atatatatag taagattaat
   104221 tacagtatta tcacatttat tctttaatat tacaaataaa atattagata aaattatata
   104281 atcatatata atatattcat cattaaaact atatataaca gtttcattat caaatattga
   104341 atatacaata agtacattat gaaaaataca tgatctaaaa ataaaacatt tatcaatatc
   104401 aaatactcta tcttcatctg gaatatttcc aattttatta attatatcat caggcaatgg
   104461 acgtgttata aaatctaaat ataaatgttt tatattactt actatattta tatttgtttt
   104521 agaatattct attaatattt tatgtattat tggatcaaaa ttaatttcca ttataattta
   104581 aaaatttatt attatttcaa aaatattagt tctattataa atgttaatag gattccatac
   104641 aactaaagat tttataaaag aatatgctaa tgaatatgta ttacaatttt ttttaggttc
   104701 accatttagt tatttgtcat caacaacacc aataccattt aaagctaata aacataataa
   104761 aatatttata cattcaaaat atgttggtaa tattgcaaat tctaaaagtc atgtaacaat
   104821 tagtaattta aaaaaagaaa ttgtttattt agatacactt aatgttaata aatgtggttc
   104881 aatatttcat ttaactaaaa tagttgatag taaagaaaaa tcaattaata cgatagttag
   104941 ttctttagaa aaattatcat ctaaattaga ttcacttaat ttaaatacat ttaattatgt
   105001 tattatagaa acatcaaata ttgttgatca tattggatct actattgaag atcttgcttt
   105061 aatatataat aaattatcat cacatacaaa aaatagagtt agattttgta tagatacagc
   105121 tcatatattt aacacttatt atgctataaa tacagttaaa ggaattgttg attatttaat
   105181 taaatttgat gtattgattg gtttaaataa agttgttgct attcatctta atgattctga
   105241 aggtatgcct ttatcatcaa ttagacctca tatttctata acagaaggga aaatatttta
   105301 tgattataaa tcaaaattat caccattaca tattattaaa ttattttcat tatattataa
   105361 tataccatgt attttggaaa gaaaaacaat aacagatgat ttatctgaaa ttaataaaga
   105421 aattaaaata tttaataatt taaatatttc taatattgat ttaaatactt ttatggctat
   105481 acttaataaa agaaaaatta tatatatgtt acataatatt gcaaatatat atgaaaaatt
   105541 ggatgaaaat aaatataaag cttataataa agcaattaat tctatatatg aacaaggaat
   105601 tataatatta aaatataata atactactat taatagtcca aaattagttg ataatatgga
   105661 aacagttatt agtaaatata aagatattcc aaatataggt gatagtatat caaaaaaaat
   105721 atataatatt atatcaaata catatattga taatataagt aatacaaaag aatataaata
   105781 tattactgaa ttgatgaatg ttttatatat aggaccaaaa actgcaaaaa atcttatatc
   105841 taaaggaatt aaaactataa aagatttaaa aaaaaataaa gataaatatc ttaatagtca
   105901 acaacaaata gctatagaat attatgataa acttaaacca ataaatagat catttatttc
   105961 aaatttagaa tcgtctatta aattatcacc aaataaagaa tggtacattt taggttcata
   106021 tgctagagga aaattaacat caaaagatat tgatatttta attgttgatt ttgatattga
   106081 tgaaatattg aaagaaatat ataaatatgc taaagaagaa gcagtattac gacatggaaa
   106141 aattatgtat tctggtatat ttaaaaaaga taaaacatat tttttaatcg atatatataa
   106201 aactactgaa tcagaaaaat atacatctat tcaatatttt acaggttcaa aagaatttaa
   106261 tattgcatta cgttcattgg cattatcaaa agatataaga cttaatcaac atgaaatgta
   106321 tgatttgcaa acacaaaaaa aatataatat taaatccgaa aaagatattt ttgatattct
   106381 tggtgtaaaa tatgtacctc catcaaaacg tgatatttat actacagtat aataagataa
   106441 tattttgttg taattatttg ctatgttttt tttattttca tatataaaat tttgaacttt
   106501 attattagta acccatacta aaatattata aaatatatat aaataatatt ctctagaaat
   106561 atatttttgt tcaggtatat caacaaatgt atatgatgga aaatatatat ttaaaaaaat
   106621 atttatacca tcatataata tagttaaatg ctttttatta atattttcta aaaatggtaa
   106681 tggatcacta aaatataata atttaaaata ttcatttcca attattttaa aaggtgattc
   106741 gtttattatt tcatttgtat taaaaaaata tttatgacta ttatctatat aaaatatatc
   106801 attatcaatt tcttttaata ctctaaccaa tgtattttta taagtatatt caaatttaat
   106861 ttctgaaatt aatgatttta attcaatatt aatatcagaa cttgtaaatt ctttataatt
   106921 tttaatatta atactattta ttgatatatt tattttatct tttatagcat aattaatatt
   106981 attttcataa gttaatatat tatctaattc taaaacatat ggtattttat cggtatataa
   107041 atctaataaa ctatgtgtat tttttacagc atttgccata ggaaaatcat atataattat
   107101 ttcttccatt gttaaaatat ctatatgatt ataaaatcgt aatactagta tatcataatg
   107161 agattttaat tctggtgtta atatttttat atatgtatta attataactg gtatatttaa
   107221 attttttatg tctatacctt gttttacaat gtattcagat actatttcta ttatcaattc
   107281 attgatacct tttttaaaat ctattctttt aaacatatct tttcttttga ctatgccaat
   107341 taattcatta aaattattaa ctaacactaa tgtgataata attacaatca ttatatttat
   107401 catacgttgt tctctaaatt gttctttttc attatattct gacataaata tattatttgt
   107461 taatctaacg aaaaatagac cagatgtatc aatttcatgt ttatattctt cttgatacat
   107521 caatctatta ttatttatgt gaatcatgta atctattatt aatctagctg tattattaaa
   107581 atcatccata acatttgtat taaatatact atcatatatt gataaataat ctgataaaaa
   107641 taattcagca ttagtaagtt taccataagt ttcatattga aaaatattat ctttatgtgt
   107701 agttataatc atataaccat gtgattgtat ataattagct tcaacaaaat taaacatatc
   107761 tattgattca ccacatattt tacatatagc taaattattt gaaaaagcta tatatttatc
   107821 aataaatgca ttataattat taaaaaaatt atttacttct ttgaaaacta tattataatc
   107881 atctatatgt ttacatggta tatatttata tacatgtttg actggttcat atatattata
   107941 ataatcttta tattctatta atggatattc atatactgtt aataaatcaa ataatctaat
   108001 ataataacaa tgtaaaaaat aacataaaca aaacattctt tcatataatg ttgttaatct
   108061 atttctagtt atataagaaa taatatcatc tatggtattt tgtataatat ctttaacatt
   108121 tgttaaatta aattgtcctt ttccttttat atttacaaat ttagtagaaa ctgtatcata
   108181 tatattatat gacaaattta aattattaag attaatatta attatataat ttaattgata
   108241 atttgatgat gataatggaa caccaattac tctatttaaa ttatcataaa tcaaatatct
   108301 tttttgaaat atatattgtt cataatttat ataaaaatca tcaaaaagat tattatatga
   108361 tatatatatt atttttgttc tagacactgg tttggttatt gtagttatat cagtttgttg
   108421 ttcttgtatt gtgttttctt cacgtttttc aacattccat aataaattta taaattttgg
   108481 tatagcttct attgtaaata tattatttaa taatgtcata taatttattg tatgaatgtc
   108541 tttattaata ctaggttttt ctttttttga tactatttta gaaacatata cattatgatc
   108601 aaatgatact tgagataatc taaatatatt atatacaatt gatggtgcta aattaacatt
   108661 ttttttaatt atttcaaata aaaatctata tgattcatct gatattatac cattgtataa
   108721 tacataatta ttatattcgt ttgggaattc attaataaaa ttattaacat tcaaattatc
   108781 tttttttata taattttgca ttattgttat taattcaatt attttttctt gattagccat
   108841 ttattaaatt gattaatttt gaaattatac tataaaaatt tgacatatat ataaattctg
   108901 aaaaaaaaat aagataataa aatggaatcc aaaaaggcta ctaaaaaaga atcaaaagaa
   108961 aaaattgaaa caccaattaa tgaaaatgaa atagttaatg atattttatc tatggaaaaa
   109021 ttggataaat attttacaga taaaaaattt attaatttga caccaattga tacatttgaa
   109081 tcattggtta gtaaaataga taaatatcat aatgaattga atatgtacat tactacattt
   109141 tgtgttatgc taaaaatgag tgatgacaat catattccat taactgaagt ttataaaacc
   109201 attattgaaa ataccaataa agtatattct gtaaatccct tcatttcaga atcatttaca
   109261 attagttgtg ctggaattgg tgaaaatggt attgactgta atactattgt acatccaaca
   109321 gcattgtgta aagttgcaaa ttatgatatt atgctaatta gtccacaaat tattgttgat
   109381 tatattacac ctagtttgga tatatcatat aaatgtatta aagataaaat tgaaaaattc
   109441 tttaaactag ttaatgaatt tattattcta gcctatattt accacaaaaa taataataaa
   109501 aataagaaat ataattatag aaaaaagaac attaataatc caaatactat atcaaaaata
   109561 gatttacaaa aaatgcaaaa gtatggtgat tttaaaccaa aatatattaa aaaagatgaa
   109621 aaaattgatc attctataac taatgctaaa ttagatttat ctagtattga taattgatta
   109681 tatttttata aatgggtcaa agtattgaaa ttcatccaaa atattggggt gttaatgtat
   109741 cacaagaaat gcaaatttct tatgctgata ttctaaatac attatatact gctgaaattg
   109801 atgatcgtgt tgcaattgga caatatgcaa ctgatccaaa tagttataca aatgttcctg
   109861 aatttaatcc aattattaaa ccaggaggat atactgaatt acatagaaaa tcatatttag
   109921 ggcctgatga aatatgttgt ttaaatgata ttagatatgg atgggttgat gctaatggta
   109981 atgtgacatc taatgcaaat ttaaataaaa ctttattatc atgtgatcca acaacaatta
   110041 aagttggatc tagtaacata tgtgatgttc cattatataa tacatgtata gttgataaaa
   110101 atcaagaata taaaggaaaa tgtggtgtat ggttaaatgg attatttaaa agatggcaaa
   110161 ttgatttttc tataatagca tctattaata aaataatgtc tgaacattgt agtcaaaatt
   110221 ataaaaatga taactgtgat atttggttgg cagctattag aaatagtaca aattcggaat
   110281 attataatat agctgataat gtattatatg cacaaactga taaatctgaa ttatcatgtg
   110341 catttcctcc agaatatatt gtaagacaat ctaataaaat taatacacca aaagaatgtt
   110401 ggtatcgtcc atgtgcattt tcaccaaatt atttattatt atcatctaat attgacaata
   110461 aaaataattg ccttttaagt gaatgtaata taaatattaa taatttaaat attatttcta
   110521 atacagaact tagtattatt tgtaaaaatc aagtaattta tagatcatct aaagaacaaa
   110581 gtaatattat tcaagaagaa gctgaattta atagatttct tattcctaat tatactgtat
   110641 attttatatt aatattaatt tttttaataa tgattatatt ttctaaaaat taaaatattc
   110701 aatttctgta aaatgtttat tattatgatt tatattacta tttataaatg ttatatcttt
   110761 atatataaat ctatttggtt tactaaatcc attaaatata tgaaatttag gtttaacttt
   110821 cattactcta gaaaataaat ctttacagcc taaattatta tctaaaatag cataaggtgg
   110881 gtaagctgta tataatatat cacattgttg aatatgattt cttatttctt tatcattttt
   110941 attaatatag gcaattccag ataaagcctt atgtatatga gtattattaa ataattttat
   111001 atttatatgt gactgtccat aaattttaat tggtttatta ttaaaattga ttgttattag
   111061 atcatccgtt aatacatata aattatattt attatgtgaa taatttttat tatatgtttt
   111121 taatatgcta tgtcttaata tttttctatt atatacatga tgatgtaatc tatcattaaa
   111181 tgtatcatca aataatatat ccttatcacc aggaacaaat ataacattat caatattatc
   111241 aatattatca aaaaaatttg atataatatt atgatcatgt aatggtgtta tattactaac
   111301 aaataataaa tcacattttt ctggcatttt tacattacgt ggataattta aattactcat
   111361 agcaactata tgcattttat tttattgaaa atatattaat ttttataaat ggatatagat
   111421 gaaaaaatca aaaatattat aaataatggt atatatgaag aattacccaa agttaactca
   111481 attccacaaa tcgtaattca atcagaattt ggatcaccta aagcatactt tggcattaat
   111541 tatcatatgt tatcaacaat tgttgaaatt caggatacat ataatgaaaa tcaaaattta
   111601 ttatattttg ctcaatatga taaagttatg caatctaatg aaaaaataac ctatgatatg
   111661 acctttccta aattttttag agaaggaaca tctattgaca aaagtggttc atcaatgaca
   111721 aataaaacat atttattttg ttctgatctt attacattaa atttattata ttttatatct
   111781 aaaaaaagta atatgagaaa tgaaatgaca tttagattac caacaattac atctacagct
   111841 gttattcatt atattattat attatcttac atgtttaata aagttgctat taaaaaaaat
   111901 gatatgtggt taaccgataa ttttattgta gaatgcaatc aattaaatat ggaaagatat
   111961 aatactgtta atcatcaatt aaaagcttta aatattaatg aaaaaaatag acaaataaaa
   112021 ataaatggat tattttcaga ttttactatt gatgaaattt ataaagataa aataataaaa
   112081 ttaatcaata gtattggagg atgtgcttca tatttatgga tttatataat tgttaatatg
   112141 aaagaatcac ttaaaggacg ttcaaataaa ataaaaaatg aatatgataa attgttaaaa
   112201 attaaagaat aaaaaattaa atataaatcc caatagcttc taaaatatta tcatctttat
   112261 caataatata aaatccatag agaaatatat ctaaatcaga tatattaata gatatatcac
   112321 aatccatttc attttctaat tttacattgt catatgtaaa aaatgttttt attatttttt
   112381 tattattata aatataataa tcttttttat tttctattaa tgaatctttt ttagatgtaa
   112441 atttaataaa ttcattaata atatttgtga tttcagcatt tgatattcta tgaaatacat
   112501 tacctttatt aaataatgga atgtctatgt catttattac atcattttca ttaacataat
   112561 tattatgcat catatatgta ttatatattc catttagata aaatgtaaat cctagatttg
   112621 aattaaaata accttggtaa ttcattttca tttaatatta ttttttcaaa atttaatata
   112681 ttccaattaa atcaatatct tttgtatcaa tactatatac cattattaag caagtcaaat
   112741 tagatccatt aataggatga ataatgactt catatggtga tatataatct gaacatttag
   112801 aatattgaat agtattatat tttgttatag aaatatatcc atttggtaaa ataaaattgt
   112861 tatatatttc aaaaattcta tttttatatc gataatagga ataattattt tcattatagt
   112921 tgaataatat tatttcatca tcatttttat tatttttaat tatatttatt atcttagtta
   112981 aatagacatt aatatttata ttattatttg ttctataaaa taattttatt tttatttcat
   113041 tactatatat aattatgtca taattaccat taagtgaaac atcacatcct tctaatttaa
   113101 aatttccaac taaatacatt atttatctat atattccaca tgcatctaat attccagtca
   113161 cctcatcata tattttaaat gcataatatt tcgatgattg tctgctatca aaaattggtg
   113221 tagttattac aatattttca ctgtttataa aatcaaaact aaaattagaa ttattgtctt
   113281 tttcatatat atgaatataa ttttttatca atctttcata attataaaat ttaaatattt
   113341 ttgttttata cataaatttg taatcataaa catcgttttg atgtacttta gaaactacta
   113401 tatttggatt aggaatgtta cttataaatg tttgatttat ataaatatta attaattctt
   113461 taacattttt atctgtaatg cttaaaactt tacctgtttt atatatagaa atattatctc
   113521 gtaattcata tgtatcataa tagggatcaa ttattttatt atctatataa aatatatcat
   113581 aatttcctaa taatttaaca atttctatat tattggtttt atatatacca ttaatataca
   113641 ttttataaaa tatactaaaa atacatagaa aagttataaa aaaaaatata ttcagtcaat
   113701 tattttatgt atctcttgaa aaatagtatt agatacatct tcactaattt cttcttctct
   113761 aaaatcaaaa ttaaataatg acatagaatc aatctcaata tcatcatcta ttgatattgt
   113821 agattcatca tcatcgggtt cttttgaaaa agattttata tccataaaat cataattttg
   113881 ttcaggtaca tcaatattca taaaatcatc attatgaaca ggtacatcat cgtcaataat
   113941 aattgaatta gcaatattga taacttcatc aattggcata gaattgatta aagaaacaat
   114001 aaaatgtggt tcaatactgt ctgtattttc gttattgcat ggttcaggac atttctttgg
   114061 tgtttttttt aaatatttac atttcctttg caactttctt ttttcattgt tttttaattt
   114121 atttacagat tgaattattg catcaaagtt atctatttgt ggtttttcat aaataacatg
   114181 tttagtttcg taatgtagag tttgtataga ttcataacaa aataaattca atttttcatt
   114241 gatttgcatt tgtttttttt tattaactcg tttttgattt tttttaatga tctgtatttg
   114301 ttttttttta ttaactcgtt tttgattttt tttaatgatc tgtattggat tttcattttc
   114361 taaacaaatt ttgtaatttt taacattaga tggtgatttt agatatattg tatctattat
   114421 gtattttatc aatccattta aattgcattt ataataacag tcatcatatt tgaaactaat
   114481 gagttttttt tgtatttttt cgaatttttt tacaatttca ttttcaattt tgaatgttgc
   114541 tatcatgact tcatcttctg attttttttt atgtttagtg atatcattta tcatattgat
   114601 acaatataat ttttgtttaa tcatggtttc atttgatgag atgtaaatcc atccataatt
   114661 ttgcaaataa ttatttatat atttaatgat atcatccaaa tattttatat ctacatatat
   114721 tccagatttt ttaaatggat gaattttaat ataatataca tcaggaagaa atttattaat
   114781 atctatttta tattcactca ataattttga caaattgaac aattttttat ttttgttata
   114841 caaaataaag tagtttttgt ataaatactt tacataagaa tcattttcat caaatctttt
   114901 atatacatgt atttttctca aattatagta accgctggcc attttaatta aatgtaacat
   114961 atttattcaa aatattgtta cagtcagtta taggttcatt atttaatgct aaagcttgcc
   115021 ttgattcacc tttatattta taatacaaat tatcaccatt acaatataaa ctactattaa
   115081 ctatttcttg taaagtatta tctaatgcat taaattgttc aatatcatca tcagtttttt
   115141 gaggtcccac aaaataatta taaataaata ttaattcttg ttgaaaaaaa taaaataata
   115201 aaaatattat aaaacatatt tctattaatg ttataatata tattgtaaaa tttccataac
   115261 taaaatattt ttcataatcc cataatataa aagttggatt aagattaata attttttcat
   115321 ttggcttttc tttaactaat accatttaaa aatatcaata aatgagaaaa aaatatatta
   115381 aatattataa tgttattaat aataaaattt atgatgacaa aaataatgaa ataattaatg
   115441 aagaattgaa taaaataatt attaaatata aaccaccatc acatttacat gatattaagc
   115501 ttatagctaa aaatattaaa gaagctgata atggtatagt atatattgga ttagattcaa
   115561 ctaataaaaa acaatatata tatggtataa attttgtaac gaatagaaaa aaaaataaaa
   115621 taaaaacatt tttaaaagtt aatcaaaaaa taccagatat agaacgatat ataaaaaaag
   115681 aattagatat atttaataaa agcgataatc caaaaatatc tattaataca ttatttgctg
   115741 taattttatt aatggaaatg aattttttta taagaaccgg taaaaaaaaa tatttaaatg
   115801 ataatgaaac tattggacta ttaacattac aaaaatcaaa ttttactttt aataatgata
   115861 aatatattga tatattattt aaaggaaaaa agaaacaatt acagcaattt actgtagata
   115921 aagaaaatca taaattacta tataaaatat taaaattgct tataaataac acagaagatt
   115981 ttatatttaa aacaacagat aatatattat tttctgaatc aaaaatgtat caaatgatga
   116041 aaatgttttc aatttcttta aaagatatac gtacatttgg tgttaataga attttaataa
   116101 atgaattatg gaaagcaatg caattaatag atatatctta tattaaaaaa aatgatatta
   116161 gaagaatgat aacagatgtt ataaataaaa ctgcaaacat tattggacat acaccatcta
   116221 tatcaaaaaa atcatatata gttgatgaac ttagatcaat aattactcca gatttattta
   116281 tatataaaga tacatctttt aaagattttt ataatattat aataaaaaaa ttaacagaat
   116341 ctatataaaa aatttaatat atgaaatttt atttataggt tctaattcta aaaatattat
   116401 aaatgtatcg atcattataa atattgttat aataattgct attaatttac taaaaatgag
   116461 agttaaccct ataatatcaa aaattaaacc acctatataa gtatataaaa taatatgtaa
   116521 tgttatttta ataattaaat gtaacattaa catagtaatt aaacttataa taataattaa
   116581 tatattatta taaatcattt taaatgaata ttatacaagt ttttggtatt atattaataa
   116641 cgtcagcatt atgtttcatt atatttcaat tatggtatta ttatgaaaat tatgattata
   116701 taataaaata taatgatgca tatggaaatt tagaatatag tcaaagtgca aatataaatt
   116761 atcaagatag tacagtatat gatccaaatg atactgaata tgatgttaat aaaaaatgga
   116821 gatgtgcctt gaataattca atatattatc cagtatctga atttggattt atgagcactg
   116881 atagtacaaa aataggttta acatatacat atttgaatga ttgtttatta aatttatttg
   116941 atacacaagt taaaataata tataatccat gttcagtatc aaatacatcg aatgattgtg
   117001 ttttattaaa taatctatta aatggagtat aaagtagatg aagttggaaa aattatcatt
   117061 gatagaatat caataaaaga aaaaaaaata acaaaattgg taaatatgtt caatactata
   117121 ttacaaaaaa aaagtaataa atattataaa ttaacacata aaatattata taataaagaa
   117181 aaattagaaa aatattctaa aacagtagat aaagatgtat taatagataa attaattaca
   117241 attttattaa tatatgattt tatatataat gtatttacat ttgaattaga aaatatagaa
   117301 aaagaacaat ctaaagcaga gcaaaaattt aaaaatattt tgaaagatat gagtaaaata
   117361 tttaatgaaa taagtaactt atttaataat ttcaaaataa aattttaaac ttctcttctt
   117421 ggtctagaat atccaacatt cattgatatt ttatttttct ttttaacagt tttaataaat
   117481 acaaaataaa caactagaat tacaaaaaat atcatagata ttgaatgaat caaagcagaa
   117541 acactaataa ttgtaaaaaa tattttacta tcttcaatag gaaaagaatc aataaatgaa
   117601 ttaattttat tagcaaatgg attaactaaa cgtaatatag ttgatgcacc taaatctatg
   117661 ttttctatag aatctacaac gttgttaatt gatgcaataa ttttttcata ttgtccattt
   117721 aaagatgtta tattaatttt atcaatagct tcaacaatgc tttgagtatc aaatttaatt
   117781 tctgattggt taaatggtaa tacactaggc agagttgtat tagcttttgt tatgtaagag
   117841 tttgatagta atactaatgt gataattgcg aagtatttca tttaatataa aaaaaatatt
   117901 taaaccaatt tatttatatt ggatattata tcttcttttt tagtaatttt tattatagta
   117961 cagttatcac tatttggttt agatgcatac tcatttgcaa tagaaatatt agtattaaaa
   118021 gatggtttat ttatcgaatg tattccatct gtagtcataa ttatagtatc aaaatcattt
   118081 gtatttaata tttttatact aggtatactt attaatgttc ttacattaat tttatttttt
   118141 aattcactat cacctaatga tctagtaact gataatattc catcatatct tggtatatta
   118201 tgtactattt gcatattaaa taaacatcta ttatattcta tagaattgta aaaattatgt
   118261 tctggtgttt catataccat taatgaatct ttgaataata ttgctttagt atctccaagt
   118321 tgtaatatgt atgtagtgtt atataatatt attatcatag taacacatga acctgaattt
   118381 atatttttag atactatttt attatcaata gatacaaata aactttttaa ataattttga
   118441 tttatattac tacaattaaa tgtattttca aataatttta taaaatattc tatacatgat
   118501 gtaccattat gtccatcaaa tattgcaata acattacatg atttaaaatt ttttatatat
   118561 acataatctt cattataatt ccgactacct ttttttgaag catattctat tttgaacatt
   118621 tacaggtata tatatttttt catattaaat ggataaagat atcttaatga aacatttttc
   118681 agtattaaat ttcatatcaa atgatatgtt aaatgaactt ttaaataaac aacgtggtgg
   118741 atctaataat gattttctaa aacaatattg ttggaaaaaa attaaaaata cagatattta
   118801 tgcattagtg tattatgata atgataaaaa aaaatattat gtatctaaac tcgaaaaaac
   118861 attaccaatg aatcaatcaa ttgatcaaca atcaggatca gctattaata aagatgatat
   118921 tgatattggt gtatcaactg ctgaactata tggtggtaaa tctacaaaaa atactagaaa
   118981 aactaaaaca caacaaaata caaacactaa cactacaagt aaaactagaa aatctaaaaa
   119041 aaatacaaca actaattata aacaaaattt atcaggtgat atgattcctc ttgatgaata
   119101 aataatgata tattattata ttaatgataa taaatatatt atatttggac caattgcaca
   119161 acaatatatt gataaatgta aattacaacc attttgtgtt ttaaaaagtt ctaatagaaa
   119221 atataaatta tttggatcat tattatatat tgattttatt aataaaaatg tattttggga
   119281 acattcatta cataaatatt acaaattata tgttacatct atagcaccat atggtaacaa
   119341 ttttattata aatgaaatgt atccagcatg ttcaataaca tcttttatat ttccacattt
   119401 aaatttaaat ttatataaca taataattcc atcaacatgt gaacataaaa ataattgtca
   119461 taatagatat tgtaaagaac ataattctca tttgatagga tataattttc catttgctta
   119521 taataaacat aacattaaaa caaataaatg ttaataaata atatgaaaac cgaaattaag
   119581 attgataaag atctaattaa taaattaatt aataaaatat ataaagataa tgtaccaaga
   119641 aattcaatat tgacatattg tataaattta ataaaagatg gtgaaataaa aaatgaatat
   119701 tataaaatta ataatgtata taaacgagat gacttattat tatatgataa aacgatttgt
   119761 gataataatg aaattattaa tgtaaatacc attggaaatt atagtccatt attagaatat
   119821 tttaaattta aaaatattaa atatgaattg actgattcac ctaataaaga tttatataat
   119881 agaagtgaag aaatattatc atttttatta tcaaatggac aatttaatga agattgtagt
   119941 tttatatcta ataatgatat aattttttat aattatataa atgatataaa aaataatagt
   120001 aataatatat gtgaaaaatt atttttattt actcaaaata aaaacataga tcctgatttt
   120061 ttaccaaaag aatgtttaaa aaacgtgaaa aataagatta ctattaatat acagttataa
   120121 atgaaaatcg agtatataaa taaaaatata tgggattttt tatcagatat agataatatt
   120181 tcattaattg tctttatatc agcagattat atatcttctg atgactattt taaatatatt
   120241 aaaaataaat ataattctat taaaacatta aaaaatcaaa aaaaaactaa aggtgaagta
   120301 tcttatatat ataaatataa tgtatatatt tattatattt taatatctga ctatattgaa
   120361 gatattgtag atgatattaa tattagaaga tcattatcta attttaatga attaataact
   120421 acagataata ttgcaacatc tatgtctcat atgaaattta tattaccaaa ctataataat
   120481 actttatctt acataagtga tcatatcact aatataaaaa atttatatat ttgcttataa
   120541 atggataata taaaaaagaa acaaaatata tatggaataa caatatttga ttataataat
   120601 attttaaatt acaatgatga taaggttata aaacatatga ttgaaaataa acgtatagat
   120661 gatcaagatg tatatataaa taatatatca aaattaatat atagtaaaat aaatgataca
   120721 aaagaatctt ttaataataa aattaatttt aatttattat attcaagaga taaatatata
   120781 aatggttttc aatcattgca aatatttaat atatatactt tcgatttcaa tgaaaatttt
   120841 ctttatgtag atatttcatt acccagttta ataatgcttt ataatttatt atataatgaa
   120901 aaacctgtaa ataaaaattt taattattat gtacaatatc aatcagatta tttagataaa
   120961 ttattagtag aattccataa tgcacctaat agttcatcac ctatattgaa taaaatatta
   121021 tatttaagat catttcctat ttttaattat ataatggaaa aaatatcaaa taattattta
   121081 aatgataata atagacattt attggataaa gaatatgaaa atgatattaa taatccagca
   121141 tttacaaaaa atatcacatt tttaaattta ttatattttg ataatataga atattataca
   121201 tataatatta aaaatttaat gaataataat acaaatattc tatcatactt aataaatatc
   121261 ccaagtaata ttaattattc agaaataaaa aatataatag aaaatgaata caatgtagat
   121321 attatttatc aaaatgcatc atttgatgaa aattatttaa aattacatat aataaaaaat
   121381 gaatttttaa atattacaaa tattattgat acagatttat attttgaatc taatagattg
   121441 tataatttaa atcgtatttt attagataat ataaaagatt ttgaaataga tataatatca
   121501 gaaattggta attataataa tgatatatta aattcattat atataaaagg cttatataga
   121561 ttttatcatg aacttttacc attatgttta aaattttata tagatggata ttcaatatcc
   121621 catgaatcat ataaatttaa ctataattat gatgaagatg aaaatattag ttatacaatt
   121681 aataatatac cattaattaa aaatataaac aataataaaa ttaaatttat taatgaaaca
   121741 tttaacaata taccatctaa tattagttat aataaaatat tttttacaaa tctattttca
   121801 gaaaatatat ttaagtttaa aaataaatat atatcaatga tgttttgttc tcattttatt
   121861 ttaattaatg agttaccaac attaacattt aaatatatta aaaatgacaa taatgatata
   121921 tatagtattt taaattcaaa taatataatg aaaaaaaatc atatggcaac tgaaataact
   121981 agatatattt atgataattt taataaaaat aataatagat atgataagct tttaaatata
   122041 gtaaaagatt gtgtttcaaa gaataaatta ttatttccat tattattatt atacattaaa
   122101 aatgatattg ctatagatat tttaatttta ttttatgaaa atgataatat tttaaaagaa
   122161 ttaactgaaa catatgataa atttattaat actatcaatt ttgtatcata tttaaataat
   122221 aatataaata aaagtttaac aacatttcta ttattttcaa atgacaaagt aagagttaga
   122281 tataatataa tagattcatt tacaaaatta ttttcatctt tatataatcc aaaatatgat
   122341 attatattat cactaaattc tttatgatga aataaaaaat attaatagta caattgtaat
   122401 tggataaata aatgatatta ttaaatttgg aatatcatca tcttttaatt taactatagt
   122461 ttgagaatat tttgctattg ggtttaaagt agaaatacaa ttattagttg ctgtaaatac
   122521 accattatct tttaatgtaa tttcaccaaa acttatttca catacagtaa catggcaata
   122581 tttttgttct tctttaatta ttgatgtttt atatgaatca gctttattac atggtgcata
   122641 ccaacaatat ggcaacgaat atgatgattt tgtaaaaatt ttaatatcat tacttaataa
   122701 aatacattga cattttgtat cagtcgtatt ttgattacaa tattcaatta attttttatc
   122761 attttcatat tcactactca tttattttta ttaaaatcct ccatatatat ttgtattttc
   122821 tataaaagtg ttataattca tatatacatc attagttgta aaagatgcat taaatattga
   122881 tttaaatata tttttataca ttgaaatttc tatatgctca ccttttcttt tatatctagg
   122941 aaatattgta tattcttcaa taaatctatc atcttcaatt cgcaataatg caaataaata
   123001 ataatataaa tccatagcaa attcattatt tttatgcaaa aaattatata atgatatagt
   123061 tgcaataaat gatactaagt ttttcattga aatatctact actttatcat tttctacata
   123121 aagatatgta gatgtagtta aattagtaaa tattagatat tttttagtag tatcaatata
   123181 tatatctatt tcgtcattgg taacatttat ttttttcata gtattttcat caattacata
   123241 tggtgatttt tcacaaacaa cattaccagc aataatatcc atttttgata ttttatcact
   123301 agatatcgaa gtttcaaaaa atatttcatt taaaaaagat ccatatttca tactaaatcg
   123361 gcctttaatt ttagataaga atttcattat atgatcgggt gaattccata ttacaattac
   123421 ataatcatat aatgatgatg gtataaattt tttaatatca atagttaatg atgtattatt
   123481 tatagtatat ggaatagatt tttttgtata agtattactg aatatttctt ttaaacgttt
   123541 tatattgaac atactatttt gtataaaata ttcaattaaa ataatatatt ttttatacga
   123601 attttcaaaa tctttagtta atttgaatga tctaaaattt tcagataaca ttctaaaatt
   123661 atttaaagtt tgcattcctg gatcaataaa ataaatatta ttaatcatta ctttaggaat
   123721 attatcaatt attttttttg gaagaaatat acaatcaatt aagacaacat ctttatattt
   123781 taatgatata tgtccttcaa taaatggaat tgaaaatata tatacatcat acccaattaa
   123841 aaaatttatg atactcatga aaaatatcat taatttgtaa gcattaatac tgtataaatc
   123901 tatatcattg tattttatat tagaatctat attaaaacat gtaaatgaac cataaactaa
   123961 acattcatga ttttttatta ctagtatagt ttttaatata ttttctaata gtttacatat
   124021 atttataaca tcatcgctaa catttttatt tttaggaatt tcttggtttt tattaattaa
   124081 tctagatcta cataaataat tactagttac ttttaatata ggtgcaatac tttcatcact
   124141 tttttttact gttttagatg ttattgatgt aaaattcatt aattcaactg atattgaacc
   124201 attattatga tcaataatat cttctaataa tctatttaca tatgttacta ttaaatgttg
   124261 aaattttaaa actgctatta ttgatccaat tttgtcaaaa gtattttgtt tattaaaata
   124321 agtatatact cttcttttaa tatcattatt ttttgaaata ttaataaaat cagttatata
   124381 tatatctttt attattatta attttttaat aaattcatct ttatcaaatt ttactatagt
   124441 atctatttgt tgtttatatt ttattaattc attatcgaat tcccttgtat taatgtaagt
   124501 attcatattt attttttatt tttattttaa taaatacaat gcaaatattt ataaagacac
   124561 taacaggcaa aactataact atagagattg aagcaaatga tacaatttct aatttaaaac
   124621 agaaaattca agataaagaa ggtataccac ctgatcaaca aaggcttatt tttgcaggaa
   124681 aacaattaga ggatagtcga acattagaag attataatat tcaaaaagaa tcaactttgc
   124741 atttggtttt acgtttacga ggtggtatta aaaattcata aaaattgatt gtaaataaat
   124801 atcactacaa ataattttat ctgttatttt tttataagat tttgatgtta atgcttcata
   124861 taaattattt aaattggatt ttcttttaat gtgttccata tattgtttcc taagatttgt
   124921 aatattttta ggtataaatg aatattcttc aaataaaatt tttaatatac tagatttaat
   124981 tatacttaat tcaaataaat cttctattat atcatacata ttattaaaat caaattttac
   125041 atattcataa ttgtatagta cattaaaatc actaacatta ttatttatta aattataagt
   125101 attatataat ttaatatatt tatctatata atctaatcca cattcattat ttttataatt
   125161 taattctatt ttcatgttta aatctaatat gtctttagat attggattat tataaaataa
   125221 aaaattaaaa aattttttgt taaattttaa tttattaata tctacatcaa aattataaaa
   125281 atatcctttt ggttcaaatg gtttttttgc tatagattcg atcacattaa tataattgtt
   125341 ataaacattt tcagatgtaa cattaatttg tccaatctca taagtaattt taggttcatc
   125401 atgatttaaa atttcatcta tagcaatata gtttttattt attaacaaat ctgatataat
   125461 accagataat tctataggta tattttttat tattgcaaat aattctttta ataaatcttg
   125521 tcttaaaatt ttatatccaa ataagtacgt ccaaattatt atattatgag taacaaatcc
   125581 atttcttata tatgaatata aaattgaaaa aaaaacatcg ttaaaatttt tagcatatcc
   125641 atcatttttt aaattttcaa atgattctct agatttccat aaatatcctg gatctaaatt
   125701 agaatcagaa actttaaatt tatattctat agtttttaat gatgatttaa ataatggata
   125761 ataattagta tttatataac taaatatgga tctatcatta ttaattattt ctaataaatt
   125821 atcaaatgtt atatctattt ctgcatcatc atttgttaaa atagaaatag ctaaatcttt
   125881 tttagaataa tatgtaaata ttaaaaattc agtaacttta ttgggatcat agtatttata
   125941 tgtaacaact tttgataata aactacttac gtttatattt tttatattat caatatttat
   126001 attacttggt ggcacattgt aaactttatc ccaaaattta tttattatat aatcagataa
   126061 atttttataa ttatcaatat ttattatatt atttatatat tcctttaaat cagttgaatt
   126121 cattatctga cgtaataaat tatgaataat taatttataa tttttactaa ttttatcata
   126181 tatatcatag ttttgcattt caatgagtaa aatgtaaaaa tatgaattat ttgttataca
   126241 tacattatta aatattttat ctattccata tttctcaatt aaattattca ttattggtgt
   126301 atataacaat gatgatttag ttattttatt gaattcattt tccatttata ttatatataa
   126361 tgagtgtgtt aaataaatat actattgaat atatatgcaa atatctttca cctaatagta
   126421 tattaaattt atcattagtt aataaacata tatgtagtat aatacataat gaattatata
   126481 atataaatta taaaatatct aatagaaaat ataatagatt atctgataaa tttgaattat
   126541 ttttaaatat taatacattt aatataatta gaaatacaat atcatataat ttaacatcat
   126601 tatctatttc aaatatacgt atatcagatt gttgtatatc acaattatat aatttaaaaa
   126661 atctaataat aaaaaaatca ataattgatc aaaatttacc tcaatcattg aaaagatgta
   126721 ttatgattga tgttgatata aaaattaatg atgtaataaa aaatttatat aatttacatt
   126781 cgttaggatt aactattaaa aaaaatataa aattagattt tccaaattca ataactacat
   126841 tatctataat tgaatcaaaa tttacaaaaa taaatattaa taatatagtt aataaagcta
   126901 atatatattt attatttaat agaaatttaa caaaaattaa tttacctaat gaatcatatt
   126961 taacaatagt aaattgtaat aaattaaaac aaatatatac caatgaatat acaatcatag
   127021 atacatataa aattaaaaaa atattaaata ttgaattata tcataaatat ttacttaaat
   127081 ataaatctta ttaataatcc attttttatc ttcatcatta tctatttgtt ttttaatatt
   127141 ataatattta tcattaataa acatacgaat tatattatca ataaaagata tattataata
   127201 gtatacaaat ttattatcat ctttaacatt agttctaaat attcttccta tagcttgaat
   127261 aattgtttta ttattagtaa taggtaatgt aatatgtaaa gtatttaatg attgtaaatc
   127321 taatgattct gaacatgctg ctattgttga tacaataata aaattatttt tatttctagc
   127381 ttcatttaat gaacttacac tatttttata ttgtttaaca tcatataaat aaacggaatc
   127441 attaataatt gattttaatt tattatatag atatatcata tggtctctat aatcagttaa
   127501 aattaatgct tttgtgtcat catgaaaaca tttatgtatt atatcaacta tacaattatt
   127561 tctcatatca tcttttgaaa tacacatttt ataattataa tttttcatat acacttcttt
   127621 aaatttatct tgtttaattc tatttaataa tatattaata gaattattac taaaagaatt
   127681 atttatatct tttgattcaa ctgaaactaa tatattttta gtttggtttt gttcaccatt
   127741 agcttttatc atatgtgtta caaataaatt catattatcg gctggtgttg ctgttaataa
   127801 tagacacatc ttaaaataat ttttatacaa gaacttagtc attaaaatat cattatttaa
   127861 attatattta tgtatttcat caattataat aattgaaaaa ttttcataaa tatagttata
   127921 tatttcatca ttttgtaaat gtttatctgg acatataaat atatcacagt ctaatccatt
   127981 tttaatatcc tttaatgctt ttttaatacc atctatagat gaatatattt ttaaatcttt
   128041 attaaatatg ttaattttat caacccattg actaacaata aatttcattg gtgcaattat
   128101 aacacattta aattttaatt tattaataat agcaattgac aatattgttt taccaaatcc
   128161 acaaggacat actaaagata tgtataatgg tttatttgat tcattaatat tataaatttc
   128221 taatatttta ttaaatatat gtttttgttt atgccttaat tctaaatttg aaatttctaa
   128281 tgattcatta gatattgatt ttaaattaaa agatatttta tcataatttt ttaacatacg
   128341 tggaggtatt ctaataagtg tattattaac tgtattcgga tcattatata ttattggatt
   128401 catataaata tcataacaaa gaacagaatt attgtttatt ctacttctta atgctgcatg
   128461 taatgcaggc gataacttag aatatagcat ttaaaataat attgaatatt taataaagga
   128521 aataaatgga gtctaaagta ttttttcacg aaatatttac tataaagtta ataacaccat
   128581 tagccgaaaa aataggtaca tgtattaatg ctatttacaa tgataacata aaacttcctg
   128641 tattttcaaa atatataatt gatagaacat attctttaag tataccattt gaaaatatgg
   128701 ttaataattt aaaaaatata agtaggatga ttccttattt attttcaaat tattttagaa
   128761 atactaataa tttaggaata aaattacatt taatttctga tggtactaaa tattatttaa
   128821 catgtaaaga tttagaatta tttatatttg atgatacaac tggtaaaata acaattattg
   128881 aaaaacctaa gtatgctgat aaacatatga taggatgtat ttctgctaat tcaaatttaa
   128941 cagaagaaga aaagaaaaaa tataaaagtg aaggatatat tttattattt acatctacat
   129001 caaatattga aactaattat aatttacatg atgaaatttt aaaaacattc ccagattatc
   129061 ctatgaaatc tattactaat gaaattgaaa attctagaca aaaatatgaa ccatcattta
   129121 ttgaatacga tacaccattt aatttatgga taattgtaaa taaagaagga acatttttaa
   129181 atataagatt aaatcattac tttgatatag ataaaaatat aataagaaat tatttattag
   129241 atatttttaa aataattaat gatatattct tcacttctac tgataatatt tatcaagaaa
   129301 ttaatgatta tataaaagat ttagaatata atggtatata tgatcataaa ttaaattatg
   129361 atataataac agttaaaaat aaaattagta caaaaatatt tgatgcatta tgttatgtta
   129421 atgatattcc gtgtaataat ggattttatt taaaacctag agatactgaa gtaattcaat
   129481 cagaaaaact tacagaattt tttagaaaag aaatccaaca tatatctgaa gaaataacta
   129541 atcattttaa ttcaatttat tcacataatt aatatacatt gtgctaatat taataatttt
   129601 ttataattta tatcattgat atttataaaa tatacatcag atacttctct atttggttta
   129661 aaatataata atatatcata tgatgttaat ggtatatttg ctatgaaagt tatatcatga
   129721 aatgttttat atactatttt atcatatatt gttgtatcag cataatatgt ttttgaaaca
   129781 tctatattat ttaaatttat atttaattct tcttttgttt cacgttttat tgtatctata
   129841 atagattctt tattaattgg ttttccacca ggtaaaacta atgttttatt aatttttttt
   129901 gttctattat ttatatcttt ataatcaatt atattaaaat atttatttat attatcatca
   129961 atatataatt tagtaaaata atgatattta gttaatttat tattatcgtt acagtttaat
   130021 aacattattt tatcaatatc ttttattttg ttattttttt tgagatattc taaaaaattg
   130081 ccaaaatgtg tagaaataaa tttaattata tttttatatc tactatcttt aggaatacct
   130141 tttaaaatat aaaatttttc atctatattt aaattttgaa ataagcaaca aaaatatcta
   130201 agtgttgtat ttgatacttc ttttttttta atagttaatc tatgtaatat atcaaaataa
   130261 taactatctt ttcttttacc aaatacaatt ttatcatcag ccgttataaa tactatatta
   130321 aatgttgtat ttttactagg ttcaggtata ttctcaaacc cataaaaatt tttaatttca
   130381 ataattcttt tttcagaata agtttctatt tcataaattt ggctagacat aataacatat
   130441 ttataataat atatttattt atatcaaatt tacattaaaa taatttttaa ttcctattcc
   130501 aacaatttga ataccaatat ccataaaagg tatatttggt gtagaaacat aattattaat
   130561 aaatgtttta gttgtattac atttattatc tataaattca tcagtaataa cagataccat
   130621 atttttaaat tcagttaatt taaatacgtc aactaaacat ttttctatac atacaaatat
   130681 taattttata ataatcattg atgtattaaa tgattgttta tgaatattta tatttttaat
   130741 taactgataa atttcttcta tttcatcttc atccatatat ttaaaatcat caatagataa
   130801 tgtaatatct tgttttattg caaaatttaa tatttccttc ttcttattta atgattgttc
   130861 acaaaatcca ttaagtttac ttataagtaa ttgcatattt tttgatttgc tagttttata
   130921 ttgttgtttt tttaattttt tattttcatc ttttagttgt tttaataatt cagtatttga
   130981 tggaggtcta attggtgatg ttttttttgt aaattgtgat gattttgtat tttgttcatt
   131041 aaatatattt atttcagttt taatggaact ttttgaagat ttattagatt tagttataga
   131101 aacactagta ttataattaa cattatcatt atcattatca ttattttcat tattatatat
   131161 agtttcatca aataatttat ttaattcatc attattatct tctatatcat catcaatagg
   131221 tattaatttt gaaataattg tatttgtatt agagttatct ggttcagtat ataattcttg
   131281 aacattgtta atatattgtt ctttaaaaaa ttcaggataa tatccaggat aattactatc
   131341 attttctaaa tctacattat tattgttaat attttcatat tcaactttag atattatcat
   131401 ttataatatt ttttattgtt aaataaatga aagataaaaa taatcatata aattacttat
   131461 tagacaatgt tttaaactat atagattttt atgacacact ttctaaaaat aatgagatta
   131521 ccatcaatgg aaaacagtat aaattagatg aaatactatc aaaaacttat atgcatccat
   131581 tagatacaat aaaaatacaa aatacaaatg ttatatttaa aaatgaaatt tataatcaat
   131641 ttatgataaa tttatttatg cattataata atccagctat gaattttact cataatttac
   131701 aaaatataat taataataaa actgaaatat taccagatga attatcattt tttaattaca
   131761 acactgccaa ttatttaaga tatagattta tgtatgatga taattcatct ggattaagag
   131821 gtggtatgct tattgacaaa actgaagatg gatttatatc atataatgat gaaagtgcta
   131881 gttatattgt aaaaaaaatg gaaaactata tttctataat taatgaagat aaatatgatt
   131941 tttatgttac atatcacgca tttatagatt attttttaga aaatgataaa ttgtcttatg
   132001 gtgatataat agacgaaaaa tcaaaaaatg ataaaatgta taataaagac gaagattata
   132061 aaaaatattt aaatgaacat actgtaagta atgacgaatc taaaaaaatt cgtaaaaaaa
   132121 taaaatatta tttgaaattt tttgatacta tcttacataa agatataatc tcattttatg
   132181 aatatatacc attaactaaa attttagatt atattgataa agatactgat attaaattaa
   132241 ttttagatat tttgataact aaagctgaac ctttattgaa tgaaaataat agtacagaaa
   132301 taatcgcata tttatttaat aaaaaacaaa gtttaagact ttatgaaaat aaaaaatatt
   132361 ataataataa taataatgca ttaagtaaat ttgttagtaa taaactttta gatattcaaa
   132421 gaaggattat aaatataatg gaaataaatt cagataataa cccaacagaa atattaatta
   132481 catttaatag taagtatcaa tcacttataa taaataacat ttataatgca tttatatttt
   132541 ttactaatta tattaataat tatttaattg tatacgaatt taatttagat agtccaaacg
   132601 ttaaaaaatt tattaaaaaa tttaatgacc tttgtgatgg aatatttgat gtattaacac
   132661 tggatgaacc attagttgac gatcatagaa tagaccaatt ttttagtcgt tcatttggaa
   132721 aaagggattt tatatcagaa cgttctaatg aacaactaaa tcaaatgatt ataaatttat
   132781 ataaagtatt taatgaaatt aataataaac taaaaaatat tgttgaagaa actaaaaaat
   132841 ttgttaatgc tattaaaata gaagatatta attattataa ttataacaag gataataata
   132901 aaaatgaaaa aaaaataaaa tatgcgatta atgtattatt actttctata tatgtaaata
   132961 ttataaaagg acaacttgat tatgataaat taataaaata tcttaattat gatccagaaa
   133021 ctcttcaaaa agatttattt agtaataatc aaaataatga atttaatatt atattaaaaa
   133081 ataatatatt taaaaattta aattttatag aatctcctga tttaaataaa gaatttgaga
   133141 atgatcacta tatatttgat agtaaactta acgataataa agacaaaaat aataaatatg
   133201 atgaaataat taacagtatt aatgaaaatt ctaaaaaatt attttatgat tgtttatcta
   133261 ctgattattc ttcattattt aaaattactc cacatttaga aattaaagat gaagtatata
   133321 aaacattaat aaataatgca acttcagaat ttgttaaaag tggaaaaata aatatattaa
   133381 acgcatttga actcaaggat aatatatata ataaaattcc attagtatta aatcctgtta
   133441 taaatattaa aaaagaagta aataatttac atgagaaaat atttaaagga gattatgaag
   133501 ataaatataa aaatatatct ataaacaatt acaaatcatt tatatcaatg ttacctacat
   133561 attattatac attattatat aataatccaa ctatattgaa agttacacat aatcaacaaa
   133621 ctaaaatagt taatgataat aaaatatttc atattaattc gtctccaaat atcaattttt
   133681 ttaatccatt tcaaaattct aatgatgctg atttgataat gatagaaaat gaaaataaaa
   133741 ataatttaga taaattagat agtataatat atagtaattt ttggtttggt attccatata
   133801 atgactttga taaattgaca atattgcaaa aatcatttat tttaagatca tgctttacta
   133861 ttgttaaatc tgaacttaac aatacaataa ttcatacaac atatgataat gctttagata
   133921 agggaatgaa tattgatttt atttgtatta ttccatatcc atattctgca actgaaacaa
   133981 tgcatagtat agtaatgaaa gtagttaata gtttaaatat tactgattca atgttttttc
   134041 aatataatag aaatgattat atatcaaata ttggattaga tcaagaaggt aataaaattt
   134101 ttattaataa agttttagaa ttatcatcat taaaagattt agtaataaca tatattttat
   134161 taagagaatc taattctgga aatgctgatt taaaattatc accagatcaa gaagctactt
   134221 ttatagtaaa tattatgaga ttattaaatt ataatgtaac agttacaact aataaaaaaa
   134281 atacttctaa tgctatatat atacgtgtta gaaaagatag aataactgtt gataatttta
   134341 aacgtatttt gagaaaaaat tataatatat ctaatcaaaa aattttaaca gcaataggaa
   134401 ataaaatggc accattattg tcatatatta atcgtaaaaa tttaaataaa aatatagaat
   134461 atgcaggtat ggaaaataat ttacaatctg aagattttat atatccaatt atcgaatata
   134521 ataatccaat aaatatttta gataatgttg atttatcatt tatgaataca aatagtttat
   134581 ttgaattatt aaatactgat atatttgaac cagaaactag actatttaaa tcaaaagtaa
   134641 tagcagcaat gtctagtaat tctaatgata atattgttga tgttattgta gagcatttac
   134701 cacaaagtag tacatataaa aaatctatat gcagtaatat ttatgaaatt attgcaggta
   134761 acaatgaaaa tccattaaat gaaataattc aaaattttat tactccagat tgtgatgaag
   134821 aatcaataaa tattgataat aatacattac taaaaaagat tattaacaaa aataaaatta
   134881 tagcatctgt tgatacagat attactgcaa atatttttaa aaataactta attaaaatta
   134941 tggaaactat aactaataga tatgcatgtc aattaagagc accaattcat tatataaata
   135001 ctttagataa attaaaaaat atattatctt ctgaaaatat aaatatagaa ggtgagttta
   135061 aagataatat atcaggaata atatcatctt tatataataa tacattatta ataattcaat
   135121 atattattat tattaatact atactagaat tatcaagagc atataaacgt gttaataaag
   135181 atattaatgg tactattatt aatgaagatt taatcaatga agtaaaatgt gtatttaatg
   135241 atatattttc taaatatttt aacaatatag aaaatcttag aaataatcct atatttaatt
   135301 catttttagg taataataat agaaatgatg tattacatga atattaaaaa aagttattct
   135361 aatgttttta ataatgtaac atattcaata tttttatcat tttctattaa acttaaatat
   135421 aagaaatact ttgataattt attattacat ataattacat tatctataaa atctttttta
   135481 atatttataa tatctttatc taatttatta ttccatggta aaccatataa aatatcataa
   135541 agtaaatatc caaatgattc taaatcactt ttatatgttg atataccatt atgcatatct
   135601 ataccaatat atttataagt accattatta actaatttac aattagtaat aaattttttt
   135661 gtgtgtttag ttatatttcc aaaatctgtt aaataaaatt tattattatt tttatcatat
   135721 aatatatttt catctttaat atcagaatga atatattctt tactatgtat atattttaag
   135781 gcaaatatta tatcttttga taaattataa atattattta ttgatatttg ttttaaatta
   135841 taatcaagtt ttggtaatac taaaaatcta agttttttat atttatcaat accactatca
   135901 acatatggta atatattaac atcttttacc atttcttctt tacaatatct aatataaaag
   135961 ttgatttcgc aaaataatgg tccatcttca attgatgcaa tttttataat tttattatca
   136021 tcattttcta ataaatgtat atttatataa tattcattta ctaaacattc tgatacttgc
   136081 caaatattac ctctaactga ttttaatatc ataattatta tatattaaaa taaaatatat
   136141 atattttcaa aaaaattatt ttgtagaact aatagataaa taatatgtag gcatttgttt
   136201 ttctctaatt ttaaatgtta ttcctctcat attagtattt aatagaaaca tttttgttga
   136261 ataaggtaat ctaaatgata taatttttgg tgataatcca atattttcac attgtaaaca
   136321 cttccaacgt tttatttcta atgaatcttc atatgtagca aaaataccac aattactaca
   136381 tgccattgct ggtaaatatt tttcagatgg atcagataat aattcaagtg ttattgatgg
   136441 tacagaatat gttaaaaata catcaacttc catttcacca attttaatac caccaccttt
   136501 ttttttgcca gatggtggtt gtccatattt atctaatctg cctctatttc taactgataa
   136561 tttatctgct gacatttgtg ataatctaga aaataaaatt ggtgcaacaa atgcttttgt
   136621 ttttttacca ttttcaacta attccatagg tttatgtgta tctggattat atattacatg
   136681 tctacaatat acaatatcat ttaattcttc atctgaaata tttggatata atggttttat
   136741 tttatttcta atatattcta ttatatcagt tgatgtcata tcagtatatg ttggataatt
   136801 aatatatcta gtattattat tttcgtcata tggaattaaa gaaaacatat ttgttaacat
   136861 tgcatcaaaa tacataggaa atgttttacg actagttata ctagtactat taaatattaa
   136921 atcaggtctt aaaccatctt ttgtatatgg taattctgat tcatctaaaa tatctgcaac
   136981 agtaactttt tgtactgatt ttgctaattt atcaccaatt gctaatcgtc tataagatga
   137041 taataaaatc tcaactttta taatatcagt accttgtttt ctagtacgtt caactacagc
   137101 aggataattt gaaacatatg gttcagattt atcaaataat ctagtattat catcagtttc
   137161 tttatatttt ggtttaagac atctatataa tgcatcattt ttaaccatta cagttccaac
   137221 atcaggcaaa cccataacgt taatttttga gtaattatta tttgcattat caggtgatgg
   137281 attattatta tttatttgaa tatcagaaac ttcagctaca attgcattta atgttattac
   137341 agataacatt ccattttcaa ctgatctttt atttacaata acaccatctt caatattttt
   137401 attataacta aaaaatccta ctaaaatatg ttgtcccata ccattttttg atattccaga
   137461 tatatctttt ggtatatttg ttacacaaga tttttgtaat ggaaatgata aatatgtaca
   137521 agattcaaat ttatttaaaa tattatcttg tggaccagta attatatgtt tatattgtgc
   137581 tgcaccaaat gttcctctaa caccagccat ttttccaaca tcatgcatgc atgatactaa
   137641 ttgactgaaa tatatataat ttggtaatct aacatattgt atagtttttc taaattctaa
   137701 actatattgt ttaaattctt ttattgaatt acatattctt gaatataatg cttgaccaac
   137761 atcaacaaat tcaattatat cattatattt taacattata tcactaaatg acattatttc
   137821 atttttatca attttatatt tatctaaatt taatattcca ttttcaacaa taaacattgg
   137881 ctgtaatgct cttctattac caacatttat tcttatttga aaatatctat ttgttggaac
   137941 attaattttt ttaattttat ccatttcatg aattggaata acttcaatac caatgtcatt
   138001 agtacaaaat atatttgata tttttgctaa tttaatatct ttcacaaatt gatcaacttt
   138061 tgattgatca atactagtta cataaaattc agatgattct tcaattatag atattatcac
   138121 accattaatt ttattaatta tattattagt ttttgcatat gttaaaatat attcattaac
   138181 ttcattaaaa atacgttctc taatttttag tgtatgatgt gaaataattg taccaatagt
   138241 taatcttttt atcaatcctg catttgaacc atgatctggt gtatcataaa tatctaaaac
   138301 accaattgtt gattcatgca aatttcttgc ttctaatgat tttgttaatt caatacttga
   138361 acccctcata acagcatttg atacaataat tggttcttgc caatttgatt tagtactaat
   138421 tttaacaaca tcactatttt ttgtatcttg catattgaaa aaattattaa atgctggagt
   138481 tatttgtgga attagtttaa tttgagataa tgcattattt atattttgat ttattttaga
   138541 ttcaatttta aattcgtttg atttttcttt tatttgatat aataatgtat ctatacttga
   138601 ttttattatt gattcgaata tatcagcagc agtagaaatt cttctagttg ctagattatc
   138661 tttatctgga tatatatcag gctgaaacat tccaacaata aattgtctaa aaatactaat
   138721 taaatacatt cctttattaa ttctgccatt agttatatga ggcaaaaaat tagataataa
   138781 tgaatttgta tatgcttgta atgtaatatt tttatcattt ttaaatttat taatatatgc
   138841 ttctttaata acatttgata cataagtatg tatattattt tcattattag ctaatatcat
   138901 ttgtgaattt tttattaata tttgtatttt acgaacaata ctattattaa atcctctttt
   138961 aattatagat tcgatatctt caaatgacat ttcagaatag aaatgtatta ataatattaa
   139021 atctatttga ataaatgctt ttttagaatc aataacacat ttaatttttc caggtgtata
   139081 atcaatatca attgttaaaa actgtggtgg ataaattttt tcatttatca ttctaaatga
   139141 aggatgttta cttataaacg aacaatgaaa tataaagggt ttattcattt tttttaattt
   139201 tgggtatacg tacatttgtt ctattctaca tgtaacaaat tttgtaattc ctttagataa
   139261 aataaatgaa ccacctggat tattagtttc agttaatgaa ttatcaatca ttggtgtatt
   139321 tcctccataa gatatatatt gcggaattct aatttcattt ggtgtacaat tataagtata
   139381 tattaattgt aatttagatt caccatcttg attaataatc tttttaaata tactaacaca
   139441 tatacctatg tttaaatcaa aacttttatt atcaaatgat gaatatatat aacttttttt
   139501 attttcttgt tttccagaaa attctatttt taatattatt tcttctttag atgatttgct
   139561 agatttaaca ttaatgactt cttctctagt aaaaaatgca gataagtcat gattaaaatt
   139621 acgaaaagga atttcaatat ttattaatga tttagattta atatttaatt tattatcact
   139681 actcaaatat aattttgcaa tatattcctc tatattattt ggtatcattt attaattttt
   139741 attttttttc attaattttt gaaataatac tacaattaat aaaaaaaaaa acaaataaat
   139801 gtgtttatta cattagttgt ccagaattta aaaatcatac agtaaaagta aatgagaatt
   139861 atattaatga aaattactat ggacgtttta cgttggaatt attaaataaa gatgaatcat
   139921 ttcatatttg tcttcatctt gatgacatgc atgtttattg tacaaaaaaa actaataaat
   139981 ctgacttagt taaatatgtg gatttagtta aaaattcata taattttaat atttcagatt
   140041 gttacacctg tccaaaatga aatgttgcac ctgtttataa aatgattttg ttgtataaat
   140101 aaatgaaatg ttattttttt tataaatgaa taaatattat agatatcctg tgtataatat
   140161 ttatgaatgt ttaattttat tagctattaa atatgaaaat aataaagtta gtctagatat
   140221 aataaattca ttatatgaaa tattaaataa tattaaattt agtgataaaa taactaatga
   140281 aattataaaa aattataata aaatagttga aaaaattttt tatatgcata atcaatttaa
   140341 aataaatgat tataatatta tattacagta tttaatagaa tataataatg aaataaataa
   140401 atgtattaaa gaaaataaat ttccatgtaa aaatccatta tataatatta catataaaaa
   140461 aaaattatat atttatgatt tagattatga agaaaaaaaa gataaagaat tagttattaa
   140521 tatagaacaa aaaaatgcag ttgataaaat aaatgatatt aaaaataatg ttaataatat
   140581 acattcagat aatgaaacaa ttattactgg taaagaaaca ttaatagata tattaaataa
   140641 attattaaaa ttagtatcat ctgatgaaaa acaattaata gaacaaatat ataaaaatat
   140701 taataataaa gaaatagaat ttaaaaatat tgataacgta caaaaagaaa taaataaaaa
   140761 acaagatgaa ctaaataaat tattagatga gagtaaaaaa gaatttatta aaaaacaaga
   140821 agaactaaat aagacaattg ataaaaaaca agaagaatta ataaagaaat taaatgataa
   140881 agaaatcaat tttaatattg atgaaaaaca aaaattatta gatcaaataa attcaaaaat
   140941 aaatacttta aatgaaaata ttaaaggtgt tatgaatttg tataccgaaa ctaaaaataa
   141001 aatatcaaat ttacaaaatg aaattttaaa taaagattca acaataaaat ctttagatga
   141061 aaaacaaaaa ttattagatg agttagataa aaatattaat aatattacat ctttatataa
   141121 taaatctaat actaaaataa caaatattca acaactttta gaatcttcat taaccgattt
   141181 taataatgct aatattaata taaatgaatt aaaatctaaa attaaattat ttgataatga
   141241 tatacaaaaa ctaaataatg atataacaga acaaaataat aaaataactg atttttttaa
   141301 taatagtact agaatattta aagaaaaatt agatacagaa tataaaaaaa tagatgatat
   141361 aaaaaataat aatttacaaa aacttgaaga atcgtataaa aaaatagatg aacaaaccga
   141421 atattacaag aataaaataa ataaagaata taatgatatt atcgaattaa aaaataataa
   141481 tttacaaaaa cttgaagaag aaaataaaaa aatagatgaa caaaccgaat attacaagaa
   141541 taaaataaat aaagaatata atgatattat cgaattaaaa aataataatt tacaaaaact
   141601 tgaagaagaa aataaaaata taaatgataa attaactaaa ttaaaaaatg atattgagtc
   141661 aaatacagaa ttatttaaca aattaaatat atcagatttt aaagacaagt ctagagaaat
   141721 tgcaaaatta aatactgaat atgaacaatt aagaaaagat cttttagaaa atattaataa
   141781 aactaatgaa ttaatgaaat tatctgataa taaattatca tcacttgaac aattatatga
   141841 tagtaaaaaa aatatattag atggaattga taaaatatat aattcattaa aagaaaaaaa
   141901 tgataaaatt gatgaatatt tttctaatat tgaaaagttt gatatatata atgtaattga
   141961 aaataaattt attggtaatt tagatagtat aataaataaa attataaata atgatcaatt
   142021 taaagaatat ataaattcta aaatagatag taaatctaat gaactttcca caatgtttga
   142081 tgatatattt aatgctaaaa atcaaattgc tagtataaca aataatatag aaaatatatc
   142141 aaataaaata aaagatttaa atgaatttat aataagtaat gaagattcaa gtaaggaatt
   142201 attagatgaa ataaggaaat ataaacaaca atttgataaa attaaagatg ctatgaacac
   142261 agaagttaaa agttttgaaa atacattgca aaaagatatt gatagtatta aaagtaatat
   142321 aaatgaatta actaatgcat atgatattat aaatactaaa gctaatgatt tggatgataa
   142381 attaaataac tatggttcag aatttaaaaa tttatataat aatgcatctg atcttttaga
   142441 tacaatacaa aaaaataatg atgaaaaagt taagcaatta aatgaatatt tagaaaaaaa
   142501 taaaaatcaa tcaattgaaa taaatgatat agtaaacaat tttataaaag aattgattaa
   142561 atttaataat acagaaacaa ataaatcatt aaatgaatta cttacaaatg atgatattaa
   142621 tgataaaata tttaaattat ataaagaact aaataaaatt tcaactaata atttattaaa
   142681 aatatataaa aatgaaattg ataatgttaa tgaaaaatta tctattgtta ttgaaaattt
   142741 acaatttata aattcttttt tatcaattga atttaaccaa ggatctatta caagccatat
   142801 taatttttta ttaaatacat tagcaggaat aaatgatgta ttaaataaat taaatcttaa
   142861 aattatggct gatacgacta gacgtggtga tacgaatata cgtgatgaaa ttaaaaatca
   142921 aattagttcc gaaaatataa aaagtcaaaa atttaatgaa aaaaatgaaa aggatttaaa
   142981 aaagcttatt tcatttaatg ataaattaaa taaatataat atttctgctg gatatactga
   143041 atacaataat attgaacatg aatgtttaaa atatttatat attgctgtat cagatcaaga
   143101 atatagatat tataaattta taatacataa tattaaacaa attgataaaa ataaaaaaaa
   143161 ttcaatgctt caatttttaa aattattttt aaaacgatat ataattatat atgatttaaa
   143221 aattttatct gatactattg ataatataca aataaaacaa tattatttaa ataaactata
   143281 taaaaatgaa tataaactaa atacttttga acagtttatt aatcaaacat atggatttac
   143341 aatgccaata ttcaatatat taaatatttc aacaaatatg gtatttgatt atatttttaa
   143401 aaataataat atatattgtc cattgtataa ttttgattac acatcatttg atacatattc
   143461 tagacaagaa tttttaaatt ctttaatata taaacttgat tatatttgaa aataaagatt
   143521 tatttgtaaa atatgtataa taaatacata ttagaaaaac ttattagaat taaattgtta
   143581 aagccaaaaa tttatattgt tacgtcaaat aaatctttaa acgatataaa aaaaatagtt
   143641 aatgtgtata attcattagt aaaatctata aataaagcat taaatttacc atctagattg
   143701 tcaatagatg gaatagtttt aaaagattta atatgggata atagtaaaat tattattaaa
   143761 aattatcctt atgtgtatta tgaaattggt ataacaaata attttataag tagtgaaaaa
   143821 aattatatat atacagatgg tgttgattgt cttatattta aaaaaacatt aaaaaaaagt
   143881 ataattagtg tatatattca acatgcatct tttaaaggaa ataaaaaaac gtcgggtttt
   143941 aatatatggg atatattacc taaaattgat tattatttat actgcaatat taataattgt
   144001 atttctatga ttgataatat ttctattaga tgtttaatta tatcaaaaga tacaaatatt
   144061 tcaatggaag agttatatat atcaataatg aatggtaaat ctatgcatga tgagttagat
   144121 ataaaaatta tatattatga tataaataaa caaagacatt ttaaccattt taataatttt
   144181 aaagtattgc ctgaatatga taaaaaaaat gatattgcta atgtgatatt aacatataaa
   144241 aataaaaaac tattcttgta tataaaaaaa ttatataata gtaaaataca aaacactgta
   144301 ttaaacaaaa ataatctaac atatgattta attgttgaag ataaaattat tcctttaaaa
   144361 aaaacttatt ttttacatta ttataaaata aataaagata tattttatta taatgataat
   144421 aataataata taaaaatatt ttctaatgaa ataaattttg atggattgat agatatagat
   144481 cattacgaat ttaattataa attatataat aaaaactcat tatttataaa attatgtatt
   144541 gcatcgcaaa ttattgataa atacgaaaat gaaattttga acattaatga tgaaaatata
   144601 gaaactgtta taaaaaatat aaaaaaaata aataataaaa tattaattaa taatttatca
   144661 aaattattga ataaatcaat taaagatcat atgaatgaaa taaatataaa tattaatgat
   144721 ataaaatatg attataattt acaaacattt gttggtaaaa atagtgatat ttataactct
   144781 atatataaat taataaaaga aatatattta ttgagtaatg cctaatggtg taatatttaa
   144841 ttcttttact attgtattta aatcttcaat taatatagga ttataatctt cattaatagt
   144901 aatttcttta tctttattaa cattaaccaa tttaatttta tttttagaat tatcaatata
   144961 tttaatagaa tcgattataa cactacttgg actaactgat actacatatg ttccaatttg
   145021 tttataagca tatactgtat cttctgatat ttgcttagct tcatttaaca tttgttcagg
   145081 attttcaact acatatttta attttggatt cattttaaat gtaattaata taggatatga
   145141 agtttgagaa aatatttctt ttctatttcc aggtcttaga atagaatcac ctactaataa
   145201 tgaaaatcta tctttcatca ataaatcaat aaaatcatta atagtttttt taccatttgc
   145261 aataaaatct ctcatatcat aaatattata aaatgtagca ttatctattt ttaatttatt
   145321 actatcatat tttgttttct ttttggtaaa tgaccgttta tgcaaaattc ttattataga
   145381 tttattatca ggaataaata ttttattagc accaccaata atattatcac ctatataaat
   145441 acttttagat gcattaataa ttgtatacaa aggattataa tacatttatt ttaaaataaa
   145501 atagcttata atataattat atttttaaca cacattagta ttattttttg gtattaattt
   145561 ttgttttata atattactaa tatttattaa atttcgttta atggtacata aattattacc
   145621 accataacaa ttatttttat caatgttatc ttgtaaatat atctcatctt ctctagatgg
   145681 aatatataat atagtttttt taattttgga aaaaattaaa ttttgtacaa cattacacat
   145741 gttaccagta atataatata tatataattt atttaaaaca aaattataat tatcttttaa
   145801 aaaattttca attattctac tagtatttaa tttatcatct tttgatttta ttataccata
   145861 atatgataat tcatatatat ctgtattttt attatctaat ttatttcttt tttgaaataa
   145921 atcagattta atgccaagat tttgtaattc aaatatagca tcagatgact cctgaatatt
   145981 atctgttatt acataaaaac catagcattt attatcatta agtactctat tataatcatc
   146041 agctgtttta atattaccat ttctaaaaac atatttatct tcatatttat cccatattgt
   146101 attagtccaa tcaatgaaaa taatataatt ttcaaaacaa atttccttaa ataatgaatt
   146161 tattattgaa catgaatcaa atactaataa attatcatac atttatttat atattaatat
   146221 aactttatta ttctttgtta tattcatcaa ttgtatattt atgattttta ttcttatcgc
   146281 atattatatt aaattcatta tcaatagtta ctttattatt acaattttta cattcatacg
   146341 gaaaacaatc aattaataaa ttattatcat ttgattcatg attttcataa ttaaagtttg
   146401 acaattgtag ttgtatattt ataaatattc tcattttttc attttcagac aatgatttta
   146461 ttttatcatt atcaagtaat tttaatattt tttttttatt ttcatctaaa tattgtgatg
   146521 gaatattaat tttttcaact tgcatttttt ttttatcaga tgtatatatt attaaacttc
   146581 caatatcatt actatcaaat gaataatcac ttatatcata atcaatttct tcaaatattt
   146641 tattaaaata tgaaatatta atttctgaaa aatgatctaa aacaatattt gatatatcca
   146701 tttatacttt tattaaaatt tcaaagactt ttatatccaa ttttttcaat ttgattttga
   146761 taaattaaat ttatatgaat taaaaagcat ataacaatta atataatatc tatatacgtt
   146821 aatgctaata accaaccgct atttaagtca tctgtataat tttgaattat tataaataaa
   146881 attgacaata taaaggttat aaaaagcaat aaaataatta tatttctaga attagttggg
   146941 tttggaaata gtctagttaa atttttaata atactatttg ttgatctttt ttgatcttcc
   147001 atttattcaa taaaaagaat ggataatatt aaaaaaataa aacaaacttc cgacgttaat
   147061 aaagttttaa ataaaatttc tttagaagat atatcagaaa ttataaaaat attaaatgaa
   147121 aaatattatg aaggtgaaac tttaataagt gatgaaattt atgataaaat tattgaatat
   147181 gttaataaaa aatatccaga taatgatata actaaaaaaa ttggttatga accaaaaaat
   147241 aaagttaaat taccttatta tatgggtagt gaaaataaaa tatatgatga agatgaaaaa
   147301 aaatttaata attggattga aaaatatggt acatcaagta taattgtttc agttaaagct
   147361 gatggaattt ctgtattatg ggatattggt aaaaataaat tatatactag aggtgatgga
   147421 aattatggaa aagatattag ttggtttttg aaatatatga attatgattt accagaatta
   147481 tctgattatg taattagagg tgaattagtc attaataaag ataaaactag aaatgatgtt
   147541 gctggtgcca ttaatagttt agaagcaaat agaaatgaag atatattaaa agaaatatat
   147601 tttgttggat atgaaatatt aaatccacga tttaatcaag aaaatcaatt taaaaaatta
   147661 aaacaacata aaataagaca tattaaagcg atgaaatatg atatagaaga tgtttcatta
   147721 gaatgtttaa gtgaattata tcaagaatta aaaccaaaaa tgaaatatga tatagatggt
   147781 ttggttataa gaaataataa tgtaaatgat ccaataactg atggaaatcc accatggtca
   147841 tttgcatata aaccacctaa tactatttat acaactaaag ttttaaatgt tatatggcaa
   147901 atttctaaac aaaataaata tattcctatt gctgaattag aacctataaa acttgaaaat
   147961 aagactataa aaagagtttc atgttataat gcaaaatttg taacagaaaa tggtattggt
   148021 acagatgcaa tagttgaaat agaatataga ggtggtgcta ttccaaaatt agtaaatgta
   148081 attaaaccag taactgtaga tgaatctgat ttaccagatg gtaaaattat tgataatcat
   148141 ttatatgcac caattgattc aaaagaatca aatattaaaa ttatttcaca attttttaaa
   148201 attttaagta tacaagcacc aaataaaaaa gttattgaac atttatatga taatggtata
   148261 actaatatag ttgaattatt aaaatctgat ttgacagaat tattagatac aacaaaaaaa
   148321 ataaataaaa atgcattaca ttcaataaat atagcaaaat ctatagaaat ttcattacca
   148381 ttagcaattg cagcattaag tattcctaat cttacagaaa aagtattaga aaaaatatat
   148441 aatacacata aagatttctt aacaacaaaa caagattttg aaaaaataaa aggtattaat
   148501 aaacttagtg ctgaaaaaat aaaaagtcag atattgaaaa ataaaaatat gatagatgaa
   148561 tatttaaaat taattaaaat aaagtaattt tatttttttt cgctcaacca ttcataaatt
   148621 tcatcaattt tagtttttag tggttcaata acttcttcaa ttgatgattg ccataattgc
   148681 atctgatttt ctttttcttg ttctacgtat ttatcatatc tgtcacatag atatgaaaca
   148741 taatcaatta tagtatatcc aataataaag aatactatat atatcaataa tatgtttaat
   148801 aaatacattt attactaaat aaaaaattta atattattta ttttaataaa tgactacaga
   148861 tacaatatct tatcataaat ttccaatttc attagaagat atttgtaaat gttacaataa
   148921 tgataataac gaatatatga cttttgaata tgatccaatt tctggtgaaa atcatatttg
   148981 ttctatagca ggtaattgta taatatcaga tttttttaat aaattaacat ctgaatttac
   149041 aaaaacacaa ttaatagctg gtgctagaaa atctgacaag aataataaaa gtaataatat
   149101 tagcactaat atagataaaa aacaagatat attaaaaaga ttagctgaat atattgcaaa
   149161 atcattttct aaatcaccaa atttatacac agaacaagat ataagaaata taattgcatt
   149221 atctaatatt gatggaatta gaaatattaa cttgtctaac gaagatatta ataatataat
   149281 taatttagca actgtatatt ataaatcaaa aatagtcgat catccattat tttcagtaaa
   149341 atcagaaaat gtaactgatt taatgcaaca attaaaacaa gttgatagtg ttgcaaatat
   149401 tagtgattat gaaggatttt taaataatct taaattaaga tcatataatt atatagatgt
   149461 tactagttgt aatttgacaa acacattata ttatcatcca aatgaaccat ccatcccatc
   149521 aattatattt gcactatttg ctaatagatt gcctatactt tttgatttaa taacatctca
   149581 agatttatat atgttacaaa aagaattaca atctgatgat tattctaaat acaataatct
   149641 ttttttgttg atatttagat tatctgataa agactatttc tataatttaa aaggtcatag
   149701 tggttcaaaa aatagttttt ataatgaatt aagtagaata attttatcaa tggcagtaaa
   149761 acaaatggtt tataatataa ttgctggtac agttacatca aatcttacta atagttttgt
   149821 aaatattatt aatagatata gagttgataa tattagaagt ccacaagaag caatgcttac
   149881 tattttatta aaaatgtggt catataaacc aacaattgtt ttgaaatcat caattggtcc
   149941 atataatgat ttaaaaccag aatcagtatt ttatgttgaa tatgatataa atgatatatc
   150001 tagaattgat gcaagtacta atataagatt tggtcaagaa atgttaaaat atatttatta
   150061 tgatagatta agtaataaag ttgtattatt accaacagtt ttaaatactg tacctacaat
   150121 taatgctaac ttaaatcaat ttccattttt agcaaatcaa tattcacaaa tgtcttatgg
   150181 tgctaataat ataacattaa gatcattggg aatttttgta ctaagtattc ctagaataat
   150241 tagtagtttg tattataatg gatatgctaa tgaatatggt ggtaggttaa atactagata
   150301 tattaatatt gatcaaacaa ttacaatttc agatagaata tttatattat catcggcagt
   150361 atgttataaa tcagcaacaa caattaatgc tgatccatgt tttggaacac aaattgctat
   150421 gggaactatt gcaattgtta gaactcaaaa aggatggtta agatatgatc cagatttaaa
   150481 agtttcatgt aattcacaac aagaaatatt agataaaatg attagaagtg aatataataa
   150541 atatacagca tctgatcaat atggtatgaa tgaaggtttt gatgatgaat ttgaacattg
   150601 gaaaaaagat attaaaaatg tagaaaaaat aatagataga tttgataaag gatatgttaa
   150661 tatagatgca ttaattatta atgattcaga agcaattgat ataatatcta gatatggtac
   150721 aattcttata tattctgatc aatctggttc atcatcatta tgtgatgtta gtattaaaaa
   150781 ttgttataca tattaaggta tataaattct ataataataa taaaatatta ataaacaaat
   150841 aacgtaacat attataaaaa ataaaaatag tattactggt actaataaca tttatataat
   150901 tatttattat ataaatgctt aattgtgtaa tatatatagt tatcattcta tttgtatttg
   150961 ttatattatt cttttatatc acttcgatta aaagagataa ttttgaatca acaacacatg
   151021 aaacagatga attagctaat tcaactaaat ctgaattaga aacacttgat caaaaagtaa
   151081 taaataaatt tattcaagat tctattatta atactagatt atcaaatatt gaagaatcat
   151141 taaataatat aattagtaaa ttacaagata atgaagttga aaaacaagtt attgaagtta
   151201 atcaaccaaa agaaaaaaaa caggaaattg tacgtaaaag aaatattaca gttaaaaaag
   151261 aaatagaaaa tgatgaagat gaaattgtag aatagatttt aaaatataat aaatgacaga
   151321 tgcagaatta tattttttaa ttattgttat aattgtatat ataatattaa ttttatcaac
   151381 tattggttta atttggggtt atttgttatc aattagaaaa ataagatcat ctattgatca
   151441 aaatatgcgt tctagacgta aaggctggta ttggttttta aatttcttat tttggctatt
   151501 accattatct ttagctgcag cattttattt tttcactgtt tggtatgtaa tgaatccaca
   151561 agcacaacaa tattggttcc caccaccatc ttctagtaca taattgaaat aatatatata
   151621 aattaaaaat gaatataaat aatccaatat atataaattt aatagatata ttaagaacta
   151681 gaacatttgt acttgatcaa tatgaaagaa accagcctat tgtatattat gattatgata
   151741 gctacacaaa agttaattat aaatgtgaat atgaaaaaaa tcatattaaa ttaattacag
   151801 aatataatga ttctataatt gaatataatt taatgaataa tgtaagacat attgatacat
   151861 cacaaaataa tattattatt tctaatcaaa aatctaaaca taatgaattt gatatgaata
   151921 tattaagtta tcatcatcct acatatatga aacaaaatag aatgaaagtt gaatttattc
   151981 caaatgttaa tgatatatta acaaattata aaccttcaat tgattcatta tgtattgatt
   152041 ataaaatatt atataatagt gaaatattta aagaatacag tgatagatta tatatagcat
   152101 atacatcagt aaatatgagt aatgtatatg aaacggatta tagaaaaata ttatatactg
   152161 cttaacatat ttttatattc gatttaataa tttaatttta acttcttcat ctaaaataag
   152221 atctatatta ggttcatgtg tttttagaat atctaatatt ttatttatac atctatcgtt
   152281 taacgactta agatagtttt cattcaataa aatatcattt attgtttttt cgcattcaga
   152341 acatgaattt atactatttg cagcagttat attgtacata taatttgaca ttttatattt
   152401 aataattata tttttttaaa caattataaa tacaatggaa tacatatttt taaataacaa
   152461 taatacttat actgcgggtt attcttatgg aattaaaccc caatttgtta ctccactaac
   152521 ttcaacaact aatgttcaaa atgaagatga tcataatatt aatactataa aacctgataa
   152581 atcttcaact attgaaaata atgaaaataa tgccactaga acaactgaaa atgtttcacc
   152641 acaatctgta gatatgtcaa tatttaatga tggtgattca tatattccag acttcttttt
   152701 gtcaaatata tcagatacaa tatttttaat ttttatatca acagctgcaa ttattgcagc
   152761 atctaaaatt gataatatta atgttagtta tctaattatt gcagcaatct cattactaat
   152821 ttcaactgaa tatggtatta gtatttctat tgtattattt gcaattatta tggcaaataa
   152881 tgctaatgct tttatactag ttttagttgt tatttcatta gttcatatat ttgttccaat
   152941 tccatggctt ataactgata gttttaatta taattattta ttgcaaggaa tacttggatt
   153001 attgacacta ttggctatta attacaaaaa acttgttata tattatgcta tacctaaaga
   153061 aacaacaaca gtatttaaaa atgctactgc agcaatgagt aatgaatcaa caattatatc
   153121 atattaaata atgaaaaatt acatcaaaat ataaattaat aaaaatggaa gatatagata
   153181 aaatattaca tattacagtt attaatgatg atgaaattaa tactgaaaat gatactgaag
   153241 ttgaaaatat aaaaaataca gattttgatg gattaaaaat atttactgaa tgtggatata
   153301 tatttaaaaa tgtaactaat aaaaaaatac aatgtattat atgtaatgaa tcatgtaata
   153361 ttcattgtat ttggtgtagt gatgaaaatt gtgtattgca ttcaataaac aagttatctt
   153421 tagtacaatt taataacgaa cataaaatga gaaattttgt tagaataaat actatatttc
   153481 caaaaaatgt aaccttttat ttaacaggaa aatttaatat tgttaaacat aaaaaaaaag
   153541 attcattttc agattattat tcatatatag aaatatatac ttatactatg ataccagata
   153601 tgttaaaaat aatagaaaat aaaatatttg aaactgaaaa attaatagta gataaaaaaa
   153661 taccatattc gtataatgat tatcttaaag tattaagagt tgataaatta aatgattatt
   153721 catttgttag atctgctgaa aatacatatc caatagtata tattgatact aataaagatt
   153781 ataataaaat atcaattaaa tataatgata aaaaatatga atttaaatta aaggctttat
   153841 gtaatatata tcctgattta gataattcaa taaaatcata tttcaaagaa tctttattaa
   153901 ctatatgtat aaatcctgtt tgctttttaa tacctaaaat tgatcctaaa tttactttaa
   153961 aatttaaatt taatgtattg ataaatatga aagaacaatc aataaatata aatagacctg
   154021 atattgattt taataatcaa tcattaacta aagaaattat tgaagaattt atagataatt
   154081 taacagctca agaaaaaata ttaaatgatg aagaaaaaaa aaagaaaact actttttaat
   154141 tttttctaat attatttgtt tcatactaga ctcagttgaa agtaaaaaat aattattatc
   154201 taaatttttc atttcatctt ctgaaatata tatataaaat aattctgcat ggacattatc
   154261 tataactata tataatccaa attttttttc atattgtaat aataatggaa ctatatcttt
   154321 tgatatttct tttctaatac tggtatttgg tataatatat tttaaatcta tagttttttt
   154381 atttattaca aaaaatttca tactatctct agtatcagga tctaaatgta tttctttatg
   154441 aactaaaaaa attgttgata taaaagcatg tctacattca tttgtaaaat tttttaattt
   154501 atttctaaaa ttatttccaa catcatcaaa tataatgagt gtattaaatt tttcaccata
   154561 ggatttatca tttaatgttt tatttgtaaa ttttttaatt tcacatattt tacttacaat
   154621 atattcaggt ttttcatatt ttgttaaata aaatacatga ttaggatata catatttata
   154681 atatttatta tttctatatc cttgatcatc attggtaatt agatatataa atttaaaatg
   154741 aaattttaaa ttatttaaaa tatattttaa taaagttgtt tttccttggc ctgtacttgc
   154801 aactatagac atattgaatg gacgttcttt taaagtatca aaattaaatt tttttatttt
   154861 catatttatt tcattttttt attattataa atgagtaatc caaataatta ttctgataaa
   154921 gatttattaa tagtaaaaac tgttagatct aatgctttac cagataatgt tatttttgcg
   154981 tttgatatga ataatggttt atttaagaat atatttaata gtgtatttaa taatgctctt
   155041 cttggtggaa tgcatgatgc attgcgtgaa tcaatgaata aaaattatta cgataatgaa
   155101 ttaggtggtg ctagtaatac aaatcaagga aggtatggac aatcaaataa tagaggtcaa
   155161 caaaatgatt ctggatgtag aattgcaaaa acaactggtg aatgtgatag acgtgaacat
   155221 ccttatcgtg aaggaaatcc tagaaatatg tcatcagtaa gatatgatga tgattatgat
   155281 agatataata atatgtatga cagaaataga aataatgata tgtatgacag aaatagaaat
   155341 aataataata ataataataa cgatctatat tctagatcta atgtagctag tgatgatatt
   155401 gtagttgata aagcattatt gagtactgta tttaaaaata cttagtttaa taaatgaaat
   155461 atacttaata aatgaaatca actaattgtg aaggtaatct tactattata tatctattgt
   155521 ctaaaagaat aaatgaattt agaaatggat caaatggcat aattaataca attagaaata
   155581 ttgtaaaaga attcagtgtt aaagaaaaat catcttttat taaaatgaaa aaacaaatga
   155641 atattataaa aaatgaaata tctaatatga atgaagaaat atttttgcca tattttatga
   155701 tgaatacata tgcattagat gattatatat atcatatttc gactggtgca tttggaatga
   155761 catttagagc aactgataat tttatattga aatttataat aaatcctata aataatcaat
   155821 atcatgaatt tattattcct cataaattat ataatatact aaaaggaact ggatgtgaaa
   155881 attttatatt agtaccttgt gcattaatta aacaaattga tattaaacat ctaatgaata
   155941 ttattattgc acataatatc atttttattt ttattaaaca tattattaat ccaacgaatg
   156001 atataaatat atttgacact tatttaaatt ttgataaaat gattaaaata tataaagaaa
   156061 taattagtta tgaagatttt tataaatatt ttacatattt ttataaaaaa tattttaagg
   156121 atttatttaa tattatttta ataaacaatt attacatgat tttgagtcat gttaaacata
   156181 tattaacaaa aatgctagat aatagtttta gctataatag tagtttaata atttcaaatt
   156241 tagcaatatg tgcatcaaat gagttaaaat taataaaaat atctgaaaat ggttttattc
   156301 cagatatgat aaatggtata ccagctcaaa atattaatcc aaattattta aggcatattg
   156361 tattacaagt tttgttgata atatattatg caaataaaga tgaaacaata tttatacata
   156421 atgatataaa accaaataat atattagttt ttccaaaaat aaatgatata gttgtaaaat
   156481 ttggtaattg taatataata tttaaggaaa aatattattt taaattaaca gattttgatt
   156541 tatcatatat taaagatttt aaaaatgaaa gaataaaagg tattattaat gaaaaatatg
   156601 ataatttcat aacagatatt ttttattttt tatatagatt taaacatgat ttttttaaaa
   156661 atttagagga aatagatcct gcattaaaca aagccataat tgaatatttt atgaaatata
   156721 tacataagaa agatattgtt gataaatatc attatgttgg aagtaaaaaa ttttattctg
   156781 atgatgtata taatttcata atggaatctg gcttatttaa aaattggatt cacaaattag
   156841 cataagtgta accctttttg tatttttata atccacaaat aacaacgatt tttaccaata
   156901 taaatatatt tatctttaac actgttataa caccattttt tagataagat gtgttgattt
   156961 aatttaaatt tcttgcataa ttttctcata tttttcacac ttaacatttt ttgcaacatg
   157021 tatggatcat atcgtttttt tattttttga tatataaatt ttttatacat cacatcattt
   157081 ttgtcattta aatcttttaa tcctaaaaaa tgtccaattt gatgtgtaaa caacccaaca
   157141 tacaaatatc tgtttttttt gattgtacga aaatgcttta caaattttat attaatttga
   157201 atagcatttt tagatacacg agctaattta tataatctat taaatgaaat ttcaagatta
   157261 caatttgttg agttgcttgt tgttatatta tatggataaa acggatcata tatatcaaat
   157321 actttgtcca atatatcagt aatgaaaatg ttgtcagcaa accaaatgtt agcatttgtt
   157381 acatcatgaa atttgttgtt gataggtttg aaacaccaaa taatatcatg atagtttttt
   157441 ttgtatgcat cttgtggaca tgtaaaaaat gcaaaaatca aaaatacaaa tatgtatttc
   157501 atattagcaa atggtatata tatagatata accagttaat aattgatgta ttaattcaaa
   157561 atgctgtatg aaataatata gtaaataaaa aaataatact gcaaacccaa aaccatatat
   157621 aatactgaat tcatatattt taaaaatact gtatgaaaaa taacattaac aatagaatgt
   157681 taacatagca caatccaatt ttgtaaactt ggtaaataca ttacacattt tgtttctttt
   157741 gttccaaagt atatccattg accatttaat ttattaatag cccattcatc atttactttt
   157801 tcaaatttgt tagaatacaa tgatataagt tcaagcaaat ttttacgact taatatttta
   157861 tcaaacaata caacattctt gtaaagttca aataaataag attctttgcg tttaaatgaa
   157921 tacataacat cagtaggatc ataactatta tgtgataatc ctattatatg accaaattca
   157981 tgaataaata catcaatgta aatataatca ttttcatcaa tttgtggatg aacttttaat
   158041 aaatcatcat gtatgtgaat atatgatttt gaataatgtg tatgtccagc atgtgctaaa
   158101 gcaccatctt taaacttaaa acatgctttg tttgttattt tattaaaatg aaattttctt
   158161 tcaactgaaa ttctaagatt gcacaaattt gaatctgcgt ttatttctga aatattgaat
   158221 ggaaaaacaa atttgtatgg ataaattgct gttctcaaat gtccatgtat atattcatga
   158281 ttaacatgta catcaacatc atcgtttctt tcataacacc aaaaaatatc tgttttccaa
   158341 acatgatttg atgatacaat tttgatcaaa atgaaaatta aaatcataaa cttcattttg
   158401 aatttttttg ttatcacctg tatagcagta acaccacgtt aatagttatc actattaatt
   158461 caatattaca gcggttaaaa aaacaataat aatcaaccaa ataattattt aaaaaaataa
   158521 atcaatattt atcccaaacc aatgtaaaat aacatatcaa aattgcattt taaccaacag
   158581 cttgcatact aggtgggtaa tgcatatttc caactctaga tgcccatata tttggtggat
   158641 aattaattgg acaattttgc aacaattgtt gtatattcat tggtactcct tgcatttgac
   158701 tattttgtgg aataaattgc tgagttggaa aaggtggtgg tataccatta tttgcaattg
   158761 gaatttttat taatggtaca aattgtgatt gtggtaattg ttgatttggc ggaggtataa
   158821 attgtacatt tggtggatgt aaaatttgtg gattttgatt tattgattca taatttactt
   158881 gtggtaaatt attatttttt gatgttgatt gttgctgatt tatcatattt cttaaatcat
   158941 caatatgttg aattatttct ttttcagcat tttcattttt ttcaaattca tctaaaaagt
   159001 tttcttcatt ttcatttatt ttattagtaa atccattcat aatttcacta aatttttcaa
   159061 tatatccatt ttgatctttt gacaattcat taccatgttt ctgacttaaa attattgaca
   159121 atgcaacaat agaacatatt aaagctgtaa taaatacact gatcaatgca agacgaattt
   159181 ttttgcattc actgttagtc atttttttgt attatgtata tacacagagt gtaatattat
   159241 tattatacac ttacttttca ttttttaatt tgaataataa aaaatttaac aatttctgaa
   159301 tcaaaatccc ttttcataag tatatatatg cacaggttca tttatgttgt aataactccg
   159361 aatttgtctg ataatatcag atttgactgg tttgattttt ttggggatgc gattatatat
   159421 ctttataata ttacatatgt cgtgaaaaga tattatattg ttaaaatcat aatgagggtc
   159481 attaatcata tcaagtcttt tgtaaactga attagctgtc ataactgatc cacgtacatt
   159541 cgattctgca agtccaaaaa tatgtccaaa ttcgtgtgta ataataaata ataattcaag
   159601 tggataatca tatgattgat acattattgt attaatttta tcaactggaa aatgcatttg
   159661 tttatcaaaa atagtatgtg cagcttcacc tgcaaaatcc caacaaaatc caccatcaaa
   159721 actagaatgt tgccgatttt caatacttat ttttatgtca caattatgta atgtgtttgt
   159781 ttcatacatt tgaaatggaa caaaattatt ccaaactttt actgaaattc taatcaattc
   159841 tttaaataat tcattatcaa tcattgaatt gtaagcattg tttaaaaaac accaattcat
   159901 ttttttcttc ggtttaccaa cataaccata aatattgcgt ttatctggtt tacatctgtg
   159961 caatggtatt ctaagatgta tataatcatc attttcattt ggaactggat tttcatttgc
   160021 aattactgga ttttcatttg gaattactgg aatttcattt ggaattactg aattttcatt
   160081 tggaattact ggaatttcat ttggaattac tgaatttaaa tctatgatca ctgaagtttt
   160141 cacattattt gtgttataat tgttaaatac ttctttatca ttgtaaatta cttgtgcatg
   160201 tccatctgtt ttaataaata attcattttt gtatgtgaaa agtttgtttt cagtatcatc
   160261 aaatacaata tcatcttgat cttcagtttt taatttaata tgttgcactt ctttaacatt
   160321 ttgtttttca gttgtaatat attcatcttt ttcttcaaat tcaccatctt cttcaaattc
   160381 accatcttct tcaaattcat catcttcttc aatgttatca gtttttgttg gtaaaattat
   160441 agtatttgca ttttctacag tttctgttgt tgcaaattct gatgaatttg tataattgaa
   160501 ctttgataaa tcaagaagtt ttgaaagtaa ggtataattt tcagaatttt tcaatttgtt
   160561 ttcaaaacta gaaattgcaa attcttcatt ggtcatttga tttttcataa ttattaaacc
   160621 aacacttgta atcaaaatga gtgcaattat cacactcaaa gaaatgaatt gccattttga
   160681 tgaaatttta gtacacattt tggaaaagat atacacgtaa tacgtaatct taattaatat
   160741 tacttatttt tcatttttaa caaacttttc caattatata tcctttaatt attggtatta
   160801 aatcttctgc aataaatata tcttctcttg atgaaacaat atgttgtaaa aactcatttt
   160861 ttttaggttt actttcagtt atataatata taatatatgt acaattgaaa taatctgcta
   160921 atataccata attaaatttt ttattttgta aaaacttaac taatatacct tttggtggtg
   160981 ttgaagaaat attgattgta tcagtagata aaattgtact atatattgga atacagttca
   161041 aatctaataa atttataaaa tttaataaaa aatattctat gaaattatat tcagtggatt
   161101 ctttaaaata tgctaatgcg tcatttatat atttagattc aattattgaa tttgatgtgt
   161161 ctgcataata taatgatgtt ttacatgata atattacaaa tacatttaat ttaatattaa
   161221 aatacatact ttgtatttta aatgttatta ttgtttctgg aattgtgaat tcatcaaata
   161281 ttaatgtatc atacattata ttacttttga ataatgtata tgatattaat aatttttgga
   161341 attttaattg atcaataaca tttctactac caaatgttaa attgtataca gaattaaatg
   161401 ttgatatttt tcctgtttca aataaaatat taatacctgt ttttcctcgt tcatgtttat
   161461 atattaatgg aaatcctatt gattcacgtt taattacttt atctgataag tttaaccaac
   161521 aaaataattc atgtgaatat attgatacag ttttattaac taacatttta ttaagtttgt
   161581 ctctaaataa tgctgtacag tctgaatata ttgatgtata taatgcatgt gttctaattc
   161641 tatcttcatt aaaattattg ccatctgtta atttacttaa tatagcttta tcattttctg
   161701 tttttacaaa tgtatttttt aataatgtat taagtaatgg taaatctttt tgaattgata
   161761 tattatttaa atattcattg tcagacatta ttataattaa tatttatata aatactaaaa
   161821 tgattaatat caaagataat aaaaaattaa tgtgcactat aattttttca tcactagcag
   161881 taatatcaat ttcattatca cctattgctt tatataatac aaatttagat aataatatta
   161941 cagaaaaaat agataaaaat atagaaatga taaataaaaa taaaaattta ttaactaaaa
   162001 atacacaaat attaaaccaa aataacaaaa tgataaattc attaacagaa atattatata
   162061 attctacagg aaaaacacaa aataaaatat taacaaaaat attaaataac tttacaaaaa
   162121 tacttaatag taattcagaa atattaaata aatctacaaa aaatcaaaat aaattattac
   162181 aaattgaaga tagattaatt gaaatgcaaa atgatttaat agaaataaaa cattctaata
   162241 gtgaattaca aaatataaat aatcaattac aaaatagtta tactgaatta ttaaatacta
   162301 ataaagaaat acaaaataaa attacaaaat taataaatag attaatgaaa aataataata
   162361 cagatacaaa aaatttagaa aaggttacag aaatacaaaa taaattaaca gaaatatcat
   162421 ataaatatac agaaatacta aacaataata aacatttaca aaaaaaaata atagaaattg
   162481 aaaatagtaa aagaaaaaat gaaattgaaa atttaaaaga agtatttttt aaacatagtt
   162541 atatgaataa aaatgtttca agttggaaaa tatttttcga agtatatggt atttctaatg
   162601 atactataat aaatatatat aataataata taaatgatga taaaacatta aaaatattta
   162661 acatattaaa aaaaattgca tgtttactag aacaaaaaat aaataaaaaa ttttctttga
   162721 atgactttat tttatttaat ataatatcaa ctagtgaaat aaataattat cttaaacaac
   162781 aaattcaaat aagtttaaat tattggaaaa acgttcattt aagatttaca ctatttaatc
   162841 acacaaatag aaatactata tttataacaa acttcaataa atcatataat gaatgtgata
   162901 tacaaataaa tgatacatta ataaaaattg ataataatta tatatttaat aaccaaatta
   162961 aagaaatatt acaattaagt atatcttata taataggaaa atttgttaat aaacgtacta
   163021 ttttagatga aagaaatgtt atgaatccat ttagtttatt atataataaa catgacataa
   163081 attgtatgtt agttaaaaat tgtgagttaa atataaatta ttgaatattt aataaattat
   163141 caataagttt tgcggtttcg cttttttttt ttaatattgt taataaagtt ttatctttta
   163201 ttttaaatat atacacacca aatttataat ctccaatata tttagaagca tagctattat
   163261 attctaaaaa gttatttaaa atagtatagt catcagattt ataatctata ttgatatatt
   163321 tattattaat aataaaatta taatttattg tatttgatgg ataatattta acaatatcgt
   163381 ttattttatt ataatttaca ttatcattac cacaaaatgt taaatatgtt ttatgaataa
   163441 taaaatgttt actcgatata ttgaacatat atctactatt atcatcaata aactttgata
   163501 agtatatact attataatct aattttttta attttatagt cttatcattg attatatatg
   163561 ttttatatac attttcatta tcttttataa attgcttaca ttggcattta caaaattgta
   163621 attctttttc acatccataa caataatttt tttgacaaca tctcaaataa cattttttag
   163681 gatatttaac gcagttatca tcacaacaat atgattccat ttttgatatt aatatattat
   163741 tgctatcatt actttcatta tattttttca ttttttatgt attctattta aatatttgaa
   163801 tatataaata tgggtgcatc tgctagtgtt aatacaattg ttagcaatat taataataga
   163861 gttgaaaata gtcttacaca agaagcttca gcttccgcaa ctgcaaattg caatgttgaa
   163921 attggaagta ttacatttaa atcaactaaa ggatgtgtag ttgaagtttc aaatttatgt
   163981 agtgcacaag ctgaagcatc agttgatgca gttgttaatg caactataga tttttataat
   164041 gatttaagtt ttgaacaaaa acaagaagca cctgcatggt ttacagcagc atttggtgta
   164101 aatacaacaa ctactaatat tacaaatgat tttaaaaata tagttgaaca aagatgtaaa
   164161 gctgatgctg tattaaatag ttcaataaca gtaaataata ttacagttgc ggattgtgtt
   164221 gcacctgaaa gtgaaggtgt tattaaattt acatttacta attcaggaac agcagcagga
   164281 caatgtgcaa ttagtgcatt attagattta caagttgctg gaagtaatac agttagtgca
   164341 aaacaaacta caggaacaga ttggactgtt atttttgcat atgttgcatt agttgctgga
   164401 attgcaataa ttgcaggtat attttattat atttataaac ttagattaag tccaaaagac
   164461 aaagtaaaca ttgaattagc taaattaggt gctacttcta gtaaaataat tcaattatca
   164521 caatatctga gaggttaaaa ataattatta tatataaatg aaaattttaa atactttgtt
   164581 ggattacata aatcaaatta ttaatatgtt atttccaaat tctgaagatg aattcaataa
   164641 attgaaaatt tttgaaaata ttaatataga aaataaaaaa actgatgaaa ttattaagat
   164701 atttaaagaa attgaacata aaatagctaa ttatgttaaa actgaattgt ataaaatgaa
   164761 tcaacaagat tatattattt tatataataa aattgaatca tatattagat caaataataa
   164821 accatttgaa ttgacacctg atgaaagaca gcaaatatat gaaggattgt ttactattaa
   164881 atgttatttt gataatgaat ggatggataa atcaattaca tggataagaa atatattttt
   164941 acatataatt atgataatta ttgtttctat aataaaacat gcaataaaaa catatatgct
   165001 tacaataaag tatattcaag atgttagaaa agatacaaat ttaaaaacat taattatgtt
   165061 gagaaatgga attttaaata taatagttta taaaataatt ccaataatgc tttatatata
   165121 caaacatgat acttcaaatt tacctaatgc ttttaaatat ccaccaacag atattaatga
   165181 attagataca aataaaataa ataatataat tgaatattta aaagaagaaa tagaaaaaaa
   165241 tatgtttaat tatatatctg gatttaaaaa atataatatg gaatcaatta ataatatgat
   165301 aaatgtatta aaaggtgata attgtgataa attatgcaat cctgatgaag ctaaagaatt
   165361 gttaaatttt ttacaagatc cacatgtaca aaatatgtta cttgatggtg aaattgattt
   165421 accacaaaaa aatgtcatta aagatttaaa ttcaaaaata ttaaataata gtgaatatgt
   165481 aactttaaat ataatgaatg aattattaga tactaatatt ggtaagaaat taatgcaaat
   165541 atttactgga tcatcatcag aatcattatc aaatactata ttaggtgcag aaaataaaat
   165601 taacaatggt ataaatttaa ataataatag ttttggattt aaagatagtg atatagtatt
   165661 aataactgtt atggaatgtt tagatgcaat tagagcatgt gcaaataata gtaaaaattg
   165721 ttgtgttaaa acaccatctt taactgttaa tgtaaataca ccaattacta aattatctgt
   165781 tgatggtact gaatttaaat tataatgaag tacacattaa taataattac aattttattc
   165841 atttatggta catatgaatt aaaattatgc gatgtttgta aatgtataga ttatggtgca
   165901 aattgtagaa ataaattttt agatgaatat attaatagaa ataatgaatc aatattattg
   165961 gatttacata atatatcttg gattgattta agttatacat tatatactta taatgctcag
   166021 aatattataa aatatatgaa aactttaagt tttttaaata tatcacataa tcatttacat
   166081 aatgcagatg ttgaaaattt atatttaaat agaagattgt ttaaattaga tttgtcgtat
   166141 aattttatat cttatttata tattattgat cattggatat ggttatctgt atcacataat
   166201 acaaatattt cattctatgt tgtatattca aatttagaat atttagatgc atcatattgt
   166261 ggtttgactt cattcaatta tacaaatgta tttccaaatc ttaaatatct aaacttatca
   166321 tacaattttt taactcatat agatattaaa tttatcaatg gatacaaatt aattcttaac
   166381 aataatgcaa tacaatatat attaaatatt aataatgtaa gatatgtaga tctttataat
   166441 aataatattt ctacaattga ttctatttct atttacaaca tatcatattt aaatgtatta
   166501 aaaaataata ttatatgtaa tagaacaact ttatatactt atttaaaata tacatatatt
   166561 attcctataa acattaaaat agcatgtaaa atgggaaaag atgaatatga tattgaaaat
   166621 ataatttgta aaaaaattaa agatgtgtat ttaaataaat ataaacatga aatgtattat
   166681 attgaaatta ctgcatatat attaactttc actgtagtat taattattgt tgtactatat
   166741 ataatatata ttataattaa taaatattat gaaaatgaat atgataataa taataataat
   166801 ataataatga ataatttaac tttataaaaa taatatatag taaaatgaac gaatacaaaa
   166861 ctgattttac aaaacaggag atatcagagg ctgcattaaa tcttattaaa gatcttaaat
   166921 caatgtttta tgaaattcat tatatagcaa atcaagcaat aataaatgac tccattaaat
   166981 gtatatattg taatgacgaa tgttataatg gtaatgtgtt caatataaaa gaaaattcaa
   167041 taaatatagg atacttttgt tcaaatatat gtagagatat attttattca attatacaat
   167101 ttatatttaa tattccgcca aataaagtta attttatacc attccaatta ctaaatgata
   167161 attctaaaga agattataat gtaattaaaa agatatttaa aaatatagat tataaaaatt
   167221 taatattatt ttcgaaatat aacaatgaac aaattatatc taattttaaa attatattaa
   167281 aaaataataa aatatggcat tttacatata aatttaattt tgaaacaaaa ataaataaat
   167341 gtttaaattg tggaagtgaa gaagtagata aagatataat tttattaaca aaatataaaa
   167401 cattacaagg attttgttca gtaatatgta aggataatat atgtaaacaa gtatactata
   167461 ctcttattcc aaaatataaa tatttaactt attctgtacc tactcaatta ttaaaaaatg
   167521 tagatgttaa aactatgata aataaactaa aaaataaatc taatgtatat ggtggatata
   167581 ctacatatga ttctaaaaat attaaacttg aatattttac tcctaattag aaaatgaaaa
   167641 tatatataaa atattaataa aatgattatt tcattatttg cattggtaat acttattgta
   167701 attttattta aattatcagt attaggacta ataaccaata ctaatgataa ttatagtagt
   167761 gatgaatccg attaaaaaat aatgaaaatt aatagttagc ataaatgata tttgataatt
   167821 tacattgtca aggtgttgat atgacttatt atttatattt aaaatttatt aaaaaagaaa
   167881 atagtaaaaa attaagagaa attatagaac caattaaaaa taatatggtt acaatatatt
   167941 tagaaacagt tatagttaaa aatacacttc gtaataaaga taaacctata gaatatattt
   168001 cacctattta aatttttaaa ttcattatat ttttcattta gtttatctac tgctttattt
   168061 attctgttca tatttttaca atacatatca atactttgtt catatttttt atttttcatc
   168121 tttataatat ttaatgtatt atattcatca aattttttaa catcatattt tgatataaaa
   168181 aaaattcctc tatatgaact agctataaga tcacctacaa atgtcatata taaatatgct
   168241 tttttaaaat ccatttcaca tttaagatta tttaaaataa tattatacaa aaataaaatt
   168301 gtaaacatac cacaatcagg actatcatat tgtatttcaa atgaattcat tataaatata
   168361 ttaatagtat caccaaatat atgtcttaaa atatcaatat tatgatataa atatgaagtt
   168421 ttttcgtttt gtatattata tcttttaata ttcatatcag tatctataaa catatatttt
   168481 ttattgtgtt taatttgttc aggactataa ccactactat taaataaata acatattttt
   168541 ctttttttat caattacagc agatgtaaaa tgatcattat atatcatagg aaatataaaa
   168601 aattgtttat tattattttt taaaaattga gaataatggt gcataaattg atttttagaa
   168661 aatttacatc ctgaatatac catagctcta gatgaatcag ttacaggaaa atgtaataat
   168721 ttgtaatatt cataatcatt atttataaat gttaaaggat atacaacatt ataaatatca
   168781 aatacatgta accaagtatc ctttccatga tttgcttttg gatatatttt atgaatatta
   168841 ttaaatccta tatgtacatt attttctcta gaataatcat cttgaataga tgcatacatt
   168901 gaaaagtctt ttgttttaga aaattcacat ttaataaatg gttttctaaa atatataagt
   168961 ggtatatttt tatattttga tgattttaaa aaatcattaa ttttaatatc tttttctgat
   169021 aaataaatat ataacatatt tattaaatat tctttcattt caaattcaga tttaaaatta
   169081 atagacaaat caccatattg agatttataa aaatctaata aaaattctaa tggaatataa
   169141 gatatttttc ctttggtttc tgatttatca aaatgattaa ttaatggtgt attagcattt
   169201 gtagaataat caataggatt tataaaatga ataattttaa atttatcaag taacatcata
   169261 agtatataat taatacctga ttcaggcatc tttaaatttt tattaaaaaa tcttctaata
   169321 gttgtttgca tatttattat taaatataaa tgacagtttt tagtacaaca tattatatag
   169381 tgaatactat tatagtttta atattattag ctgcagttat tgtaatatac gtattttatt
   169441 ttttaaattc accaatagtg tataaatctg ttacaaaaat aatagcttta aatgcaaatg
   169501 gcattgcatt aaataattta aatttacttt atacaacaga tatgatatta attaatgatt
   169561 caactataaa aggaattgaa gtaagttctg aaaataattt aaaagattta gaagtatata
   169621 caggtgatga tgtctcaaaa tatactaatt atttaaattt ttattctata tattctggtg
   169681 atcaaactgt attagttggt atttctaatg caattcaaga tattagacca tttatttatt
   169741 ttacaccatc tataatagct atagtattag ttgtaaatga aatatgttat tgttttatgg
   169801 gatctaataa ttccgtagca gatgatatta ttgcaacaat atattatatt actgaaaatt
   169861 attcatcatt tgttatagtt ggtcctttaa caatagaata tactagtcaa tttttaaata
   169921 ttcctataaa tactgattat agagtaataa caaataaaaa aatattgagt ttagatacac
   169981 aaatattttc atatgaaatt gatcctggta ttttatttac aattgggtca tagaatattc
   170041 ttgaattatt ttttctactg cttcataagg ttttgataat atgtctatat ttaatttatt
   170101 aatcaatagt ttaaattgat caatatgtac aataagacga aatgaatcat tgtattcact
   170161 tttactatat gtaatatttt tttctatcaa aactttttca agattttttg ttaatagttc
   170221 attattatat ggaatttcca tagctcttaa aataatatca aaatcacatt taaataattc
   170281 tccactatca ccatatttat attcagacaa tttataacat aaatagtttt ttactaaaac
   170341 catatcatca acatttattt ttattttaca aggaaattca atattatctt ttgaataata
   170401 aattgcatat atttcatttt ttttgtattc atcaacataa atatacccag gactatcatt
   170461 tataggtatt tttggtccaa aatatagaaa ttttaatata gaactagtaa ttaacacatt
   170521 tgatttatta tacataggca aacaaatatc ttttatccat ggattcataa taatattttc
   170581 attttgttta ttctcaatat attcatatat atgttccatc attgtcattg tcaataatta
   170641 cattattttt tcaaagatat taaattttaa atggaaaaaa taaaaatatt taataaaaat
   170701 gagtttaatg atataaaaaa atttcaaaaa gaaaataaat taactaataa tgcattgttt
   170761 aatgcttggt atgaagataa aaatccattt tgttattgtg taattaaaaa tgataaaata
   170821 atatgtatag tattattatc acattgtgat tttagtgata aaaagtatat tttaaattat
   170881 atatacacat taaaaaatta tagaagacaa ggatatgcat ttaaattagt taattatata
   170941 aaacacaaaa ttaatttttc tgtattttgt atgaattatg aatcaaaaaa attgtttgaa
   171001 aaatgtggat tatttaaaat gtaaactaca attattagga caattgcttt tcatatcatt
   171061 ccaaaaactt aattttttat caactttaca gtcaaatgtt tctgtaaaat attcttcaaa
   171121 ttctttacgt ttaattgatg ttttattata tttctcaaat gcttctttta ataattcttc
   171181 tttttcatta gaagataaac tatcaaataa ttttatattt ttaataacta cattatttgc
   171241 agtaatttgt ctattaatag ttatattatc ttcgaatatt attggataaa ctacactttg
   171301 tttatttatt gaatttatat aaaattcttc atgcttttct ttaattatat ttattaatgt
   171361 atcattagaa tcaataacag catttaatac atattctaaa tctaagtaat ataatttata
   171421 taattcatta tttaatttag ttttattcgg tgatgtaaca ttaatattat atctattcat
   171481 taaagtatta aaatcttttt caattttagt agcatcataa acttctttat aaaatacata
   171541 ataatatgga tcactagcac ctgtattata agtcgataat ctatttttta tagaattaat
   171601 attagtttta ccaattttaa atatattttt tgacaaatca gtgttattag ttaaaacata
   171661 aattatttca tttttttcta atttttgtaa tctattacaa tattctttgt attgttcatt
   171721 taactttttt tgtttttcta attcctcttt tattttattt tcttgatcta attgttgttg
   171781 taattgttct ttttcttgat ttaattgttg ttgtaattgt tctttttctt gttcttttaa
   171841 agttagtaaa ttttgaaaat tagtagttaa tgtttctaat tcttttttta ttttatattc
   171901 accatgtttt ctaatatttg gtaaaacttc attagttatc cattttttaa atattttagc
   171961 ttctgatttt ttagatgata aaattaatga atataatcca gattctgata tataaatagt
   172021 atttttttca ttatatgtta gactcggcaa aataccgggt ctattaataa ggtcttcata
   172081 tttagattta tcatcatcat caacatgttt tttaatagca tcattagtat ctttatattc
   172141 taaaatttca gctatatctt ttcctttaaa atatggttta ttttcatata tagcaatatg
   172201 aattttttta ttattaaata ttaaattatc taaatccatt ttattttata ttttaatatt
   172261 aatttttcat agactgttat aaaaatttat tttgaaatta atgaataaaa atcagattca
   172321 gtaataaata ttgtgtctgg atgtatatta tttaatatga acgaatcgtt catattaata
   172381 tttttaaatg aaatttgatg tttttgtcta acatgatctc gaattgcttt taaagggttt
   172441 gtatatttca aaatttcagc acaattttta gctttaaata aaactttatt attattatca
   172501 ataacaatat gaattttttt attattaaat attaaattat ctaaattcat ttgttttatt
   172561 ttttaatata aaaacatgta ttttatttat cagattatat atattaaaat ctgtatcata
   172621 aggattaaat ctaataaatt tacaatttaa ttcattttgt attaatattt gtctatactt
   172681 atcataagat gtataatgac cattataatt atatttatca cattctatag caatttttaa
   172741 atctgtaaaa tacaaatcta tataaaattc aaatacttta tattgtgttt tgtatctatg
   172801 attaataaaa caagaaataa ttacatcaat atatttttgt tctttaggtg taatatttaa
   172861 atctacattt aaatcaaatt tacatattaa tttatcaatt atattatgat gtactattga
   172921 tttatgtttt aatattaatt caattaaacc aaaattatta atgaaaactg tatgtggatg
   172981 tatatatttt ttagatcgta tgttaatatt tttaaatttt attttattgc catttgatac
   173041 ataatgtcta atagcatctt tagtatgttt aaattctaaa atacttgcac aatcttttgc
   173101 tctaaaatat gatttattat taaatatagc aacataaata ttcattttat tttttattta
   173161 ttatttcaat caatgaaata atactattaa aaatttatat aggcatgtat tataaaaata
   173221 atagaaatta tggaataatc taacaagtgc tacaagtata accgtataga ctataaattt
   173281 atactgatat ttcattgatc attttaaaaa tatatttatt ttttatttca gttttacata
   173341 atggacaatt ataattattt aacagccaat tatctataca ttttttatga aatacatgtt
   173401 tacatatagt tttactaaat aaacattttt catcagataa acatatagga cattcattat
   173461 aattttcaaa aattatatca tatggaaaaa atatttctat taattcagat tttgataaat
   173521 ttctaaattt atctaaaata tgaatccaat atggtaataa tttatcccta aattcaataa
   173581 ctatatcttt tgttaatatt gtatgatttt gtattattac aatacaccaa ttaatttcat
   173641 ttttatattc tctcataata tctaatgtta gtaaattatt acaagatata ttacaccaat
   173701 gcattttatc tttatatttt ttaataatat caattgataa tttattaaat tcacataaat
   173761 atctccaatt aattttatct ttaaattcta ttatattatc atctgttaat tctataaatg
   173821 ctgatacttt tttccaatta agtttatcct gatattttct aatgaaatta atagaaaaat
   173881 ttttattata aagtaaatcc caattaactt tatctttatg ttttataata aatttttcag
   173941 ataatatttg atattttgat atttcttccc aattaacatt atcttgaaat tctataataa
   174001 atttttcaga taatttttga tgttttgata tttctttcca attaacctta tctttaaatt
   174061 ttctaataaa actttctgat aatttttgag atattgatat atgatcccaa tcaaatatat
   174121 cttgcatatc tataataaaa tcttcattta aattattata ttttgataat atatatatca
   174181 atgatacatt attatatttt ttaatataat caattataac tgttctattt tctttatttg
   174241 ttgataaata aaccttatat aatttataaa attcataata atattgcatt atgatttaaa
   174301 gtaatatata aaaattcaat atctgataat tatttgagta tttttataat taattggttt
   174361 attacttttt tcccaattta atattttaga aatatgtttc cataatgtta atttgttaca
   174421 agaacaaata tctaattttc taagtaattc acttctagtt atatttaaat tattagattc
   174481 tatatattca tctaataatg caaatatttt atcttttagt tcatttaata aaatagattc
   174541 agaagtaata attaattctt caggaataaa aggttttaaa tcatacattt taattaattc
   174601 atttttaatt atatcattaa tattatcata tggttcatta atatttttaa taattaattt
   174661 tacaatattt aataaatatt tataatgtaa aataaagaat tcattatttg aagaatctct
   174721 aaatgattcc aatacatcat gaattatttg ttcaacttta ttaggattat atacagcctc
   174781 ataataacaa atataaattt tatcaaatga cgtatgtgaa ttatttaatt gcgattgtct
   174841 tttagaaatt aaattatcag ttttaccaat tttaaatgta tttaatttag cataattttt
   174901 agacgtagct atataaatat atcctttttt atttttttgt tttatattat ttacaaaatt
   174961 atttagtaca ttatttgatg attgcaatat ttttaattgc tcatcttttt gttttatttg
   175021 tttaattgat tcttcaatta aatatttatt agtataatta gaatatttaa ataatatttt
   175081 ttctaataaa ataaaatatt ctctaacttc aatagcaaca tttgtagata gcctcataat
   175141 taacatttta aattcatcaa ctgataaaat aaaccatgtt gatttttcta aattacaagg
   175201 tctaatattt tcaatttctt ctttaacttt attataataa tcttcattat tgattatatc
   175261 attatattta atttttttat aattaatttt attattattt aaaatttttt caaaatcacg
   175321 ttttaaatta gtattatttc gcattggatg gtaatccaac acgacatttg atgttccata
   175381 atgtataaaa tttaaaatat ttaaagtaat taataattct gtttcattaa ataatggtat
   175441 ccaaatttca ttaaaccaag gtcctaattt aatatcaaaa ttattttgtt caatgaattc
   175501 gaatatattt agcattttaa tttacttttt aaatattaat ttttcataga ctatttacta
   175561 tatgaaattt tatcaataaa aataattatg caatttatat ttatgtaata tattttctaa
   175621 tgtaacataa tattcacaaa tttctttagc aacattagta gacaatctca taattaacat
   175681 tttaaattgt aaaacgtcta aaataaacca agttgattta tttaaattat tgggtgttat
   175741 atttttaatt tcatttttaa ctaattcata ataattttta ttatttacaa tttcttcata
   175801 ttttattttt ttatatttta ttttattatt gtttaaaatt ttttcaaaat cacgtttcaa
   175861 ttcacgataa tttagtgtag tattcccatc caacactgat ttcgatgttc cataatgaat
   175921 aaaatgtaaa atatttaatg taattaataa ctctgtttta ttaaataaag gcaaccaaat
   175981 ttcattgaac catgagccta aattaatttc aaaattattt tgttcaatga attcgaatat
   176041 atttagcatt ttaatttatt ttttaaatat taatttttca tagactattt actatatgaa
   176101 attttataaa taaaaataat tatgtaattt atttctaatg tgatataata atcacgtatt
   176161 tcattagcgg tatttgttct taatttttaa aatttttaac tgtcattaat atccatgttt
   176221 tttgaactaa attattatgt tttatagatt taatatcatt ttgtatatat tcatattcta
   176281 atactaatgg attatcatat ttaatttcta tatattctaa attataattt ttacatgaat
   176341 caataaaatg acctttttca cagtccacaa agatggactc tgaaattaag cataaaatat
   176401 atttagtaat taatacatat ttttattaaa taatggtaac caaatgtcat taaaccaagg
   176461 tcctaaatta aattcaaata tatttagcat tttaaatatt aatttttcat atactgttaa
   176521 taaaaataat tatgtagaag taatacaaat cccattaaac caatgtccta tatatttatt
   176581 tttcatagac tgtttcatta aaaatgtctc aaatatacct attaaaaccc aataatcatt
   176641 ttttttattt tacagttaca atcatcatca tcaaaatttt ctgataattt gcgtttgaga
   176701 ttagattcaa cattttcaat ttttttcatt ttatagttac aaacatcatc atcaaaattt
   176761 tctggtaatt tgcgtttgtg acaattacca ttatttacaa atttatattc aatatcaata
   176821 tacgattctt gattttcagg aagagatata caaaatttat aatatttttt taaagaattt
   176881 tcaattttat gaattatatt tagtatattt gattcttggt ccataatgat ttctactaat
   176941 ttcataatat taataggaat accattacta tgttcaaaat tataatattc atggaatata
   177001 ttatcaattt tattaatcat atcataatta agtaattttt ctttatctag aagtaaattc
   177061 aatttatatt tagcaataca aattctattt gaaattatca tattattaaa catcatcaga
   177121 ttttttggta tatgacattt aggaatattt gtcattttag tagttgtagg atgatataat
   177181 ccaattttaa ttatatatac ttatttttca taaaaatagg ctaagaaatc atattcatca
   177241 ttctttcttt aataatatta tgtatttcag gtatacatct tttataatat tttttatata
   177301 aattatatat taaatgtata tctaaagaat caaatattaa ttttattgta ctatccttta
   177361 atttgtgagt taacattaat tttataattt tattattaat tatattttta ttattttcta
   177421 accatttatt tatacaaggc attaatatgt aattatcaaa taattcaata ttaagatatt
   177481 cacaaataat ttcttcttta tgatcaatta tttcaggaat attccatttt ccattattag
   177541 caataaatat cataaatcta gtatatttat caatagataa catttgcaat tcattattat
   177601 atggcagtaa atatttatat ttatgtttcc ttatttttat tataccatta tcattataaa
   177661 taaatggaca tatataaatt aaaatatttt taagtgtttc atcttttata tatttataag
   177721 cattatttgt aaatatatca tacgtaaaat tatataaata tattaataaa tcattaatat
   177781 cataaaatcc cattttttca actaaaccaa ttttatttat ataatatatt gggtctatcc
   177841 atgctaaata attacaaata ttatcaaatt tatttgcatt ttctatttta tatttatgaa
   177901 ataaatattt tatttttata ttatcagtac aatatataaa agtatcaaac atattaatag
   177961 gaagtaaaaa taaataatca tctttaatgt tatgatattt tatacctatt gtaattaaat
   178021 attttaataa agcatagttt tgtttatcat tatatatttt agatagtaaa ttatcatatt
   178081 gtatttcatc aaaatcttct aatttatgat attttaattt agcattatat ggaatattta
   178141 aaaaattgtt taaattatct ttaatatatt taattgataa cattgaacta ttattaatat
   178201 attccattgc aatcaatcaa ttattattca tttttcattt ttaataaaaa tattttattt
   178261 aataatttca attttaataa aatcgtaaat gataaatatt aaagttaaaa ttggatcttg
   178321 acaaaatttt tgcccgcaaa tcatacaatt accataataa tcttcatctg acatgacatt
   178381 acatgttgca catttctcaa ctggaacaaa tccccttaag tccattctta cacgttatgt
   178441 aactatacat tacatatata ctatttattc attattcatc attaaatcat gtattacatt
   178501 tattatatca aatatattag atttttcatc aaaaataaca aatttacaat ttaattgatt
   178561 ttcaatttca atttgtctat ttttattata attattgttt ttatactcaa ctgcaatttt
   178621 ataaactgga aaatataaat ctatataata ttctccaata tggtattcaa ttttatattt
   178681 atcattttta aaacatttaa ttatatttgt tagaatatta tcttttgtat tatgtgtact
   178741 agtactgagg ttatgtttat taatattata tttttcaata atattattag aattactaga
   178801 ttttttaata ttatgagaat ttaaaaattc aattaaatca ttaatttctt tatttgataa
   178861 tcgtttgact ggcatatcaa ataaattttt taatccttta gtgtttataa atattgtgtg
   178921 atgcggtgtt ttatgtaatt gtccattaat agatacattt ttaataagtg ttgagtaatt
   178981 tactttatta gtagaaagca cattatttct aattactttt ttagtatcga tatatcgtaa
   179041 tattttagct atatcttttc ctttataata tacttcacca atagtagtat ataaaaggtg
   179101 aatttgattg ttattataat ttattatttc catttgtaat actttttata tatcattttt
   179161 catatatttt tccgttgtat tattatttga cgtcgacaca ttggacaagt attgttatta
   179221 tttaaccata tatcaataca ttttttatga aaaatatgat tacacatggt tttagtaaaa
   179281 ttattttgtt cattagataa acatattata caatcttcat tatttatatt atcaaatatt
   179341 tcatatgctt tacataactc tatatacaat ttatttgata tattttgata agtacagata
   179401 ttatatttat taattttatt tatatgtttt ttaataaaat attcagataa tgtttgatat
   179461 ttagatatat catcccaatt taatttaatt tcaaattttt caattaagta ttctgataaa
   179521 atttgatgtt tagctatata ttcccaatgt aatttatcat gatattgtaa aattatatct
   179581 tctgataatt cttgatattg tgatatatat tcccaatgta atttatcatg atactgtaaa
   179641 attatatctt ctgataattt ttgatgttta gatacaatat tccaattgat tttattttca
   179701 ttttttctaa taaaattatc tgataatatt tgatattgac agatatattc aaatggaact
   179761 ttataataaa atttttcaat tatattttct gataattttt gatatttata caaaacatcc
   179821 caatcaattt tatttttaaa tttcataata acatcttctg ataatttttg atattgacat
   179881 atatatttcc aatttaatct atttttatat tttattaaaa acgattttga tattttttta
   179941 ttaattgata tactatccca atttaaataa tctttatact cgtcaataaa gtgattatat
   180001 aattttttat ttgatattat attccaattt aaataatctt taaattcctt aataaaatca
   180061 atacttaatt ttttgtctga taatatagtc caatttaatt tatctttaaa aacaataata
   180121 aactctgaaa taatagcatt tagtctactt gaaattaaat tccaatttaa tttatctgca
   180181 aaatctctaa aaaattcaat agacctatga tgtggaatat tatcactatc aaaatatata
   180241 tattctgata ttgatgtcca atctaatata tcgttgtaac gtctaattag actttctggc
   180301 aaataccgaa ttggtatttc tcgtaaatat aatctatgtt cgaattttat aataaaatca
   180361 acagataaat atttttcagt tgatattata aaccaatcta atttatcttc aaattctaaa
   180421 gcaaattgta tatttatgtt agaatgtttt gatacaagtg cccaatttac tgtatttgga
   180481 ttttttttaa tataatttat atctaaatta ttataataat atattataaa actatctata
   180541 tgtctattac taatattatt agatattata tattgaatta ttttaaattt gtatttagta
   180601 tccgaattat aaaatatttt atataattta tcattgggta tattatcaaa tttatattct
   180661 aataaattta aaagttgttg ttttttaaac ccagaaacat atgataatcc attttcttta
   180721 agtttattaa ttatttcact gcaagtgggc atttgtattt atatatatat ttatccgcta
   180781 atatatatta atatcatttc ataaattatt aaaaaaaata aaataatcga aaatactgta
   180841 agtgaattat ataataataa aattaataaa attataagaa ttgctactgt atatgcatca
   180901 aattctaatt cttttattct aaaaaatggt gtagttaata atctatacat agttgtatta
   180961 ttaatactat acaaaaataa actattatgt ttaagaccca tagatgaatt atatccactt
   181021 ggttgaacaa tcatcttatt tacacataat atatatgatg atatattcat atagtttact
   181081 atatctaaac ttaattgaac atcaatatga aaccatactt tatattcaat ataataatct
   181141 gatattattt ttgctatatt actagttaat gcatatgcac ctaatgacat attaatcatt
   181201 ggatttttta ttattgtaca ttctttatct ataataattt tactatccca tcctaaacaa
   181261 taatcagaat ataaaaatgt aaatccggtt tttgtcaaat tatatatata atcgatatat
   181321 ttatttaatt tatcaatatt aattattgta tcatcttcta atacaattac aaaatcatat
   181381 ttagattcta atgaagctat aaatttccat aaaagtatat gtgacgcagc acatgccata
   181441 acaccatatg gactaatttg tttaaaaata tgtctagcta catattttac attatccttg
   181501 ttttgtttgt aatcaatacc ataaaaaaaa ctataattat tatatttttg agcattcata
   181561 taatttatta tatccttttg tctttgttta tttcttttaa tagttaaaac tattatatga
   181621 tatctaatat tcatttatat atttaaacta tttttatata ccatagatat atcatatatt
   181681 cgttttaaaa tgttacattg tagtaatgca tagtcgaaag attggttatt tatttcttgt
   181741 atgattcttt ctaattcatt tatacgtttc tttaatgatt gtatttcaga tatatgttgc
   181801 atattatatt gatttaataa attatatgat ttaattaatt tttgatattt tatttgtaat
   181861 tgatcgatca tgatagtgat atttatatta attaaattat attaaacaac ttatccaatc
   181921 aatttcaata tttttatgta tttttaaata ttcattagct tttataaaac actttgaatt
   181981 aataaatggt attacattat atttactgtt ttcactatat aatgtttgat atgatggata
   182041 acttgtttta ataataaaat gattatctat attatgaatt atattacatt tatcatgcat
   182101 tttacttcca attaatataa atacaatatt atcattatta attgatattt ttttaattat
   182161 atcattagtt aaatattccc atccaatatc agaatgatca tttatatttg agcctatagt
   182221 taaattaaca tttaataata aaactccttg tttagctaaa cattcaagac tacttttatg
   182281 cattttatct gatattttat ctaatctatt ataattagaa aatatttcat taataaataa
   182341 tttattttct ataggtttat ttttatattc atttggacaa gaaaatgcta atccatcttg
   182401 aattaatgaa aatggtctat aacctaatat tacaacatta gtatgttctg gattaaaata
   182461 tttaaaacat ttaaatatat tttcttttga tggtttaata atatgtttat catttaatct
   182521 attttctata tcaataatca attttttatc tatataacat ttccaattat ctggaataaa
   182581 atcataaaat gtcattttat aattgtatct ttaatttctg atattatttc attaatgtat
   182641 gatttaaaag aatttttagt catcatgtat ttggattgta gatctaataa catagatatc
   182701 aatctttctt tatctttaac ttcgattttt aattctttta tttctttaat aatattatct
   182761 acatccattt attgtatata taaataataa tggtattttt gttttttatg atatattttt
   182821 ttatattatc aataaatatt attttaaata aagaattgta taaattagaa ttagataaaa
   182881 aattatatca agttgcagaa gatgatttaa aaactactat tagttgtatt aatgattatt
   182941 ggtttattgt taaaagaaat tctagatatt tagatttaca atatcttaga cgaaataata
   183001 attatgtacc atgtacaaca acgccattag caagtgattt tttagattct tgtggtttaa
   183061 atgctaaata taataataaa aaagaaccat gttatgctgc attattaaat cttttatttt
   183121 tattgcgata aataataatg aatgaaaaaa tacaattata ttataacact atcaaatatg
   183181 gcattttttg aattagaagt aaatatggtt aaagatttaa tgattaaata tgaacatgga
   183241 attgttacca aaaatcacta ttttgatatg ttaaatatta ttttaaatac tgtaaataat
   183301 aaaataatta atacattata ccatacatat gttaatgcta ataatgatga tgataaaata
   183361 attgatataa tgaataaatt atataatgat atgaatgaat taatatttct tattcaaaat
   183421 atttttacaa atcatttagt tgaacatcaa tatgttttaa aaaatctgga aatataattg
   183481 tatttatgac tggtatttca tatgcaataa cattttttat catgattgtt atattcataa
   183541 taatcaatta ctattatata ttttgattta aatattctaa atttataatt attaaataat
   183601 aaaaaaatat tattaatatt tatatttttt atatcattct tatttaaata atatatttca
   183661 ttacctatat tatagtagtc attataatca tatataaaaa tttccatatc atctataata
   183721 attttatttt ccatatttac cattgactga taagattaag aatatttata gaaatatctt
   183781 tgcatgttat tattacatca ttacctttat taagtaatat aatgcttaat actgattcta
   183841 agaatctatt ataatttgaa atatcatatt ttatatgtga tgattctaat atactcatac
   183901 cattatcaaa agataatttt attttttttt ctatactatt tggaataata aacgatttaa
   183961 ttaaattact atatatatat ttacaactat cctttgaagt atataattca atattttgta
   184021 tattatttat tactggtatt atatcaatta tagttacgtc ttttttaaaa atatatgtat
   184081 aataaggtgt tattaagtta tatattccat ccttattgac aagtttcact gacagcattt
   184141 atcttataat aattattttt aacataaatg tttatacaat tttatgtaaa tgttctacga
   184201 gatagattaa aaatactaag tatatttaat ccaaatggta ctttatggtg tgatggtact
   184261 aaatgtgaaa ttgtttttac atcaaatttc aaatgttgta tatcaattcc ttttataaaa
   184321 acaaatatta cagaacttag aggatttgat atatgttatg ataaaataag cgaattatca
   184381 ttaaaaaatt ctatagcaga taaaataaca cttacattta aagataatgg aatatatgta
   184441 gaagaattaa tattcgaaaa taatataaat ataattgatc caaaatatat ttctatgcaa
   184501 tcaatatctc aaattaatac tccttcaaat aataataata attttgcttc tgctgaaaga
   184561 atagatgata tttctgatat taatgaaact gataatatta tatcagaaaa acttgaatta
   184621 aaaaagcatg atagtggtga tttaacaatt ggatacacaa ttcatgataa atttacatta
   184681 aatacaaaca atacatataa atataggatt aatcctaata tgtataataa agtaggtgca
   184741 gtatttaaaa ttaaattaga tgtattaaca gaatttatta aaaaattaat gacaacaaaa
   184801 ggtgcctcaa ttgaaatgca agtaattaaa aatacaatta aatttaaagc ttatagaact
   184861 gataatatta aaaataatac tatagatgaa tcatgtttat attgttcatt gattaattta
   184921 tattatccaa ttttaagaaa atataaaatt gctttaaata attttgcatt attaaaaaaa
   184981 ttaaatatta gtatatctga ttttaaagct aaagataaaa aaatatataa atatatacaa
   185041 tttaatatta taatgcaaga agatttagtt attggattat gtatatatcc aggatcagcc
   185101 aatattacta atcctgaaga attacaaaat tattttatat ttatgcctgt tgaaaattat
   185161 tagaattaag tagttgttca gatatactat ctattttatc atttaataat tttatattat
   185221 aattaatatt atttaatatt gtatctaact tttctctagt ataacttgtt ggatcatcaa
   185281 ccatatttat agaatcatta gtaaaattat tatttaaatt tgatatgtct atattttccc
   185341 aatttacaaa tttatcattg taattaattt gtgatttaat gctgttaata atatttatac
   185401 taatatcatc attataatat tctacttttt ttgttctatt attactatta aatacagtcg
   185461 catatattat taaattatta agagatattt cattttctac atatcttaat ccaaatttaa
   185521 ttccataagg gcataatctt ttatctatta atataaatga tgtttgtgaa tatatattat
   185581 ctgatacata attaaaaata ccatcatagc atgatgatat tgtagtattt tttttaaata
   185641 tattatttat aatagattgt atatattttc cattaagacc tgtttcacca cacattataa
   185701 ataatttgtc attaataaag ttatttttga tgtataatat tatattacct aaaatattat
   185761 aatattcagc atcatcattt gttgatgcta ttttattaat tgaaattaaa acaatttcat
   185821 taaaattgta taaaatattt gtaataataa tatggtcatt aatatcacta gaattactag
   185881 ttaaatattt taatatattt ttatcataat taagtcttct aatattttta ttattagaat
   185941 ttgcacaaat ataatcacca cgcccattaa caacagcaaa ccatccagga taaagccaat
   186001 tcaatgatcc attaattata ttatttgttg gaaatgttaa tgaattatta taaaaaccac
   186061 cataggcaat taattcattt tttataaaat tagtaaaaaa cataaatgaa ggttttaaat
   186121 ttaaatctat caaattatca aatgttctag aattaataat actttctcta aaagatcctt
   186181 taattattat aaattctgtt gtataattat aattataatt ataattatta atacatttta
   186241 taataaaaaa tataaaaaaa ataattccaa ctataacata aaatataata ttattattca
   186301 tttaatgcat aaatatcttt tttattcatc gtatgttaat atttctttag tatatgatga
   186361 tgtatcattt ttaagataat cttttttata ttcaaaattt gtatttaatg tacttgtatc
   186421 tattttatcc caatttacat aatcatctat gtaatcactt ctacttttaa ttgattcaaa
   186481 aatatttata cttaacgcat ctgtaaaata ttctatttta tttccagtat aattttcatt
   186541 atatatataa gcatataata ataaattata tttgagtatt tcattttcta aatatttaac
   186601 cccaaatcta acaccatatg aacataaatt tttatctaaa ataataaatg ttgtttgtgc
   186661 atataaacca ttattattaa aatatgtaat actaccatta taacatgaag atataacagt
   186721 atctaaaaaa attgtttcta ttgctaaatt tatatattta ctattcaatc caaccgatcc
   186781 acaaataata aattttttat tattaagata attattttta atatataata aaatattacc
   186841 tagatattca taatattcag aattattaaa atcggatgat aattcattta tatttattaa
   186901 taaaagttct tcagatttat atattatatt aagaactata atattatcat ttgttttacc
   186961 aggatttata cttaatttat caactgtata atttttgtca tatcttttaa tattactatt
   187021 attagaatct acacaaataa aatcaccatt tccattacct aaaataaaat atccattata
   187081 tatccatcca tttctgttta ttatattatt aattggataa tttaataatt tattaaatcc
   187141 accatatgca agtatatcgt cagtttttaa attagataaa aataccaatg ttggtttaat
   187201 ttttgaatat tgtaaaccat ctaaacatct atctaatatt acgttatcca tccaaccaac
   187261 aattatgtta aattccacaa tttcttcttc attaactggt aattttgaca ttataagatt
   187321 actgtaatca ttattaatat aattttttat tttacttata aaatcattta tatcccatat
   187381 tatatatata attagatata tagctaatac tactaacaaa acaaaatata tcatttattt
   187441 aataatgatt ctatattttt tttagaaata tatttttctt ctttaaatac ataaatattt
   187501 tcaaaatttg tatccaatgt acttgtatca attaaattcc attcaacata tttattatca
   187561 taattagaac ttgattttat agattctaat atagtaatag ttaagggatc attaaaatat
   187621 tcattttcat taggttcatt atatataata gcatataata atatattagt aaatggtgta
   187681 ggatcactaa taggatattt taaaccaaat ttaacaccat tttcacataa tgatttttta
   187741 atacaaaaaa aaatagattg tgtaaatgta ttatctctag catatgttat tacaccatca
   187801 taacaagaag ttattacatc atctccaaat acagtatcta ttattaattt attatacttt
   187861 ccatttaatc cattatcaca aaacaatata aataaattat cttttattat ttctttttta
   187921 atataagtta aaattttacc agtatattga aaataatcat tactaataat attaccttga
   187981 gatatttttg ttacatttat taataaaata tcaatttgat ttttatatag tattttactt
   188041 acaattatat gatcattatc atctgatgga tcatattgaa tataactttc ataaaattgt
   188101 ccataaaatc tattaaaatt attaagattg ttactcctaa cacaaatagc atctaaatta
   188161 gcattagcat ttataaacca accaccatat atccattggc ttgatttatt aagattatta
   188221 ttaggaaagt ttaaatattt attttcatta ttaacatact catttcttaa aaaattatta
   188281 aaaaatacaa tagatggtat atttttttca tattgaatac catctaaact tctataaata
   188341 ctattatttc ttgatgacaa accatataat ataatattat ttgaataatc ttttgtattt
   188401 atttttgata atatattatt actaatttct gttaatgtat tatttaatac attgtataca
   188461 ttagtatttg tataataatt agtaaatata aataaataaa taataaatac tattcccact
   188521 ataacaaaat atatatattt catttattta ttatattttc caataaagtt ctactatatt
   188581 ttacattatt attatcaatt aatgtatctt cattaatttc atattctttt gttaaattat
   188641 caatatttat tttatcccaa ttaatataat cgtctataaa attatcacta gattgataat
   188701 atttaaagat atctaatgtc aatttatcat caaaataatt aacagtgtat tcacctatat
   188761 ttttattata aactgtagca tataatataa aattaaaatt agaagatgat atttctaaat
   188821 atctaattcc aaatctaaca ccatatggac ataaatcttt atgaattata ataaatgacg
   188881 attgtacaag aatgtcattt tcaacattag taaatgaatt attataacat gatgatattg
   188941 tattatctaa aaatacagtt tttattgcta aatccataaa tttactattt ataccagtta
   189001 taccactaat tataaaattt ttatccttta taacatttat attaagatat accaatatat
   189061 ttaaaaaaat tgaataataa ttttcattta aagcattatc aggttttgac attctaatat
   189121 taattaatat tacttctttc aaattatata ttatatttgt atacataata tttgatgtta
   189181 agctattatc attatatttt aaattattta ttatattatc agatttatta aatcttctaa
   189241 ttttttcatt attggctttc actgaaataa aatcaccatt atttgcaaca ataaaatatc
   189301 caccatatat ccaattatca gattcattag taatattatt agcaggaaaa tctaatgtag
   189361 cattaaaacc tccatacatt ataacatcac tagttttaag attgtttaaa aatataaaag
   189421 taggaatatt tttaatactt tgcataccat tcataacatt atctataata gaattttcaa
   189481 aagatccttg tgtaatcata aaatctatac ctatttcatt aactatacta tcactaaatg
   189541 tattacttaa ttgcttataa tattcagata aaatattagt gttagtatct tttaaaaaat
   189601 ttatatattt atttttttca tattttaata aaaatattaa taaaaatatt aaaaatataa
   189661 taccaactat aacatattca atcatttatt attaatttgt attaccattt ccattagttt
   189721 gttcaggagg tttataacta tatactaaaa ttattattaa aataattaat aataccaata
   189781 atatcaaata ataaatcgta tcagattcca tttaaatgat aaatgatgca tgaaaaataa
   189841 cttttaaaat ataatataca gccatggata agaacgataa caataaacca acaaaacctg
   189901 taaaaacaga aactatatat attgttacta attccggtgg aacaaatgct gattcaacta
   189961 atactttaaa ataaatttac atgatgcgcg tatatatttt atttttatga tttacctcaa
   190021 tatttagata attaagaatg tcaaaagatt tataatttaa ttttaaatat attaacaaat
   190081 tatatttatt taaagtttta attgcattat atatatcaaa gttatgaaaa tcataatatt
   190141 cgttagaatt atatattata tcatttttaa aatagtattc atcatatgta tttgggaata
   190201 atatttttaa taatttatat ttattatatt ttaatatttt ttttgattta tacataatat
   190261 ataaggcatt acatatattt ttataattta ttttttttcc ataaagtata ctggctaatt
   190321 ctatagatat ttctttaaat tttataatat tatttagatt agaacaacaa ttattttttt
   190381 ctggattata aaatattatt ccacacgaat ataataaata tatattatta ggtttcttat
   190441 tatatgttat attttttata aataatatac cacttttatt atgatcattt tttggtatat
   190501 ttaaatctaa tatttttaat ggattaaata attgtaattt tatattatta aaatctgtat
   190561 taaaattata ttcactatat gtacttttta aataattaat ccataaatta tgattttcat
   190621 ctaattcatt actatttaaa aataatttag tataatattc tctatataac acctctatat
   190681 gatttatata ttttgaaagt tcattattat aaatatatat tatagattct aatgataatt
   190741 ttggaaatat attttttaaa atataatcaa aatatttttt tatatttcta gatttattaa
   190801 ataaatgata attttcacat aatatttttt tgtaataatt tttatgtatt atgcaaactt
   190861 ttttggagtc tttaatattg tataatggat tatttataac ttgactacat gtacatatat
   190921 tacttttcca caaatacatt tttttattat tgaaaaatga tataaaattt taaatttata
   190981 atgaatattt tgtataataa ttatactgag ggattaatat tatacaatcc aattaaaata
   191041 tatgaaataa atgatcaaga aaaaattaaa ctaaatcttc atttatttat ggataaaaaa
   191101 aaatttaaaa ttaatatgca tacattatcc tttaatgaat ttatgtcaaa attatatctt
   191161 attattgtat caaaaataaa agataataat ttaaaagaaa atatacatac atatttaaaa
   191221 tataatataa atattaatga atataaaaac ataaacacag aaataaatga tattaataaa
   191281 gatatagata ttttaaataa taaaatttct aataacgatt ataatatatt aaaagatata
   191341 tgttatatta tttgtaaaat agataatata aaaaatataa aaaatacaaa aataaaaaat
   191401 gtattatata ttaagaattc actatatagt aatattgata aaaatataat aattgtaaat
   191461 aataaaatat aaaaattaaa ttctacaatt gatagggaag ataaattata taaacttatt
   191521 attacatttc catttaataa atatcctgaa atatataatg atgatatgat tattttatta
   191581 ttattacata attatattga tataaaatcc atttcagaat attataaaag atatccaaaa
   191641 aataattttt tgcatgaatt aaaaaaatat aaaaattcat atgaattaat aataaatgaa
   191701 tattttataa tgcattataa tatatatatt aattctaatt ataaagaatt atttaaaaaa
   191761 atatataaat atagaaacta cgaacattta attaatcatt attcagaaat aattaaaaat
   191821 tatatattac ataattatag tttatttgat aaagaaaaat gtgataaaat attaaataac
   191881 aataattcaa aagaagttat acagcaatgt tatgaatttt ttttatgaaa taatattatt
   191941 tattattagt ataataataa aaatgaattt aactaatgcg tgtaatgata taataaatta
   192001 tttaaataat atagatagca gattacttaa aatatttata aaaaataaaa cttttatttc
   192061 tggtagtttt gtatcatata tgattgccat taataagtta aaaaaaaatg atgacataga
   192121 tttatattgt tctgatccgg atcaattaat taaagatttt gatgatttaa atattcatag
   192181 tttagtaaat agattcaata atacaataaa ttattttata aaatataata ccgaattaat
   192241 taaatttcaa ataatatatg ctaaaattag ttcattaaaa tttatagata actatgatat
   192301 atctttaact aaagtagcat atgttactca tgaaaattat atttatttat cagaagaatt
   192361 taaaaatgat tataataaaa aagaatttca tgcatctgat ataatatcaa attatagata
   192421 taataaatat gaatcttttg caagattaaa ttataattca cagataaaaa aaataaaatt
   192481 tgattatgat tataaaattg attattataa ttatataaat aaatgtaata ctatagttgg
   192541 tattacagga attccattta cttattctat ggaattatta gatgatagta taaaatgcaa
   192601 tgcaatgaaa ggatgtattt tatctgattg taaaaataaa agtattaaat atatatgtaa
   192661 aaattgtata gaaaaattaa aatttaatat agttttagat aatgaatttt ataataaaca
   192721 ttttatagta tttggagcag ctactagatt tggtaactta atatttgaat atttatcaag
   192781 taatgttaat aattgtatag gtacatctta ttggtatgaa agtgaatcta aaaatataat
   192841 aaaatataat ttagaacatg agccatcata tgatatatta gaaaaaatat tagcttctga
   192901 tattgttata ttatctgcaa caaaattagg aaatacaaat gaaatatatt attataaaaa
   192961 tattgttgat catgggatag ataaaaattt attaatggat agatttaatt gtaatgtaat
   193021 tggatattta aatttattat atagttacat gaaatttaaa atagataaaa aaagtaataa
   193081 aaaacaaata tttgtatata ttgataatta tatgagtgaa tttaatgata acacatcaca
   193141 tcctgaattt aatatagtta aagttgctca aaaacgtgta atatatcaat ttgaaaaacc
   193201 gtttaataaa ttaaatataa atattttaat ttataatata ggtaacaaat atatgcctaa
   193261 aaaattaaat gtttatatat taatgaaaat attaaatgat attataaaaa aaaatgaaaa
   193321 aatagataat attttagata ctagtgcaat tcaatacata ataaaaaatg gaattaaaaa
   193381 ataaaaatat atctattgaa aattttcgca tattagatgg tatattgcat tcaactatat
   193441 tagatatagt tgtttcaata tttggaatta tatttatatc caattatcca aatattatta
   193501 attttagata tgattattcc atattatatg gaatgtgttt tttaaatgct tttatatcta
   193561 catattatat gtatgctcta tatagaaaaa atatttttgg aattattatg tatatatttt
   193621 ggcattttat agtaatattt atattattat gtattttgat tattaatgct agttttctta
   193681 taaataatcc tactatatta gatttgataa aaattatatt attttggttt ataacaaaac
   193741 aaaaacttga ttatacattt ttaataataa cacattataa taaaatgact gataatgact
   193801 tgccaccacc atatactgaa gtagaaaata ataaatattg atattttttt tgaaaaaata
   193861 cactagttat aaaagcttgt attttcacta taacaatgga aacactaaac attttcagaa
   193921 atggaatttc acgtttattc aaaaatatta ttccatctct tacatttgta caaacaattt
   193981 ttaattttat aacttataca tttgcttatt gtataagtta taaatttgat cctatcaaag
   194041 attatgaata tacaatatat tatatcatat tttatacaat tagtggattg tcattaatat
   194101 atttattttg tcttataaat ggaattgacc atggtagtat agtatatata atattagttt
   194161 actgttttat ttctatatta gcagtcaata taattgtata tttaacagaa aatgaaattg
   194221 ataatgatct attattgaga gttttaataa attgttttat attaaatcaa atgattaatt
   194281 actcatcatt actagtatca tgtcataaat atatgattga ttacagtaca ttgaaacatg
   194341 attcatatta tagtaatcca ccaacatatg atgaaatatt taatagtcaa caaaatgaaa
   194401 ggacaacata aaattaaatt ttataattaa ataaatggaa tgtgaattgt gcttagaaaa
   194461 aaataaaagt actattcagt gtgatgcatg taaatatatt acatgtatac cttgtattat
   194521 aaaatttaat aaaacaatat gcccaaaatg ttataaaatt tatagtgata tattaattat
   194581 gccatttatt gaaaataaaa ttttttttaa tatatataaa tctacttatg taaaatctaa
   194641 aataacaatt aaagatgcta gattatatga ttatatttta aaaaataaaa agttattaag
   194701 atttggaaaa agtttaaatt ataaatcatg tattgatata aattcatttt tatgtttatg
   194761 taatacacca tcttgtaaag gtataatatc taaaaataat cctatatgtt tattttgtga
   194821 tagtgtgttt tgtacaaaat gtaaagaaaa aatattagaa tataatcata catgtaacga
   194881 aaaaatatta gaaactatta aattattaaa agaatctact atgttatgtc caaattgttt
   194941 aacatatatt actaaatcat atggatgtaa tgatatgttt tgtactaatt gtggaactag
   195001 attttgttgg cgtacaggtc aaagacaaaa atataattct aacacacatt ataaagtaaa
   195061 taatactaat gtatatgaat atattaatga tttatcacaa acaggtaaat ttataaatca
   195121 tgctgttaaa tatttgcgta attttaataa taaaataatg atgatagaat gtaaacatta
   195181 taataatgat aaaatagtta gtaacgctta tatgaattat aaaaaatttg atttttttaa
   195241 atatatatat gataataaga aaaaatgtga caatatatat aatttaaaag aattaattta
   195301 tgattattat agtaaaaata tagtttcaaa taattgttta tatacaatta ataataacaa
   195361 tataataata tcaaaaacta aaaataaaaa tattaaaatt atgaatgata aagatgaaaa
   195421 caatgattca ggtattgaaa tgattgatta tatacaagaa attcatgcat ataatataaa
   195481 aaaaatttta ttaaaatata aaaaagctta tgatttatct attccaggta gtggaaaatc
   195541 gtatgttgct ttatatgttg ctaaacagat gaatcttaaa aatattttta taatatgtcc
   195601 agcatgtctt gttgataaat ggaattttat tattaaaaaa tataataaat ataataattt
   195661 taattatata atattatcta ataataatat atgtataaat agatttgaag atggtaatat
   195721 attgttgtct aaattattaa atgttaataa taaaataata tatgaaccaa cagaattttt
   195781 gaaaaacttt ttatcttcag aatctatgat tataatagat gaaagtcata caataagaaa
   195841 tactaatagt tatacattaa aggctatata taaaatagtt aatacatcta taggatatat
   195901 attaaatata tcagcaacac caattgaaaa caaaaatcaa ttacaacatg ttgttaaaaa
   195961 attaggtatt aatgataatt cagaagattc tgatataatg aaacttttta tagaatatat
   196021 tttaagaata tgtgaaatac aagatataat aaaagtttat aaaaatagat atatttatca
   196081 aaatgtaata ttatctaaaa atttcaatac atttatagga atgtgtaaat tagctgatta
   196141 tgaaaataca cgcaaattaa tatatttaga ttatattaat aaatcttata tttccttaaa
   196201 taaaatatta tttaataaga ttgcatatac tgcaccaata tataatgtaa tacaacctta
   196261 tttggctaaa tataaaatga ataatagaaa tgaagaaacg attgatttag catttacaaa
   196321 tataaatgtt gaagataaaa catctacatt agaatttggt aataaaattg taaaaggatt
   196381 aatgcaaata gaaactgcaa tacttgaatc tattgaaaat atggtatata cagtattaga
   196441 aaatacaaat aatgttaaag tagttgttgc attaaattat acagatagta ttaatgatat
   196501 atataaggaa ttgagtaaat tttatgataa tattcttgta attactggaa aaactaataa
   196561 taaaactaaa ataattgaaa aatttcaaga acctaataat aattatagat tacttatagt
   196621 aaatcccttg tgtgtaaata acggattaga ttttgatgat aaatatggaa attataaaag
   196681 atttgttata ttcaatccaa acttaatatc aataaatatg tatcaattta tatacagatt
   196741 tgaaagaaaa gattcaaaat ctaaacctat tattcacata cttgatacac attatgaagt
   196801 tgtagataat ttgataaaaa aggtaaaaat acaaaatgat atatttaagg caataaaaaa
   196861 aattagagaa tatccagaat ggattgaaac agaaacatca gtattacaat tacttaatga
   196921 attaaataaa cattaacatt tatattagaa ttacataatt tttctttaat aatatttgat
   196981 acatcatccc aatttaaacc atccaatcca ctaccaatag ctggcatatt aagtgtagtt
   197041 atattatttt ttatacaata ttctcgtaat aattctatag catcttcata ctgttttaat
   197101 gttggttttt tataagatga tggtttagtt acaaggttta ttataatttt attatcatta
   197161 tttatatatt catatacacc aggtatttct aatggcgttt tagattgtaa atatttaacc
   197221 attttaaaat attttttttt aattgtatat gcaatacctt taccaaatgc agcatctgca
   197281 cctattgtat gaacaataat atttgtttta agtacatcac caaaaatttc tttataattc
   197341 attttattaa tgtattatat tttcaatttt atgattttat atataataaa tgagtaatca
   197401 gacgactatg atggtaaata tggatacaga tgaactatta aaacttcaag gattaataaa
   197461 aaaggatgaa aaaaataaaa ctaatatttt tactattaat acaacacata ataataatga
   197521 taataatgat tataataata ataatgatga tgatgatgat agtgaatgaa ataatattac
   197581 attaaacaat aaataatctt aaaatggaaa aagtaccatt tgtaattaaa aaagataatg
   197641 aaacttggta taatatgtta gacataataa aaatattagg atataaaaaa aaattacatt
   197701 tacatgcatc attattaaat aaaaataata aaaaaaaatt ttatcaatta cttactaaaa
   197761 atactttaaa aaataaatac tttaaatata caaatgtaca aaaaaataga atatttatta
   197821 atgaagtagc tttgttttat attttattat catcaaaaaa agaaaatgca ataatatgta
   197881 aaaattatgt atttggtaat ttatttaaac ttgagaattt aaatttatgt tgatttacaa
   197941 tttttgtatt acaatttttt attattatat atttatcaga ttgcttatca atatataaat
   198001 attttacatt tttaattttt gaaattaatt tttgatctga gtaatattta cggtttaaat
   198061 cagcatatac attaactaat ccaattagat ataatgtatt tggtatttta actactacta
   198121 aatttgtaat agttgatcta tttaatatta atatttctaa atttgataat ttatttaaaa
   198181 aattataatt ataaactatt gcattaatta taaataattt ctttatacat gatggtaata
   198241 ttaattcatg tatattgttt tttgatctat tcaatttatc ataaattata gacaatattt
   198301 taaggttttc taaattttta aatatatctt ttttaatata aacagcgtct gtattaaata
   198361 tttctaaatt tttaggtaat aatatatttt ttaattgtaa cttatctata atactattta
   198421 tatgtaattc ttttaaattt actaatatct ttaaagatgt aaaatcgttt agttcattat
   198481 taactataac attaaattct aatttattta aagataatgg taaagataca tcttttaaaa
   198541 aattcttttg tatatttaca aaattaattt cttcaatacc atatatacta tcaatttttt
   198601 catttgtcat ttcatttcta ataattaatc tttttatata tacatttttt tgattattcc
   198661 atttaatata tcctttgtac ttacttaaat atcctaaata taaagttttt gaacatgtag
   198721 aaacaaaggc catttgatct ttttcattta aatatttcat aatacattca aatgaattaa
   198781 tttctaattt atccatatta tgcataaaat attatatata atatttcata tatttaataa
   198841 atgagtgtaa tgttagaagg tattaatatt gattataagt cgttgatgaa tattgaatca
   198901 ttatttataa aagatctaaa tataagtact aatatttcga aatatacaaa tttatataaa
   198961 ttaacaaatt taaaattttt aatatttgaa actaatgaat atattctaga taaaattaaa
   199021 ttaccaaaat cattaatttc attagatatt atatttaata tttgtgatga atatgtaaac
   199081 ctatctttta ttaatcattt tgataaattg gaatacttaa gtattaatag tggatgcata
   199141 tacgaaatat atataaatga aatacctaaa tcattaaaag tattaaaaac taatattaca
   199201 tttattaata aatctatttt atataattct aatttattat caataaaatt tataaattgt
   199261 gatacaacat cattaatatt accccaatcc actatatcat tagaatttaa taatacattt
   199321 acgtatgatt atacttgttt agaatcatta ataaatttaa aagaattaat tttaaaaaaa
   199381 tgttatattg gtaatttaaa tactgttaaa atatcaaata atatagaaaa attaaatata
   199441 ataaatatta gtaataaacc ttataataat gatattatag atatagtgga atttatagtt
   199501 aaattagata atataaaaat atttgagtgt gttatggatg ataatgaatg cattaattgt
   199561 attattaaaa ataatcatga tagatgtaat cataatattt tattatacat tttagcatta
   199621 ttaaatggaa ataatatttt atctaccaat gaaaaaaata aaaaaatata tttgatataa
   199681 atgaacattt ataaattttt attaaattta tttaattgtt atgatgatga agaatactgt
   199741 gatgaagaag atgaaattat tatatatagt gaaaacgaag aatgaatttt tatattgaat
   199801 ttcaaatatg tcagttatat caatagataa tgaaatttgg tttaaggata gatatatttt
   199861 atcaatactt gatacatatg atttaaaatc aatattatct aaagtacata aagataatag
   199921 aataaaatta aaaattataa aaagaagtaa cagtgttgat gatataaata tttatattaa
   199981 taaaacagga ttaatatcat tatctgaaaa attaaatact aatgaattaa actatattat
   200041 aaataaatat aaatcaaata aaatatgttc ttataatgaa tatataggaa ctataattca
   200101 ttgttttaat cattgtagat atcaagttaa ttataaaata tataaatata aaattgattt
   200161 attctttatt gattataaat tagctataga atgtgatatt ggtgatatag atataaatta
   200221 tgaaattgat aaacaacaat acattgaaca acaaattaaa ggatgtaaat ttattagatt
   200281 taatccattc gttccagatt ttaatttatg taaagtagtt aatactatta tgatttttat
   200341 gtatgataat aaataatgtt tttattttga aaaaataagt atactaataa gattgctgtt
   200401 tgctattacc acaatggcta ttaataacaa tttccatatt ttgttagata aggtaattaa
   200461 tatgaaaatt gaaaaattta taaaattatt aaaatataaa tatgataatg ttaattttga
   200521 agaaaaaaaa caaattatat caacattatt aaaatttaat aattttgata aaactgaaat
   200581 gtgtggtgtt agcgttgaga aatttgttca attgattaat aataaatcag catcagaaaa
   200641 atattctgat gttgattcta gtattgatga atcacaaaat tctgattctg attctgattc
   200701 tgattctgga gttaatattg atgaatcaca aaattctgat tctaaagtta atattaataa
   200761 actagaaaat gaatcacaaa attctgattc taaagttaat attgatgaat cacaaaattc
   200821 tgattctaaa gttaatatta ataaactaga aaatgaatca caaaattctg attctaaagt
   200881 taatattgat gaatcacaaa attctgattc taaagttaat attgatgaat cacaaaattc
   200941 tgattctaaa gttaatattg atgaatcaca aaattctgat tctaaagtta atattgatga
   201001 atcacaaaat tctgattcta aagttaatat taataaacca gaaaattctg aactagaaaa
   201061 tgaatcacaa aattctgatt ctaaagttaa tattgatgaa tcacaaaatt ctgattctaa
   201121 agttaatatt gatgaatcac aaaattctga ttctaaagtt aatattgatg aatcacaaaa
   201181 ttctgattct aaagttaata ttgatgaatc acaaaattct gaaccggaaa aagaatcaca
   201241 aaattctgat tctggggtta atagagaatc acaaaaaaat tcaaatacat tttattgttc
   201301 ctcatgtaac aatggaatat gcaagatatt tacaaaaaat ttagatgaaa ttaaacctaa
   201361 gttttcattt tatcttcaaa tatattattt aagacagctc attgaaaaca aacaaataaa
   201421 aaattttaat attatggaat ttattaaata ttatgaatct ttaaatgaag ataaaattaa
   201481 acaacaaaat ttatgtgaag aaattgaaca atatatttta tttttgaaag aagataaaga
   201541 tcaaagtaaa catgaaaatg atgatgatga aaatgaaagt atgaatgaaa atgaaagtaa
   201601 acatgaaaat gatggtgatg aaaatgaaag tatgaatgaa gatgaaagta aacatgaaaa
   201661 tgatgatgat gatgaagatg aaagtaaaca tgaaaatgat gatgatgatg aaaatgaaag
   201721 taaacatgaa aatgatgatg aaaatgaaag tatgaatgaa gatgaaagtg aaaataaaaa
   201781 tgaaatgaaa aaacatcaaa gtgtggataa agataaaatt gatatttcat tattgaataa
   201841 tttaattgtt gatataagta gtaaagataa taatgatgaa gaaatggaaa aaatacttgg
   201901 tgaattatta ttatttaggg aatcaattga aaatgaaagt gtaaataaaa atgatgaaga
   201961 aattgaaagt atgaatgaaa atgaaaattt atctgtgatt gctgaaaata aaagtgtgtg
   202021 taaagatgaa agtttatctg tgattgttga aaatgaaagt ttaaataaaa atgatgaaga
   202081 aaatgaaagt aaacatgaaa gtgtgaatga acttcaaagt ttatgtgtga ttgaaaataa
   202141 acaaaaaaat gatattatat atgatactga atattttaaa aaatatggta agctttcaaa
   202201 taaatatcat aatgtatgca ttgtaaataa agatatatat tgtcttacat gtaatcaatc
   202261 aattggtaga acatatataa aaaaaaatag tcataatttt gataagccta tcaagttgta
   202321 tgttaatgaa aacatttata ctttattatt taatcaacct gaaaaaattg ttcatattaa
   202381 aaaatacatt aaatacaatg aagaagaaat atatgtatat gattaaaaca ttctatctga
   202441 aattattatt caatatgtta gtgtaaaata aatgtatatg tatataatat ataaatatga
   202501 ctgaaattat tattcaatat gttagtgtaa aataaatgta tatgtatata atatataaat
   202561 atgactgaaa ttattattca atatgttagt gtaaaataaa tgtatatgta tataatatat
   202621 aaatatgact gatatgtaaa taaattttgt tatatgtaaa tatgactgat ttattatttt
   202681 tttaatgtaa aataactgta tgttataata aatataagtc taattgttat ttttataata
   202741 ttttttaata aataaatcaa catcaaattt acgtctacat ccttcataac tcatatatct
   202801 aattttacca aatattggtc tttctttcca tgctctatca tgaataccac aaattgacca
   202861 catacatcca acatatccat ttggatcacg tccatctata aaatatttat catttaaata
   202921 tatagatata tataatgctt cttctggtga ttttgtccat tctaatattt ttttagccca
   202981 atacattctt aaatatccat gcattttacc atagataatc atttgttttt gtgatgcatt
   203041 ccataaattg tcatgagtta atgcattttc aagttgatat aaactatata tatgttttct
   203101 agtatcattt ttatgttcat ttagtgtttt tattgcccaa ttattagcac catttatatt
   203161 atcgtaattt tcattataat aacaaaaatt atcacatagt tctttacgaa taatagcttc
   203221 ttcacaaaaa acttctaccg atttaggata taatttttta tatttgttaa tttctaatat
   203281 tattctttga gttgaaattt gaccaaaatg tatccatggt gataaattac ttattgcatt
   203341 agcatttgga tcatttcttt ttttagcata atcttttaat ctattttgta taaatatatc
   203401 taatatttta aatgcatatt ttgtaccaga ttttgcccaa gaaacaggtt taacatttct
   203461 atcaatattt aatgattgtt ctgctttttt ccaattatta tttattttaa tatatgtatt
   203521 ataagtatgt ttaataatag gtataaattc agttaaatat tctgataatt tataatttat
   203581 tttatttcta atggtttttg cagaatattc taatttatta ctagcaatcc aacatggtac
   203641 aatattatgt gaatcaactt gataaacatc aatatttatt ttactaataa gttgatttac
   203701 ccaattatta aatattttaa taggataaaa atcaacaatc aatacaccaa tattatattt
   203761 ttttataaat tttggtaata catctactga tattcctatc aatagatgaa aatgtatatt
   203821 taaattttta cattcttctt ccatttgttt aacaccattc aacataaaat caaattgtct
   203881 aattgtagca ttaagaaatt ctggtactaa acatatacac atatgtaatg acgattttga
   203941 ttttaatgct aattcttgtg cataaattaa accccaatta tcttgaattc tttgatctct
   204001 aacacaccaa tataatacat tattataaat tttattttcc aacttcaata atattttaca
   204061 tctattaaca ttcattttat aaaataatga aattttaata tataatatta ataatctcat
   204121 taatttataa aatggataaa attaatcctt caatgtcaaa gaatgaagtg tttaatataa
   204181 tgaaagaaag agtaaaaaat gacaatttta aacaaaaatt aacttctaat aaagaaataa
   204241 ttaaaaatat agaaaatgga tcatatgtac caaaaaatgc taattatgta gaaaaaaatt
   204301 atgatgtaat tacacaagat gaatatgtta aatcatatca atttgtaaat ggtgattata
   204361 taccaaatat aataactgaa aaattaggaa taacaaaaaa taatataaaa gaatttacat
   204421 ttaaacttaa tgatccagat gttagacata taactgtatt taaagaaaat aataaaattg
   204481 gacagatatt tatgaaatca tcagatatga ttaatgtttt atcttttaaa tgaaaaatta
   204541 taaaataaat ttaaataatg tttatatcac atcatttagg aggttataat gaatcattac
   204601 atgcatttcc tgatttatct acagataaag ttatagatgt aactaaatat tctaaaatat
   204661 atgtcgatga taatatgtat attatttctg gattaatgtg gatatttagt aaaatagaaa
   204721 atagatatat tggtggatta gtaccatatt ttgtatgtaa tgatatactt gaaggtgggt
   204781 ctttaattac tgatgaaaat aatactgcta tatcttgtgt aacaatgaaa aaagataata
   204841 tgtatgcatt aagtggttta gcatatgaaa catttgatca aaatattaat gtacctatat
   204901 atcatcatga attagaaaat ggacattcag tttatggttc aatacaaggt aaatatgaaa
   204961 ttattaaaga atatgctaaa tcatttaaac aatcatcaca taattctatt tctgaatatc
   205021 atatttgggt tggtgaaaaa ctaatacaaa taacatcaat taataatgat aaaaaagaaa
   205081 tttttagatt tagaattaaa aaaggtggaa tattagcaga tgaatatgtt atataataaa
   205141 tttatattct ataaaaaatt atataagctg aaataatata tagttttttt ttttaataat
   205201 tagaaaaaaa aatatattat ttattaaaca accatatcta attttatttt tcccaaatgg
   205261 ttataatcaa ttaattcaaa atcatcaaat ttaaaatcat ctatattatc tacttgtctt
   205321 tttattttta attttggaaa tgggtttggt gtacgttcta attgtttttt taatccatta
   205381 atatgattaa catatatatg tgcattacca atattatgaa taaattcata tggttttaaa
   205441 ttagttaaat gtgcaatcat ataagtcaat aaactataac tagcaacatt aaatggtaca
   205501 cctaaaccca tatcagctga tctttgatac atttgacatg taagatattt attattaatt
   205561 acatgaaatt gtacaaaaca atgacaaggt ggtataacca tattttcaac atctatagga
   205621 ttccaggctg ttaatattat atttctagat tcaggtttat tttttatttt atttataata
   205681 tgtgttaatt gatcaaatcc ttgatttgta taatttgtat ccatatcaat atatttagca
   205741 ccaaaatgac gccattgaaa accataaact ggacctaaat caccttcttt tctatcatta
   205801 aaaccacgtt tttttatata ttttaatgat ccattttcat cccaaatatg gattccttta
   205861 ttttttagaa tatttgtatt agttgatcca gatataaacc ataataattc ttcaacaatt
   205921 cctctccaaa acattgattt tgttgtaaat aatggaaatg aatcatctaa tttatatttc
   205981 atagttaaac catatacagt ttttgtatct acacctgttc tatttttggt tattcttcca
   206041 ttagataata tttctgatat accttttaaa tattgatatt catctgatga tgtgatttcc
   206101 attataatat aattttaatt ttatatattt aataattttt caatattata taaatataca
   206161 ttaaaaatat tatatataac aaaaatgtga aattatatat attttttaaa tggatattca
   206221 attattagat ttttattcat acaaaaatat aataaaatat ttagataatg aggatattaa
   206281 taaattaagt ataataaaaa aatgtagaaa ctttaattta gaattaaata ttacaatatt
   206341 gcataaatat ataagatttt atgatccttt agaaattaaa aaattagatt gccataaatg
   206401 taatataaaa gattgtaaat ttttaaaatc attaaaaaat ttagaagaat tagatatatc
   206461 ttataataat aatttaaata atttactatt acctaaatct attaaaaaat taaattgtaa
   206521 taattgtaat ataaaagatt ttaaattttt aaaacaatta gataatttaa aagaactaga
   206581 tatatcctat aataataatt tagataattc atcattatgt tatataccta aatctattaa
   206641 aagattaaat tgtggttatt gtaaaataaa tgattttaat tttttagcac cattagataa
   206701 tttaatatac ttaaacatat gtggaaatag aaatttaaat aattcatcat tatattatat
   206761 ttctaaatct attaaaaaat taaattgtaa taattgtaac ataatagatt ttaaattttt
   206821 agagccatta gataatttaa tatacttaaa tatatcaaat aatactaatt taaataattt
   206881 tacattattt tatataccta aatctattaa aatattaaat tgtaataatt gtaacataat
   206941 aaattttaaa tttttagagc cattagaaaa tttaatagaa ttagatatat ctgaaaataa
   207001 taatttaaat aatttatcat tatattatat tcctaaatct gttaaaatat taagatgttg
   207061 tagatgtaat ttaaaaaatt gtaaattttt agaatcatta attaatttag aagaattaaa
   207121 tttgtctttt aataaatatt caaatatttc atcattatat tatataccta aatctgttaa
   207181 aatattattt tgtagaggat gtaatattac ggattttaaa tttttagaat cattagaaaa
   207241 tttaatagaa ttggatatat caagaaatac taatttaaat aatttgacat tatataatat
   207301 atctaaatct attaaaatat tagaatgtga aggatgtaat ataaaagatt ttaaattttt
   207361 aaaacaatta gataatttaa aagtattaaa tatatcatat aatagaaata taaataaaaa
   207421 atcattatat tatataccta aaaatattaa aacattatat tgcaataatt gtaatataaa
   207481 gtattttaaa aatttataaa accattatta aaattagaaa aattaattat atcaggttat
   207541 gaaaatttta atatttcttc attacagtat atacctaaat ctattaaaat attagattgt
   207601 agtgatacta atatagaaga ttttaaattt ttagaacaat atgataattt aaaagaatta
   207661 aatatatcac ataattttaa tttaaataat acatcattat attatatacc taaatctatt
   207721 aaaatattaa tctgttgtaa atgtaattta acagattgta aatttttaga atcattaatt
   207781 aatttagaag aattgaatat atcatggaat gaaaatttaa ataatacatc attatattat
   207841 atacctaaat ctgttaaaat attaaatttt gcttattgta atttaacaga ttctaaattt
   207901 ttagaaagat tggaaaattt aaaaatatta tttatgattt ataatgataa gttaaacata
   207961 aatgaaatta acttaaaaaa tatatttgtt ataagataaa tgttttatga aaatttaatt
   208021 aaaaaaataa aatataaaga tattttaaat ttaataattt ttatctaata tggctattca
   208081 attattagac ttctattcat acaaaactct tatagaatat ttagatatta acaatattaa
   208141 taaattaagt ataatagaag aatgtagaaa ttataattta gaattaaata ttataacaat
   208201 atataaatat atagactttt ataatccatt agaaattaca aatttagatt gccataaatg
   208261 taatataata gattgtaatt ttttaaaacc attagaaaat ttagaagaat taaatatatc
   208321 tgaaaataat aatttaaata aattactatt acctaaatct attaaaaaat taaattgtaa
   208381 taattgtaat ataaaagatt ttaaattttt agaaccatta gataatttag aagaattaaa
   208441 tatatcatgt aattatgatt caaataattc atcattatat tgtattccta aatctattaa
   208501 aaaattaaat tgtaataatt gtaatataaa agattttaaa tttttagagt tattagataa
   208561 tttagaagaa ttaaatatat catgtaatta tgattcaaat atatcattat gtaatttacc
   208621 taaatctatt aaaaaattag agtgttataa ctgtaatata ataaattgta attttttaaa
   208681 accattagaa aatttaatag aattatatat atctgataca tgtgattcaa atacatatta
   208741 tttacaatta tattattata ttcctaaatc ggttaaaata ttaaaatact ataatattaa
   208801 tataacaaat tttaaatttt tagaaagctt agaaaattta atagaattag atatatctga
   208861 aaataataat ttaaataatt tatcattata ttatattcct aaatctgtta aaatattaaa
   208921 atgccatata tgtaatataa cagattttaa atttttagaa agattagaaa atttaataga
   208981 attaaatata acagctaata aaaatttaaa tatttcatca ctatattata tacctaaatc
   209041 tgttaaaata ttattttgtc gaggatgtaa tattacggat tttaaatttt tagaaagatt
   209101 gaaaaattta gaaatattag atatatcatg taatagaaat ataaatattt catcactata
   209161 ttatatacct aaatctgtta aaaaattaca atatgaatgt tgccatacag attttaaatt
   209221 tttagagaca ttagataatt taattgaatt aagcatactt ggaaatagaa atgtaaatat
   209281 ttcatcacta tattatatac ctaaatctgt taaaaaatta aattgtctaa actgtgatat
   209341 tacagatttt aaatttttag agctattaat aaatttaata gaattaaata tatcaagtaa
   209401 tacagattct aatatatcat tatgtaattt acctaaatct attaaaaaat tagattgtgg
   209461 acattgtaat ttaacagatt gtaaattctt agaggcattg aataatttag aagaattgaa
   209521 tataagtgga aataaaaatt taaataattt atcattatat tatctaccaa aatgcattaa
   209581 aacaataaat tatactcatt gtaatttaac agattttaaa tttttggata atttaataga
   209641 attaaatgta taaggtgata atattcaaat ataaataaaa ttaaatatta atgaatgtga
   209701 aaaaataaaa ttataatttt aattttaaac gatgaataaa attaatcagt attgttataa
   209761 tgaaattatt aaatacttag atattaaaga tataaataat ttggcattaa taaattttaa
   209821 ttttaaaaaa tttaatatat ataataaagc acaaatactt tattctcatc atgaaatata
   209881 taattttaat gatattgtta atttaaattg ttcgggatgt aatattacaa attttgattt
   209941 tttaaaaaaa ttaataaatt taaaaatatt agacatatct aaaaatgaaa attcaaatat
   210001 ttcagaagaa aatattccat catcattaat agaattatat tgcagtaatt gtaatattac
   210061 aaattttgat tttttaaaaa aattaataaa tttaaaaata ttagatgtat cttataatct
   210121 actatcaaat attaataaat gtgagatacc ttcttcatta attaaattat ttattaaatt
   210181 taataatcaa gacaattaca agtttttaga aaaattacat aatttacaaa tattagatat
   210241 atctgataat tgggatatag atgttgatat ttataaatta ccatcgtcaa taattaaatt
   210301 atattgtaga gattctaata taaatgattt tagttttata gaaaatttgt ataatttaaa
   210361 agaattatat ttaactcaaa atccacaatc ttttatatct gattataaat tatctatcac
   210421 aatattaaaa cttatatgta atgaatgtaa gataaaagat tttaaatttt tagaaaattt
   210481 atacaattta aaagaattag atataagtga aaatataaat tctaatatta gtgaatgtaa
   210541 attatctaat tcgatattaa aatttacatg ttataaatgc aatataaaag attttaagtt
   210601 tttagaaaat ttatacaatt taaaagaatt aaatataagt gaaaatataa attctaatat
   210661 tagtgaatgt aaattaccta attcgatatt aaaatttaca tgttataaat gtaatattaa
   210721 aaattttaag tttttagaaa gattatgtaa cttaaaatat ttaaatatat cccataatac
   210781 taattcaaat attttaaaat gtaaattatc aaattcaata ataaaagtat tttgtgaacc
   210841 ttatgatgtt ttaacagaag ttaaaattaa tggaatttgt tattcatttg tataattaat
   210901 aaaattaact taaaacaaat tatttataaa atttgaaaag aatgtagaaa ctataactta
   210961 gaattaaata ttacaatatt atataaatat atagattttt atgatccttt atagtataat
   211021 tttgtaaata atttattatt atattatatg cctttaaaaa aaagatatta attttttcat
   211081 tgaataattt agaagtatta gatgtaccat aatagttcat cattgtatta tatacctaaa
   211141 tctattaaaa tattatatat aattgatagt aataagttaa ataaaaatat aaatgttata
   211201 tgttaaaatg tgaaattata tatcatttgt ttaataatta caaaaaaatg agttataata
   211261 ttaatgaata tgcatttaaa gaaattataa aatatttaga tgatgaaagt ataaataatt
   211321 taagtcaaga aatattgcat agaattaaaa ataactatat tatatagatt tattgatgaa
   211381 tataaatatc atcaaataat taaattaaat tgttcagaag aataaatgat tttaagtttt
   211441 taaaaaattt agagacatta aatatatctt taaatttata ctcaaatata tctaaatgta
   211501 aattaccaat atcattaata gaattaaaat gtatttcttg taatattata aattttaaat
   211561 tcttagaaac attacataat ttaaaaatat tatatgtatc ctcaaatgaa tattcaaata
   211621 tatcagattg taaattacca gtatcaataa ttgaattatg gtgtagagat tgcaatatcg
   211681 taaattttaa atttttagaa ccattaatta atttacaaat attagatatt tctaaaaata
   211741 tttatttttc agaatgtaaa ttaccaatat cattaattga attatggtgt gataactgta
   211801 atatcgtgaa ttttgatttt ttaaaaccat taactaattt aaaaagttta attattccaa
   211861 ataatgaaaa cttagaaatt aattttttaa ataattttaa aaatcagatt atctaaatat
   211921 atcatatatt aatttattgc ctgatacaat tacatatctt gaatgtgatc cattatatat
   211981 tgagtcatta gagccattaa aaaatttaaa atatttaatt ttaaataata ttgtaaataa
   212041 tgacattaaa ttgccaaaat cgattatata tattaaatgt aataattgta aaataaaaga
   212101 tttttcattt ttagaacaat tagaaaattt aaatgaaata gaatttttaa atctatctat
   212161 aagaaaatgt attttatcat cttctgttac aattataaac tttctcgaat gtaatatttt
   212221 aaattctagt tttttaaaac cattaaataa attaaaaaaa ttggaaatat tggaatgtaa
   212281 tcattttaat atagaaaaac atacattacc aaattcaatt actagtttat cattggatat
   212341 atatcaaaat attgatttaa cttttctaga tgaattaacc aatttacaaa cattaagtgt
   212401 atcttgtaat tttaaatcaa atatacaaaa atgtaaatta tcaaaaacta ttactgcatt
   212461 aacatgttat aattgtaaga taacagattt tacatttata gaacatttag ataatttaaa
   212521 agaattaaag atatttaatt attattatag aagtgttaaa tcaaatatac ataaaataaa
   212581 tttaccaagt tctattacaa tattagaatg tagcaattgt tttataaaaa aatttaattt
   212641 cttacaaaaa ttaaaaaatc ttagaatatt agatatatca aagaataaaa actcaaatat
   212701 atcaaaatgt catttaccaa agtctattgg tgaattaaat tgtagtaaat gttttataaa
   212761 aaattataca tttatagaac aattaaaata cttacgcata ttaaaaatag aaataaacat
   212821 taaattacca aaaagatgta ttgtttaaaa atgaataaat agtcattata aataatacgt
   212881 gcatcatcat ggatggtttc aatcaacaaa tgccaattga tgaaatggta gagaaaactt
   212941 atgataaatg ggataattca attgagattt atagaatgat gaatgctgga tttacatgca
   213001 aaggtccatc aatagtagaa tgtatggaat gtcgcaaggt gttaactgat tggaaaaaag
   213061 gtgataatcc tttttttgaa catatatatt actcaaaaga ttgtcctttg attaacttaa
   213121 tattattgag gttattaagt atacaaatat taggcattga aacaaaattg aaagaccttg
   213181 gattaataat tccaatttgg aaaacatgta acgatgaatt acgtgtaatg gatgttgttg
   213241 atgatggatc aacatttaaa aatgttaaaa atgatgattt tgatttgtat aaaaatcata
   213301 atcttaaaaa gaaatctaaa ataagttatt attgtcctac atgcaaagtt gatattcaat
   213361 tattggaaga tgaaattaat tcagatcatt atatatttaa aaaacatatt cgtttttcag
   213421 aaaattcatg tgattttatg aaattaaagt taggatctga catatgtgat aaaatataca
   213481 atgtggatct taaattaaag tctagtgctg aagaattgaa aaaactattt actcaatatg
   213541 agaatgaaaa taaaaatgaa aataaaaatt taaagtgtaa aatctgtaat aataataatc
   213601 gcaatatcat agcatttcct tgtttgcata tttatgcatg catttcatgt tacaaaaaaa
   213661 acaaaaaatg taattcctgc aatgaagaca ttttgcagta tgctagagtt attattaacg
   213721 aaaatgaact ttgcagtaca tgcaattcag aaaaatgtga tatgttattt ttaccatgtg
   213781 gacacatttc atcttgcaaa aattgctttt ataaaggaaa aatgaaatgc aataaatgtg
   213841 ataaagatgt tatgggtaca tctgatataa ctctttaata aatgtacatc tttcaaaaat
   213901 atttggtgat ggaaatttca tggttctaag gtttaaatat ttgttatttt taaattatgt
   213961 ttttatatat tattggtttg cttgtatcat ttgattatat attatttgca ataaaaagaa
   214021 taattgataa taaaagattc attgaagcaa aaaggacaaa tattaattaa tttatattta
   214081 ttagtatata tatcgttaca taacatttta gtttttttcc aaaaagttgc tgttttttta
   214141 tttattttat gaccacattt atagaacata tattcatatt ttgtacttgt acacatagaa
   214201 tagttacata ttttattatt aagtttaaca tcaatagatc tccaaatata tatattacca
   214261 cttatatcaa taagagtagt atcaattaat tcgtttatta aatttaattt tatatttgag
   214321 cgtaaaatat atatatttcc atttattgat aaatccatcc attctaagtt tggaaatttt
   214381 ataaatattc cattttgaag caagccatca ttattgtcaa aatataaata tttttttgaa
   214441 tttgaacatc caccatatat aaaacatttt tttttttcat aatcacattt aataatacat
   214501 gcaatattac taattttttt atcattaata aatatatcac atttagaatt tcgtccaatt
   214561 gtaaatgtat aatttttatt atatattaaa ttataaatat ttccagaatt gagattagtt
   214621 aatgaaccaa atttatatac cttatccatt tttattaata tatgttttcc tcctcaatta
   214681 taatgccttc tgctataatt ttattcactc cagtagaatc tcttaaattt tcaattttaa
   214741 caatgcattc atcgtaatta gaatatgact tattatttat agtaatattt ttatcggaaa
   214801 tattgacttg catatttggt gttttattta tattgcatct tatataattg ttataaacaa
   214861 taatttcagg aatttcaccg tgctcaattg atatattgcc tttgatttcc tgatttatat
   214921 tgaaatatat gcattcacat tctaatgtaa ttttgtaagg ataaattgga tttgttggac
   214981 ttatattttc caatggtaat aatggtaatt catttttaaa tattggatca taatttattt
   215041 gtaatatata ttttagtccc aatcctttat tcaaataaac tctgtcaatg tattttttta
   215101 tattcattct aacgtcattg gttatgtctc gtgcttctag aattatatcg aattcaattg
   215161 ctgtatttat tttattaggt ccaacaattt ttggtatttt agatatactt gacattttat
   215221 agtattattt atttttcatt attatgataa ttattccatc ttataacaaa tatagctaat
   215281 tccattgaac atattgatgc acataataat aaatatataa tagcacatat tgtatcaaaa
   215341 tttatacaca ttaaaataaa tatacataca aatattgtta tgtatattaa aattgatata
   215401 aattgtaaca aaataattga atatatcgca atcatatttg tgtataatat atgtataaaa
   215461 ttatgcacta ttgtaaatac tgttgctatt aaaaataata ttaatgtgtt atcaggtaac
   215521 tcatatatgt attcatattc tttttcttta tatattatta acataataaa atatataaaa
   215581 ttataaaagt gtattaataa ggatattgat gaaataattc tattttctgt tgtatatgtg
   215641 aaattataac aaaatagcat aatgatatat atgtatataa aatactatta tttcatctag
   215701 agttaaaagt taataataat tgtaaataat ttttttttaa tgtataaatt aagattttaa
   215761 aaataattca atgaaataat atataaaata tttatattta aaatggttga taatttttgt
   215821 acaccattat atccttatta tattacacta caatctagaa ttaattctta tgaaaattgg
   215881 cctatatcat tattttttaa aattaataga ttatgtgaag ctggtttctt ttatacaaac
   215941 attggtgata taacagtatg ttttaattgt ggcctaaaga taaaaaattg gttatattat
   216001 aatgatccat ggatagaaca ttcaaaatgg tcaccaaatt gtaattatat aatttttaat
   216061 aaaggcaaaa aatttataaa ttttgctaaa aattttaaac atcaattatt atataattgt
   216121 attatatgta atgaaaataa tatatcatat attttaaaac catgtggtca tgcaagtact
   216181 tgttatgaat gctcatataa aatatataaa tgtcctgtat gttacaatac tatatcaact
   216241 attataagat attaattttt tttattttat atttaatata tgtatacata ttatatgtta
   216301 aaaattcatt tttttttgaa aaaataatat atcttataat actaacatca tgcatgctgt
   216361 actgtgtact aaatgtaata ttatatgtaa tgataaaata aaaatacaaa aacataaaga
   216421 aattgaaaat attatttcat ttaacgttga aactaacatt tgtgaatgca aaattccaaa
   216481 tttacaattt tgttttttca atgtaaataa aataattgta aacgaaatac cgtattacac
   216541 atcactcatt aaattagtta tatttaatat agctatatta tcaactgcaa gttttgaaat
   216601 ttggattaac aatgatatag atgaaaaaat caattatgaa ataaatgatc aaatagttcc
   216661 tataaatgaa aatatattat cttacattcc aaaagaggat tatgataaaa taaaaataat
   216721 caatcattat gaattttgtc atgaagactt ttattttgat gattatgcat tttgtgagga
   216781 acataaattt tgtcaaaatc atatgaatta tgaaaatggt atatggaaag aaaattatga
   216841 atattgttat aatatatgta atgaatgtga agaatctaaa atttttaaat ttgaaaacaa
   216901 attggaaaat tataccttac tttcaaaact tctttcatca gaaattacaa caacagaaac
   216961 tgtagaaaat gcaaatacta taattttacc aacaaaaact gataacattg atgatgatag
   217021 tgaatacttt tatgatagag aaatttatta ttacggttac tttacaatgc atgaaaataa
   217081 agattatgat tttataaata aagttgttga tgattatgtt gataattatg taaataaatt
   217141 tgttgatgat tttgtaaata aagttgtaaa taaaaatgtt gataatgttg ttgatgaagt
   217201 tgtaaataaa aatgttgata aagttgttaa tgaagttgta aataaaaatg ttgataaagt
   217261 tgttgatgaa gttgtaaata aaaatgttga tgattttgta aataaaattg atgatgattt
   217321 tgtaaataaa attgatgatg attttgtaaa taaaattgat gatgattttg taaataaaaa
   217381 tgttgatgaa gttgtaaata aaattgatga tgaatttgta aataaaaatg ttgatgaagt
   217441 tgtaaataaa attgatgatg ttttaaataa aaatgttaat gaagttgtaa ataaagatgt
   217501 taatgatttt gtaaataaaa ttgatgatga agttgtaaat aaaaatgtta atgactttgt
   217561 aaataaaaat gttaatgact ttgtaaataa aaatgttaat gattttataa ctattataat
   217621 aatgaatttt aaatctgtaa gaaaaaaaga aatatatgta tatacattta tatagtattt
   217681 atatgtcagt catatttaca tataacaaaa tttatttaca tatcagtcat atttatatat
   217741 tatatacaca taacaattat atatacatat aacaaaattt atttacatat cagtcatatt
   217801 tatatattat atacacataa caattatata cacatatcag tcatatttat atattatata
   217861 ttgtttttaa taaaaacaaa tttgttgatc aatttaaatc acatttatat tttttatgaa
   217921 actttattaa acgttctgtt gaaaataatc ttttacattt ttcacatata tacacaggat
   217981 ttgttgaaac atattttcta aaatcaggtt ttaatgaaaa atatgtcctc ataatttatt
   218041 ttttttatgt tttttcatac aatgaaaata ttttttataa atatgataaa gtatagatta
   218101 attaacgaaa ataattatag atattataat attgataaaa atataactaa aatagatatt
   218161 tgttgtgata aatatattaa ttatttagat atatcaaaat gttataatat acaatcatta
   218221 atatgtaaaa ataataaaat agaaaaatta attattcatg atcaattatt atatttatac
   218281 tgtgaaaata ataatattga ttatataaat attaataaac attcaagatt attaatatta
   218341 gattgttcta ataatgatat aacttcttta ttaataaatg atagattata ttatttaaat
   218401 tgttctaaca ataatataaa ttatattaga tgtaataata atttaaaaat attaaaatgt
   218461 tataattgta atttatcaaa tatttttttg aataatggtt taatatattt agattgtagt
   218521 tataataaat tagaaaacat aaatattaat actagtttat tacatttgaa ttgttcaaat
   218581 aatgaattaa gtaatataaa ttgtgtagat tcattaaaat atattgattg tgaaaataat
   218641 tatataattg aaataataac aaataatgaa ttatttgaat taaattgtat taacaatcct
   218701 ttgaaaataa tatctatata taataattta aaatcattaa aatttgatac taatttagaa
   218761 tatatatatt ttaatgaaca taacgagatt ataataaatg gtattaaaaa ttatatagat
   218821 agatttaatt taaaaaaaat agaagtattt gataatgatg atatttgttc catatgttta
   218881 gataaaggaa ttttatataa aacaatatgt aatcatacat ttcataaaga atgtttgaat
   218941 aatataaata ataatttatg tccatattgt aaacaaaata tactttgcat tccattacat
   219001 acgccaataa aattagataa taatgaaaaa atataaaaat gtaaaaaatg gaaagaatat
   219061 ttaatgatta ttttttgctt aaaaaaattt ttgttaatat gcaaataata gatataatta
   219121 atctttatga atctgatata atagaaaaat caagtatttt atcatatata tcaactatta
   219181 aagattctac gcataatgtt attttaaata atgaaaatgt gtctgataat tttatatata
   219241 attttttaga tatttgttgt ataaatatta atatgttaat tgataataga ttaaaattta
   219301 ataaaaattt gtcatgtaat ataattgata aatatataaa tatatataat aatatagaat
   219361 atataaattg gaataatata agtatgttaa aattaacata tgaatttata aaaaaatata
   219421 aaaatgaatt aaattggaat attatatgta aatataaaat aaatttaaat gatcaaatta
   219481 taaatgataa taatgatttt attaattggt attatattaa aaacactttt tgaaaaatta
   219541 tatacatagt ataaaaatgt ataaaatata ttttcgagat attgataaat ataaaaaaga
   219601 agacattata tttttagatt gttcaaaata ttttataaaa aattttaaat ttttagaatc
   219661 tttaccaaat ttacaaatat tatatatatc atgtaataaa aattcaaata tagaaaaaat
   219721 taaattacca aaaactatta cagaatttgt atgtgataat tgtgatatta ggagttttaa
   219781 atttattaca aacttaccaa atttgaaaaa attaaatata tcagtaaatt ttaattctga
   219841 tatagaaaaa tgtaaattac cagaatctat tatagaatta atttgtgaat attgttttat
   219901 aaaagattat agttttatta ataatttacc aaatttacaa atactaaata tatcaaataa
   219961 tttcgaacca atagaatata ttaatataca aaatttaatt gattttaatg catcaaattg
   220021 tattattaat aatttttcat ttttagaaaa ttctaaatta caaaaattaa atttatgtgg
   220081 tgtatgtatc actaacaaat tatcaaaaca taaattacca aatactatta ttaaattaaa
   220141 ctgtaataga tgtgatgtaa ttgattttag ttttattgaa tcgttaatta atttagaaac
   220201 tttatttata aaatataatg taaattcaaa tatatcaagt tgtaaattac caaattctat
   220261 taaatatata gattgtgaag aatgtttaat aacagatttt acatttttag aacctttaca
   220321 taatttaata aaattaagta tatcatacaa tatgaattca aatataaata ttataaattt
   220381 acctaaattt attcaagaat ttacttgtaa aaaatgtaat attaacgatt ttagtttttt
   220441 actttcatta tcaaatcttt taatattaaa tatatcatgt aatgatgtat taaaatgtat
   220501 tttaccaaat tctataaaat cattaaaatg ttattgttgc aatataaaag attttagttt
   220561 tttaagtcca ttaaaaaaat tgaaatattt agatatttgc aataatccaa attctaatat
   220621 aacacgtgat atgataccat catatgtaaa ttttatttgt aaacgtaatg atgtaaaaga
   220681 atttaatttt aatggaataa atgttaattt caaagaatat atatattttt catcagatga
   220741 atgtgatttt tctgattaat ttttgttatt gaaaaaatat tttgtaataa ttacaatatg
   220801 tgcgatataa aaatattaaa tatttcaaat aataaaaatc caaactttaa tatacccaat
   220861 tatattacag aatttatatg tacaaattgt gatataaaag attttagttt tatagaaaaa
   220921 ttagataatc tagaaatatt aaacatatct aataacccta attcaaatat atctaaatgt
   220981 ttattaccta aatctataaa aacatttata tgtattgatt gtaatataac agattttaaa
   221041 tttattgaaa aaatgccaaa tttggaaaca ttaattatat cttataatac taattccaat
   221101 atatatcaat gttggattcc aaattctata attacttttg tatgtattgg atgttatata
   221161 tcagatttta gttttattca atttctacca aatttaaaaa tattagatat atcatataat
   221221 aaacatgcat acataatatt accagtatca ataattaaat tagtttgtac taattgtagt
   221281 attaaaaatt ttagattttt ggaaaaatta cataatttac aaatattaga tattagtaat
   221341 aataaaaact caaatatatc aaattgtaat ttatcaaaat taataattga attaacatgt
   221401 tgtggatgta aaatatataa ttttaaattt attgaaaagt taaaaaattt acaaatatta
   221461 aatttatcta gaaattatgt ttacagtaat ataaatgatt gtaatctacc aataactatt
   221521 aaaaaattaa ctttaggctt ttttaaagat attaattata aatttattaa taaattatta
   221581 aatttagaaa tattaatact agaatatatt atttgttctt taacaatacc taatactata
   221641 aaagaattat atttatttta ttgtgaaatt aaagatttta aatttattga atcatttaaa
   221701 tatttgaaaa aattacatat aatacataat aacagttatt ctaatatatt agattgtata
   221761 ataccaacat ctgtatgtga atataaattt gaaatttaat gatatatttt tgttaaagaa
   221821 aaataaaaat gaatgaagaa ctaaaaaaat ataaatacga agatataata aataataaat
   221881 atgaatatat aaaatttctt gattgtacta atagaaatat taaaaatttt aaatttttag
   221941 agttactaac taatctagaa atattaatta tatctgataa ccctgattct aatatttctt
   222001 tatgtaaatt accaaataaa ataaaaagat ttgaatgtaa ttattgtaat ataaaagatt
   222061 ttaagttttt agaaccttta gaaaatctag aaatattaga tatttctgaa aattataatt
   222121 ctaatatttc tttatgtaaa ttatcaaata aattaaaaaa aattatatgc aattattgta
   222181 atataaaaga ttttaaattt ttagaacctt tagaaaatct agaaatatta gatatatccg
   222241 aaaattataa ttctaatatt tcagattgta atttatcaaa aaaattaatt aagttagatt
   222301 gtaaattttg taatattgta gattttaaat ttatagaaaa tttagaaaat ctacaaatat
   222361 tagatatatc ttggaataaa gatgcaatta tttctaaata taaaatacca ttatcattaa
   222421 ttgaatttaa atgtcaatat tgtaaaattt ctgattttaa atttttagaa tcattaatta
   222481 atcttaaaat attaaatata tctaaaaata aaaattcaaa tatttctgat tgtattttat
   222541 catcatcaat aattgaattt aattgtatat tttgtagaat ttatgatttt aaatttttac
   222601 aaaatttatt caatttaaaa aagttatata tatcatataa ttttcattct aatatatccg
   222661 aatgcacatt accagtttca ttaattaaat tagaatgtaa atattgcaat attgttaatt
   222721 gtaatttttt aaagaattta tctaacttac aaatattaga tattagtaat aataatagat
   222781 gtcatatatc ttattgtaaa ttatcatcat caataattga atttagatgt aaatcatgta
   222841 aacttttaaa ttttaaattt ttagaggatt tatataactt acaaatatta gatatatcta
   222901 ataatcctaa ttcaaatatt tctgattgtg tattatcatc aaaattaatt aaattatatt
   222961 gtgaaaaatg taatattaaa aactttgagt ttataaaaat ttttaaaaaa ctagaaatat
   223021 atataaataa ttatttttga aattttatta ataaatatat aaataaatga taaataataa
   223081 atattttttg aatttattat agtaaaatga aagaaagtaa taaaacatta ttttgtggaa
   223141 tttgtaacac tactagtaat aaatatgtat ctggtatatg tgtaacatgt tttaaaatta
   223201 gtaaaaatag tcatctaata gattcatttt gtatagtatg caatggtatt actaaaataa
   223261 ataaatataa tggtatttgt aaaacatgta attataatat agattattgg tatgaacaaa
   223321 ttgccaaatc ttataatgaa agatttttaa catttaaatg taaaacatgt aaaaaataca
   223381 ttgactgtca atctggatat agacattgtg ttgaatgtat agaaagatat tttaaagtta
   223441 gatgtattac atgtaataaa tttattgatg ctaaatccta tgatactaaa tgtaaaattt
   223501 gtaaaaaata attttttttg aaataataat atattattta tgtcgtaatt atataaaata
   223561 tggcgcttaa ttattattct tttgttgagt taattaagta tttaaataat cctgatgaaa
   223621 tacatggctt gatttcatta aatgaaatat ataaatcata tataatagaa tcaagaatag
   223681 aattgttatt ttattataga gatattaaag aatatgatga aaaatattat ccatttataa
   223741 caaatttgga ttgtagtaat tgtcctgatg taactattga ttttttaaat aaattcatta
   223801 atttaaaagt attaaatata tctaataata gtcatttatc tgaagatatt gatgatttaa
   223861 gattaccaaa tttaattaat ttaaattgca gttcatgtaa tattaaattt tttgattttt
   223921 taagtaaatt tactaattta caagtattag atatatctaa taatattaat tgtgaggata
   223981 aaagtattaa tgttttaaat atattaacta atctaaaaat attaaacata tctaataata
   224041 attgtgatta taaaattatt gataatttaa ataaattaaa aaaaagatta caagtattaa
   224101 atatatctaa taatgaacaa ttatctaaaa aaattgatta tttaagatta ccaaatttaa
   224161 ttgattttaa ttgcagttca tgtaatatta aatcttttaa ttttttaaat aattttacta
   224221 aattacaaat attagatata tctaataatg aaaatatatg gacctatgca ttaccactac
   224281 caccattttt aattaaagtt aattgtagtg gatgtaatat aaccaatagt gattttttaa
   224341 gatatgttga taatttagaa gaattagata tatctaacaa tcctgattta aaaattgaat
   224401 atatgccaac taaaataaaa aaattaaata ttagtgaatg ttatattaaa aatgataatt
   224461 ttttaaaagg tttaaataat ttacaagaat taaatatatc ttataatcca tacaattatt
   224521 ttagaaagtc aattgaaata gatattgata atttatcaaa cacattaatt aaattatatc
   224581 ttcgtaaatg taatattaaa aatgtttcat ctttcaaaaa tttgattaat ttacaagaat
   224641 tagttatatc tgaaaataga caagtaaata taaataattt accagatgaa ttaatttcat
   224701 taaatcttag ttcatgtaaa attataaata ttgagtttcc aaaaaaatta aaagaattaa
   224761 atttatctaa aacttatata tcaaatatta aaaatttacc aaaatcattg attaaattag
   224821 atattagtta ttgtaatctt aaaaatgata attgtttgaa agatttaaat aatttaaaag
   224881 aattagatat atctggtaat tgggaaatat gtttttcatc tttacctaaa tcaataatta
   224941 aaattaaatg taaaaattgt aatattacta atactgattt tttaaataat ttagataatt
   225001 tacaagaatt agatatgtct gtaaattatt acataaatat taataaatct agacgtattg
   225061 ataatttacc aaaaaaacta attaaattaa atattaataa ttgcgattgt gcatatatta
   225121 gttttaaagg attagataat ttagaagaat tggaaatgat tagaaatact tgtttaattg
   225181 attatttacc aaaatcatta attaaattac atggttatac tcatactttt aaaattaaag
   225241 atttaaataa attaacaaca ttgtgtttac ctggtattat taaaataaat attgaggatt
   225301 taccaaaatc attaattgaa ttagatatta gtacatgtaa atatatcata aatgaagatt
   225361 gtttaaaaaa tttatataat ttaaaagaat taactatgtc tataaattgt aacattataa
   225421 aacaaacttt acccgaatca ttaattaaaa taaaaattaa actatgtaag tattcatatg
   225481 atgatttcat aaaagatatt tatgataaaa aattaaattt atctaatgaa tatggtaaat
   225541 atatttcatt tttacctgaa ataattaaaa ataattataa tgcttttaag attcatttaa
   225601 tagataatat atataattta aaaaaaatca aatcaataga tataagtaat aatgaatgta
   225661 gatgtcattg cttaggatta taatatgatt atgatagtat aaaattttta tattttatta
   225721 aaaataatac attatattta attttttttc agaaccatta gttaatttat aaaatgtgca
   225781 tttattatat tatataactt gtaaaataat aaaaaatgaa atattaatat aagatcctat
   225841 tatttatttt aatatataaa attgatcttg actactattc tttattgaga taattaagta
   225901 tttaaataat cctgatgaaa tacatggttt tgtttcatta aatgaaacat ataaaaaata
   225961 tataatagaa tatgattacc aatttattat aaatatatta aagattaaag aatattatcc
   226021 ttttataaca aatttgaatt gtaataattg ttctgaaata actattgatt ttttaaaaat
   226081 tttttatatt aaatatatct aataatagtc atttatttga aaatattaat gatttaagat
   226141 tactaaattt aattgatttt aaatgcagtt catgtaatat taaatttttt gattttttaa
   226201 ataaatttac aaatattaaa tatatctaat aatggatata tatggtctta taatttacca
   226261 tcatcaataa ttaaatttaa ttgtaatgaa tgtaaaatca gtaatagtga ttttttaaga
   226321 tatgtatata atttagaaga attagatata tctaacaatc ctgatttaaa aattgattat
   226381 aagccaaaga aattaataaa attaaatatt agtaaatgtt atattaaaaa tgatagtttt
   226441 ttaaaaaatt taaataattt aaaagaatta gatatatctt ataattcaac tttatatatt
   226501 tcatgtagtt ttaaaaattt gattgaaata gatattgata atttaccaaa ttcactaatt
   226561 aaattatatc ttcgtaaatg taatattaaa aatatttcat ctttcaaaaa tttgattaat
   226621 ttacaagaat tagatatttc tgaaattagt caaataaata taaataattt accagacaca
   226681 ttgattacat taaatcttag ctcatgtaat attacaaata ttaagtttcc aaaaaattaa
   226741 aaaatttaaa agaattaaat ttatctaaaa ataacattaa agttattaaa catttaccaa
   226801 aatcactaat taaattagat attaattatt gtaaccttaa aaatgataat tatttgaaag
   226861 atttagataa tttaaaagaa ttagatatat ctggtaattg ggaaatatgt ttttcatctt
   226921 tacctaaaac aataattaaa attaattgta atagatgtaa tattgctaat actgattttt
   226981 tgaataattt agataattta aaagaattag atttatctat aaattacatt atcattatta
   227041 ataatttacc aaaatcacta attaaattaa atattagtaa atgcaatatt ttatatgtta
   227101 gttttaaaga tttaaacaat ttagaggaat tgaatatgtc tgaaaatcat tggataaaat
   227161 ttgattattt tccaaaatca ttaattaaat taaattgtaa tgtctgttct attatagata
   227221 attctttctt taaaaaatta aataaattga aagaattgga tgtatctggt aatattgaaa
   227281 tagatattaa aaaattacca aaatcattaa ttaaattaaa tattattgaa tgtaaaatta
   227341 aaaatggtaa ttatttaaaa gaattaaaat tatatagaaa ttgtaatatt aaaattccag
   227401 ctctatccat tttttaagta aaaaatgaaa taataattta ttattttgtc gtaattataa
   227461 tatataaaaa tgacgcttaa ttattattct tttattgagg tagttaaata tttagataat
   227521 ccagataaaa tacatgaatt tgtttcatta aataaaatat ataagaaata tataatagaa
   227581 tcaggattac caatttacta taaacatatt atagattata atgaagaata ttatccattt
   227641 ataacaaatt tggattgtaa taattgtcct gatataacta ttgatttttt aaataaattt
   227701 actaatttaa aagtattaaa tatatctaat aatagtcatt tatctgaaag tattgatgat
   227761 ttaaaattac caaatttaat taatttaaat tgcagttcat gtaatattaa atcttttaat
   227821 tttttaagaa attttaataa tttacaaata ttagatatat ctaataataa atacatatgg
   227881 tgctacgaat taccagaatc attaattaaa ttaaatatta gtaaatgtta tattgaaaat
   227941 gatagatacc tcaaaaattt aaataattta caggaattaa atatatctaa taaattggat
   228001 ttagattttc caaatgaaat agatattaat aatttaccaa aatcattaat taaattaaat
   228061 attagtaatt gcaatataat aaatgctaat tctttaaaaa atttaattaa tttaaaagaa
   228121 ttagatatat ctaataaatt atatttagat ttttcaaatg aaatagatat taataattta
   228181 acaaaatcgt taattaaatt aaatattagt aattgtaata taataaatgc tagttcttta
   228241 aaaaatttaa ttaatttaaa agaattggat atatctaaca attataatat aaatatttca
   228301 tcattaccaa aaacattaat taaattaaat attagttcat gtaatataaa aaatactaat
   228361 tttataatta atttagataa tttgaaagaa ttagatatat ctagaaattt taatataaat
   228421 atttcatcat taccaaaatc attaatcaaa ttaaatatta ggacatgtta tataaaaaat
   228481 actaatttta taattaattt agataatttg aaagaattag atatatctag aaattttaat
   228541 ataaatattt catcattacc aaaatcattg attacattaa atattaattc atgttatata
   228601 aaacacacta attttataaa tgatttatat aatttgaagg aattggatat atctagaaat
   228661 tataatataa atatttcatc attaccaaaa tcattaatca aattaaatat tagtgattgc
   228721 gatattaaaa atactaattt tataaatgat ttagataatt tgaaagaatt agatatatct
   228781 aacaattata atataaatat ttcatcatta ccaaaaacat tgactacatt aaatattagt
   228841 tcatgtaata taaaaaatac taattttata attaatttag ataatttgaa agaattagat
   228901 atatctaaaa attttaatat aaatatttca tcattaccaa aatcattgat tacattaaat
   228961 attaattcat gttatataaa ccatactaat tttataaatg atttatataa tttgaaagaa
   229021 ttagatatat ctaacaatta taatataaat atttcatcat taccaaatac attaattgaa
   229081 ttaaatatta gttcgtgtta tataaaaaat actaatttta taattaattt agataatttg
   229141 aaaaaattag agatatctaa aagttcatta tatgatatga tattacataa tatttttact
   229201 tttaattatt taaaattatt agataaaagt aatacttcat ttacatttta ttataaaata
   229261 aaatcaaaat ttgtaaaaat aattgttaat cgtgaagaat gtaaattact aaagtcattg
   229321 tatcttatat gttcattgaa gtagtaaatt ttgtcattat tgttaatact caaaatgaaa
   229381 aatggataat atttttatta atgttaaaaa aaatttaata ataatatgat tagtataaat
   229441 aatcaaatta tattaacaga atatgaaata attttttttt ttttgaaaaa ttaatccaat
   229501 cataatgtat agctgtaaaa tggaaattga tcttgaatgt gtagttttat gtaaaaattg
   229561 taatgtatca tcttatcaat atacagatgg tatatgcatt aattgtgatt ttcctattaa
   229621 tattaaactt gatatatgta ataaatgtaa caaaattaat tttgttcatg atggagtatg
   229681 cggtgaatgt tatgctaaca aaattgtatg taatggtgat aatacaaaat ctacatgtta
   229741 tataattatt ataaatgatc aaaaggtaat agaggagggt gttgtagaat ccagtaaaga
   229801 tatatttatt tcagataaat ttacatataa tattataaat gttgtaatta tttctaataa
   229861 taaaatacta caaataaata acattgataa aaaatatgaa aaagttttta atagatattt
   229921 gatattcaac tatgaccatg ttattttaac acagcaaata gatgaaatat aattttatat
   229981 ttaaaatttt gatataaaat ggctgagaaa agaaatgtta aagtaaagtt agttgaacct
   230041 gatgtcaata aatcattatc aactataatt gaagcattac aaaatgaaat acaaaaaagt
   230101 attcaagatc aatcaaatat attaaaacaa aatttaagtg aagatataat gaatgaagtt
   230161 gaaaagtttg agtctcaagt aacagaatta actaatatgc ttaaaaatta tgttattagc
   230221 accattgaag agaaaattga taattatgtt aactcattaa tttcttaaaa aggattttat
   230281 atcaatatca atatcgatac attttattaa atatataaag tccaatcaat gtttttatat
   230341 ctaatgtcca attaatgttt ttatatctaa tgtccaatta atgtttttat atctaatgtc
   230401 caattaatgt ttttatatct aatgtccaat taatgttttt atatctgata tgttaaaata
   230461 tcaaaaatat caatatctaa tacccaatca atgtttttat atctgatatc acaaaatatc
   230521 aatattgtat caaaaatatc aatatctaat acccaatcaa tgtttttata tctgatatgt
   230581 taaaatatca aaaatatcaa tatctaatac ccaatcaatg tttttatatc tgatatcaca
   230641 aaatatcaat aatgtatcaa aaatatcaat atccaatgtc caattaatgt ttttatatct
   230701 gatatgttaa aatatcaaaa atatcaatat ctaataccca atcaatgttt ttatatctga
   230761 tatgttaaaa tatcaaaaat atcaatatct aatacccaat caatgttttt atatctgata
   230821 tgttaaaata tcaaaaatat caatatctaa tacccaatca atgtttttat atctgatatg
   230881 ttaaaatatc aaaaatatca atatctaata cccaaacaat gtttttatat ctgatatgtt
   230941 aaaatatcaa taatgtatca aaaatatcaa tatccaatgt ccaataaagg attttatatc
   231001 tgatatcaca aaatatcaat aatgtatcaa aaatatcaat atccaatgtc caataaagga
   231061 ttttatatct gatatcacaa aatatcaata atgtatcaaa aatatcaata tctaattacc
   231121 caataatgtt tttatatctg atatgtcaaa atatcaataa tgtatcaaaa atattcatat
   231181 ccaatgtcca attaatgttt ttatatctga tatgttaaaa tatcaataat gtatcaaaaa
   231241 tatcaatatc taatacccaa tcaatgtttt tatatctgat atcacaaaat atcaataatg
   231301 tatcaaaaat ataaataatc aaagtacaaa caatgttttt atatctgata tcacaaaata
   231361 tcaataatgt atcaaaaata tcaatatcta atacccaatt aatgttttta tatctgatat
   231421 gttaaaatat caataatgta tcaaaaatat caatatctaa tacccaatca atgtttttat
   231481 atctgatatc acaaaatatc aataatgtat caaaaatata aataatcaaa gtacaaacaa
   231541 tgtttttata tctgatatgt taaaatatca ataatgtatc aaaaatatca atatccaatg
   231601 tccaataaag gattttatat ctgatatcac aaaatatcaa taatgtatca aaaatatcaa
   231661 tatccaatgt ccaataaagg attttatatc tgatatcaca aaatatcaat aatgtatcaa
   231721 aaatatcaat atccaatgtc caataaagga ttttatatct gatatcacaa aatatcaata
   231781 atgtatcaaa aatataaata atcaaagtac aaacaatgtt tttatatctg atatgttaaa
   231841 atatcaataa tgtatcaaaa atatcaatat ccaatgtcca ataaaggatt ttatatctga
   231901 tatcacaaaa tatcaataat gtatcaaaaa tatcaatatc caatgtccaa taaaggattt
   231961 tatatctgat atcacaaaat atcaataatg tatcaaaaat atcaatatct aatacccaat
   232021 caatgttttt atatctgata tcacaaaata tcaataatgt atcaaaaata taaataatca
   232081 aagtacaaac aatgttttta tatctgatat cacaaaatat caataatgta tcaaaaatat
   232141 caataatcaa agtacaatta atgtttttat atctgatatc acaaaatatc aatattgtat
   232201 caaaaatata aataatcaaa gtacaattaa tgtttttata tctgatatca caaaatatca
   232261 atattgtatc aaaaatatca atatctaata cccaattaat gtttttatat ctgatatgtt
   232321 aaaatatcaa taatgtatca aaaatatcaa tatccaatgt ccaattaatg tttttatatc
   232381 tgatatgtta aaatatcaat aatgtatcaa aaatatcaat atctaatacc caatcaatgt
   232441 ttttatatct gatatgttaa aatatcaata atgtatcaaa aatatcaata tctaataccc
   232501 aatcaatgtt tttatatctg atatcacaaa atatcaataa tgtatcaaaa atatcaatat
   232561 ctaataccca atcaatgttt ttatatctga tatcacaaaa tatcaatatt gtatcaaaaa
   232621 tataaataat caaagtacaa acaatgtttt tatatctgat atcacaaaat atcaataatg
   232681 tatcaaaaat atcaatatct aatacccaat caatgttttt atatctgata tcacaaaata
   232741 tcaataatgt atcaaaaata tcaatatcta atacccaatc aatgttttta tatctgatat
   232801 cacaaaatat caataatgta tcaaaaatat aaataatcaa agtacaataa aggattttat
   232861 atctgatatc acaaaatatc aataatgtat caaaaatatc aatatccaat gtccaataaa
   232921 ggattttata tctgatatca caaaatatca ataatgtatc aaaaatatca atatctaata
   232981 cccaattaat gtttttatat ctgatatgtt aaaatatcaa taatgtatca aaaatatcaa
   233041 tatctaatac ccaatcaatg tttttatatc tgatatcaca aaatatcaat aatgtatcaa
   233101 aaatatcaat atctaatacc caattaatgt ttttatatct gatatgttaa aatatcaata
   233161 atgtatcaaa aatatcaata tccaatgtcc aattaatgtt tttatatctg atatgttaaa
   233221 atatcaataa tgtatcaaaa atatcaatat ctaataccca atcaatgttt ttatatctga
   233281 tatgttaaaa tatcaataat gtatcaaaaa tataaataat caaagtacaa acaatgtttt
   233341 tatatctgat atcacaaaat atcaataatg tatcaaaaat atcaatatct aatacccaat
   233401 caatgttttt atatctgata tcacaaaata tcaataatgt atcaaaaata tcaatatcta
   233461 atacccaatc aatgttttta tatctgatat cacaaaatat caataatgta tcaaaaatat
   233521 aaataatcaa agtacaataa aggattttat atctgatatc acaaaatatc aataatgtat
   233581 caaaaatatc aatatccaat gtccaataaa ggattttata tctgatatca caaaatatca
   233641 ataatgtatc aaaaatatca atatctaata cccaatcaat gtttttatat ctgatatcac
   233701 aaaatatcaa taatgtatca aaaatataaa taatcaaagt acaaacaatg tttttatatc
   233761 tgatatcaca aaatatcaat aatgtatcaa aaatatcaat atctaatacc caattaatgt
   233821 ttttatatct gatatgttaa aatatcaata atgtatcaaa aatatcaata tctaataccc
   233881 aatcaatgtt tttatatctg atatcacaaa atatcaataa tgtatcaaaa atatcaatat
   233941 ctaataccca attaatgttt ttatatctga tatgttaaaa tatcaataat gtatcaaaaa
   234001 tatcaatatc caatgtccaa ttaatgtttt tatatctgat atgttaaaat atcaataatg
   234061 tatcaaaaat atcaatatct aatacccaat caatgttttt atatctgata tgttaaaata
   234121 tcaataatgt atcaaaaata tcaatatcta atacccaatc aatgttttta tatctgatat
   234181 cacaaaatat caataatgta tcaaaaatat caatatctaa tacccaatca atgtttttat
   234241 atctgatatc acaaaatatc aataatgtat caaaaatatc aatatctaat acccaatcaa
   234301 tgtttttata tctgatatca caaaatatca ataatgtatc aaaaatataa ataatcaaag
   234361 tacaattaat gtttttatat ctgatatgtt aaaatattaa taatgtatca aaaatatcaa
   234421 tatccaatgt ccaattaatg tttttatatc tgatatgtta aaatattaat aatgtatcaa
   234481 aaatatcaat atccaatgtc caattaatgt ttttatatct aatatcaata tcgatacatt
   234541 ttattaaata tctaaagttc aataaaggat tttatatctg atatgttaaa atatcgttgt
   234601 ttttatatat aaatataatt atgaaaaaat atttcaatat ttaaaagtta tatgttgaaa
   234661 taacagtaat actttaaaaa atgaaaaata tatcaatata taaaatttat atgttgatat
   234721 aacagataat tcaaatatga aattttatta ataataataa ataaatatat gtttataata
   234781 aatattaatt aaaatgataa aattataatt ttttaataat tgtaagagac ataaaacaaa
   234841 ataaaaaaaa aaaaaattat aaactaaaac taataaaatt gataatcgaa aatcgaaaat
   234901 cgaaaatcga aaatcgaaaa tcgaaaattg ataatcgaaa atcgaaaatt gataattgat
   234961 aattgataat tgataattga taatcgaaaa tcgaaaattg ataatcgaaa atcgaaaatt
   235021 gtatatttta ttatatgata taatataata ctcaataaat gttttgatat atgatatatt
   235081 tacatactat aaaagtctag tttatgtttt atatatttta taccaatatt gatattgata
   235141 cattttatat aatattataa aataccatta tagatatatt ttattaaata tccaaaatcc
   235201 aatcaatatt tttatatcta atatcaatat tgatatattt tattaaatat ccaaaatcca
   235261 atcaatattt ttatatccaa tatgttaaaa tactatttta ataattagca ttaatataat
   235321 tgttgatttt agttgtaaaa aaataaataa atattaaata ctaatgtatg tacatattac
   235381 aaatttttaa atagaatttg atgtatttta gatataatgc tataataatt atatttgatg
   235441 tattttaaat tgtatttgat gtattttaaa ttgtatttga tgtattttag atataatgct
   235501 ataataatta tatttgatgt attttaaatt gtatttgatg tattttaaat tgtatttgat
   235561 gtattttaga tataatgcta taataattat atttgatgta ttttaaattg tatttgatgt
   235621 attttaaatt gtatttgatg tattttagat ataatgctat aataattata tttgatgtat
   235681 tttaaattgt atttgatgta ttttaaattg tatttgatgt attttagata taatgctata
   235741 ataattatat ttgatgtatt ttaaattgta tttgatgtat tttaaattgt atttgatgta
   235801 ttttagatat aatgctataa taattgtatt tgatgcattt taaattgtat ttgatgtatt
   235861 ttagatataa tgctataata attatatttg atgcatttta aattgtattt gatgtatttt
   235921 aaattgtatt tgatgtattt tagatataat gctataataa ttatatttga tgtattttaa
   235981 attgtatttg atgtatttta aattgtattt gatgtatttt agatataatg ctataataat
   236041 tgtatttgat gtattttaaa ttgtatttga tgtattttaa attgtatttg atgtatttta
   236101 gatataatgc tataataatt
//
DBGET integrated database retrieval system