GenomeNet

Database: RefSeq
Entry: NC_002127
LinkDB: NC_002127
Original site: NC_002127 
LOCUS       NC_002127               3306 bp    DNA     circular CON 03-AUG-2016
DEFINITION  Escherichia coli O157:H7 str. Sakai plasmid pOSAK1, complete
            sequence.
ACCESSION   NC_002127
VERSION     NC_002127.1
DBLINK      BioProject: PRJNA57781
            Assembly: GCF_000008865.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli O157:H7 str. Sakai
  ORGANISM  Escherichia coli O157:H7 str. Sakai
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (sites)
  AUTHORS   Makino,K., Ishii,K., Yasunaga,T., Hattori,M., Yokoyama,K.,
            Yutsudo,H.C., Kubota,Y., Yamaichi,Y., Iida,T., Yamamoto,K.,
            Honda,T., Han,C.G., Ohtsubo,E., Kasamatsu,M., Hayashi,T., Kuhara,S.
            and Shinagawa,H.
  TITLE     Complete nucleotide sequences of 93-kb and 3.3-kb plasmids of an
            enterohemorrhagic Escherichia coli O157:H7 derived from Sakai
            outbreak
  JOURNAL   DNA Res. 5 (1), 1-9 (1998)
   PUBMED   9628576
REFERENCE   2  (bases 1 to 3306)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3306)
  AUTHORS   NCBI Microbial Genomes Annotation Project.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-1998) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AB011548.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
                        PHY: Based on Phylogenetics
            Sequence updated (09-Apr-1999).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3306
                     /organism="Escherichia coli O157:H7 str. Sakai"
                     /mol_type="genomic DNA"
                     /strain="Sakai"
                     /sub_strain="RIMD 0509952"
                     /serovar="O157:H7"
                     /db_xref="taxon:386585"
                     /plasmid="pOSAK1"
                     /note="RIMD 0509952 is a strain of enterohemorrhagic E.
                     coli, EHEC O157:H7"
     misc_feature    1..3306
                     /note="REFSEQ gene predictions performed by GeneMark
                     2.4/GeneMark.hmm 2.0 with comparison to original submitter
                     provided annotation."
     gene            413..736
                     /gene="mobA"
                     /locus_tag="pOSAK1_01"
                     /db_xref="GeneID:1789662"
     CDS             413..736
                     /gene="mobA"
                     /locus_tag="pOSAK1_01"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid mobilization"
                     /protein_id="NP_052604.1"
                     /db_xref="GeneID:1789662"
                     /translation="MTKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLR
                     AAALGKKVNSLTDDRVLKEVMRLGALQKKLFIDGKRVGDREYAEVLIAITEYHRALLS
                     RLMAD"
     misc_feature    437..730
                     /gene="mobA"
                     /locus_tag="pOSAK1_01"
                     /note="conjugal transfer transcriptional regulator TraJ;
                     Region: PRK13877"
                     /db_xref="CDD:184361"
     gene            complement(971..1351)
                     /locus_tag="pOSAK1_02"
                     /db_xref="GeneID:1789661"
     CDS             complement(971..1351)
                     /locus_tag="pOSAK1_02"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052605.1"
                     /db_xref="GeneID:1789661"
                     /translation="MKKDKKYQIEAIKNKDKTLFIVYATDIYSPSEFFSKIESDLKKK
                     KSKGDVFFDLIIPNGGKKDRYVYTSFNGEKFSSYTLNKVTKTDEYNDLSELSASFFKK
                     NFDKINVNLLSKATSFALKKGIPI"
     misc_feature    complement(1010..1294)
                     /locus_tag="pOSAK1_02"
                     /note="Antitoxin to bacterial toxin RNase LS or RnlA;
                     Region: RnlB_antitoxin; pfam15933"
                     /db_xref="CDD:406375"
     gene            complement(1348..2388)
                     /locus_tag="pOSAK1_03"
                     /db_xref="GeneID:1789663"
     CDS             complement(1348..2388)
                     /locus_tag="pOSAK1_03"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052606.1"
                     /db_xref="GeneID:1789663"
                     /translation="MAQNPFKALNINIDKIESALTQNGVTNYSSNVKNERETHISGTY
                     KGIDFLIKLMPSGGNTTIGRASGQNNTYFDEIALIIKENCLYSDTKNFEYTIPKFSDD
                     DRANLFEFLSEEGITITEDNNNDPNCKHQYIMTTSNGDRVRAKIYKRGSIQFQGKYLQ
                     IASLINDFMCSILNMKEIVEQKNKEFNVDIKKETIESELHSKLPKSIDKIHEDIKKQL
                     SCSLIMKKIDVEMEDYSTYCFSALRAIEGFIYQILNDVCNPSSSKNLGEYFTENKPKY
                     IIREIHQETINGEIAEVLCECYTYWHENRHGLFHMKPGIADTKTINKLESIAIIDTVC
                     QLIDGGVARLKL"
     misc_feature    complement(2149..2373)
                     /locus_tag="pOSAK1_03"
                     /note="RNase LS, bacterial toxin N-terminal; Region:
                     RnlA_toxin_N; pfam19417"
                     /db_xref="CDD:437249"
     misc_feature    complement(1867..2121)
                     /locus_tag="pOSAK1_03"
                     /note="RNase LS, bacterial toxin; Region: RnlA_toxin;
                     pfam15935"
                     /db_xref="CDD:406376"
     misc_feature    complement(1453..1818)
                     /locus_tag="pOSAK1_03"
                     /note="RNase LS, bacterial toxin C terminal; Region:
                     RnlA-toxin_C; pfam19034"
                     /db_xref="CDD:408804"
CONTIG      join(AB011548.2:1..3306)
//
DBGET integrated database retrieval system