GenomeNet

Database: RefSeq
Entry: NC_002128
LinkDB: NC_002128
Original site: NC_002128 
LOCUS       NC_002128              92721 bp    DNA     circular CON 28-AUG-2016
DEFINITION  Escherichia coli O157:H7 str. Sakai plasmid pO157, complete
            sequence.
ACCESSION   NC_002128
VERSION     NC_002128.1
DBLINK      BioProject: PRJNA57781
            Assembly: GCF_000008865.1
KEYWORDS    RefSeq.
SOURCE      Escherichia coli O157:H7 str. Sakai
  ORGANISM  Escherichia coli O157:H7 str. Sakai
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Escherichia.
REFERENCE   1  (sites)
  AUTHORS   Makino,K., Ishii,K., Yasunaga,T., Hattori,M., Yokoyama,K.,
            Yutsudo,H.C., Kubota,Y., Yamaichi,Y., Iida,T., Yamamoto,K.,
            Honda,T., Han,C.G., Ohtsubo,E., Kasamatsu,M., Hayashi,T., Kuhara,S.
            and Shinagawa,H.
  TITLE     Complete nucleotide sequences of 93-kb and 3.3-kb plasmids of an
            enterohemorrhagic Escherichia coli O157:H7 derived from Sakai
            outbreak
  JOURNAL   DNA Res. 5 (1), 1-9 (1998)
   PUBMED   9628576
REFERENCE   2  (bases 1 to 92721)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 92721)
  AUTHORS   NCBI Microbial Genomes Annotation Project.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-FEB-1998) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from AB011549.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
                        PHY: Based on Phylogenetics
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..92721
                     /organism="Escherichia coli O157:H7 str. Sakai"
                     /mol_type="genomic DNA"
                     /strain="Sakai"
                     /sub_strain="RIMD 0509952"
                     /serovar="O157:H7"
                     /db_xref="taxon:386585"
                     /plasmid="pO157"
                     /note="RIMD 0509952 is a strain of enterohemorrhagic E.
                     coli, EHEC O157:H7"
     gene            join(92527..92721,1..2502)
                     /gene="tagA"
                     /locus_tag="pO157p01"
                     /db_xref="GeneID:1789672"
     CDS             join(92527..92721,1..2502)
                     /gene="tagA"
                     /locus_tag="pO157p01"
                     /codon_start=1
                     /transl_table=11
                     /product="ToxR-regulated lipoprotein"
                     /protein_id="NP_052607.1"
                     /db_xref="GeneID:1789672"
                     /translation="MNTKMNERWRTPMKLKYLSCTILAPLAIGVFSATAADNNSAIYF
                     NTSQPINDLQGSLAAEVKFAQSQILPAHPKEGDSQPHLTSLRKSLLLVRPVKADDKTP
                     VQVEARDDNNKILGTLTLYPPSSLPDTIYHLDGVPEGGIDFTPHNGTKKIINTVAEVN
                     KLSDASGSSIHSHLTNNALVEIHTANGRWVRDIYLPQGPDLEGKMVRFVSSAGYSSTV
                     FYGDRKVTLSVGNTLLFKYVNGQWFRSGELENNRITYAQHIWSAELPAHWIVPGLNLV
                     IKQGNLSGRLNDIKIGAPGELLLHTIDIGMLTTPRDRFDFAKDKEAHREYFQTIPVSR
                     MIVNNYAPLHLKEVMLPTGELLTDMDPGNGGWHSGTMRQRIGKELVSHGIDNANYGLN
                     STAGLGENSHPYVVAQLAAHNSRGNYANGIQVHGGSGGGGIVTLDSTLGNEFSHEVGH
                     NYGLGHYVDGFKGSVHRSAENNNSTWGWDGDKKRFIPNFYPSQTNEKSCLNNQCQEPF
                     DGHKFGFDAMAGGSPFSAANRFTMYTPNSSAIIQRFFENKAVFDSRSSTGFSKWNADT
                     QEMEPYEHTIDRAEQITASVNELSESKMAELMAEYAVVKVHMWNGNWTRNIYIPTASA
                     DNRGSILTINHEAGYNSYLFINGDEKVVSQGYKKSFVSDGQFWKERDVVDTREARKPE
                     QFGVPVTTLVGYYDPEGTLSSYIYPAMYGAYGFTYSDDSQNLSDNDCQLQVDTKEGQL
                     RFRLANHRANNTVMNKFHINVPTESQPTQATLVCNNKILDTKSLTPAPEGLTYTVNGQ
                     ALPAKENEGCIVSVNSGKRYCLPVGQRSGYSLPDWIVGQEVYVDSGAKAKVLLSDWDN
                     LSYNRIGEFVGNVNPADMKKVKAWNGQYLDFSKPRSMRVVYK"
     misc_feature    550..1455
                     /gene="tagA"
                     /locus_tag="pO157p01"
                     /note="Peptidase M66; Region: Peptidase_M66; pfam10462"
                     /db_xref="CDD:287440"
     misc_feature    1606..>1734
                     /gene="tagA"
                     /locus_tag="pO157p01"
                     /note="metalloendopeptidase CpaA; Region: metallo_CpaA;
                     NF033511"
                     /db_xref="CDD:411150"
     misc_feature    1840..2127
                     /gene="tagA"
                     /locus_tag="pO157p01"
                     /note="ToxR activated gene A lipoprotein; Region: TagA;
                     pfam12561"
                     /db_xref="CDD:432637"
     misc_feature    2224..2493
                     /gene="tagA"
                     /locus_tag="pO157p01"
                     /note="Beta/Gamma crystallin; Region: Crystall_4;
                     pfam17945"
                     /db_xref="CDD:436164"
     misc_feature    1..92721
                     /note="REFSEQ gene predictions performed by GeneMark
                     2.4/GeneMark.hmm 2.0 with comparison to original submitter
                     provided annotation."
     gene            2589..3464
                     /gene="etpC"
                     /locus_tag="pO157p02"
                     /db_xref="GeneID:1789731"
     CDS             2589..3464
                     /gene="etpC"
                     /locus_tag="pO157p02"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpC"
                     /protein_id="NP_052608.1"
                     /db_xref="GeneID:1789731"
                     /translation="MLFFLSFRGDRGLFIKDIVLKMLTPNRLLCVILLIAGYQLVSVI
                     HHFWLTQAASVPGLSRVSAPETAVTGDQTEERFVFTLFGRASPLSSEGRAQETMPSLS
                     DDLLSGEDLDVRGILYSSVAEHSVAIFAHNNRQFSLSVGEKVPSYDATISAIFSDHIV
                     INYQGKTVSLPLRYDNTEKKNAYDNNNLTVGDVITQDNFRVESVFDIMSFSAVTVNNT
                     LSGYRLIPGKHSSLFYNAGLHDNDLAVSVNGSELRDTRQAQQIMKQLPELKEIKITVE
                     RDGQLYDAFIAVGEN"
     misc_feature    <2823..3452
                     /gene="etpC"
                     /locus_tag="pO157p02"
                     /note="Type II secretion system protein C; Region: T2SSC;
                     cl44344"
                     /db_xref="CDD:457689"
     gene            3675..5432
                     /gene="etpD"
                     /locus_tag="pO157p03"
                     /db_xref="GeneID:1789733"
     CDS             3675..5432
                     /gene="etpD"
                     /locus_tag="pO157p03"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpD"
                     /protein_id="NP_052609.1"
                     /db_xref="GeneID:1789733"
                     /translation="MLNEEQYYQFFLSVLDVYGFAVVDMHNGILKVVRSKDAKTSAVP
                     VASDVSPGTGDEVVTRVVPVSNVAARDLAPLLRQLNDNAGAGSVVHYEPSNVLLMTGR
                     AAVMKRLMEIVERVDKVGNRSVATVPLTYASATDVARLVTELTKETDKTAIPAWMTAK
                     LVADERTNSVLVSGEPISQQRIISIIKQLDRQEDVQGNTKVIYLKYAKAKDLVEVLTG
                     ISSSIENDSKKSPSTEALRKGVTIKSHEQTNALILTGAPDVIRDLENVISQLDIRRPQ
                     VLVEAIIAEIQDADGLNLGIQWVNKHAGVAQFTSTGLPITTMVQTRQNEILDSDQSNA
                     LSMFNGIAAGFYQGNWAMLLTALSTSSKNDILATPSIVTLDNMEATFNVGQEVPVLSG
                     SQTTSGDNIFNTVERKTVGIKLRVKPQINEGDSVLLEIEQEVSGVADTAVATTTDLGA
                     TFNTRTVTNAMLVGNGETVVVGGLLDKSIRGSESKVPLLGDIPVLGHLFRAKSEQTAK
                     RNLMLFIRPTIIRERDGFRHASAEKYQSFNQEQVQSRGKETTALTLNEEQLRLSPDQD
                     DTAFRKVKAAIAAFYAQEM"
     misc_feature    3678..5255
                     /gene="etpD"
                     /locus_tag="pO157p03"
                     /note="type II secretion system protein D; Region:
                     type_II_gspD; TIGR02517"
                     /db_xref="CDD:274175"
     gene            5432..6937
                     /gene="etpE"
                     /locus_tag="pO157p04"
                     /db_xref="GeneID:1789725"
     CDS             5432..6937
                     /gene="etpE"
                     /locus_tag="pO157p04"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpE"
                     /protein_id="NP_052610.1"
                     /db_xref="GeneID:1789725"
                     /translation="MSRVVQNVSESRPLLPFSFSRTQRILLLREQEGNRVFCMEDTPA
                     SALLEVRRVAEGPLNVTTVSAEAFEKQLVSSYQRDSDEARQMMAEIGNEMDFYTVAGE
                     LPDREDLLDANDDAPIIRLINAMLTEAIKEKASDIHIETYERHLQVRFRIDGVLREIL
                     RLHRNLASLLISRIKVMARLDIAEKRVPQDGRMVLRIGGRAVDVRVSTLPSNHGERIV
                     LRLLDKNSVSLDLAALGMSQQNQRHIDALIRRPHGIILVTGPTGSGKSTTLYAALSLL
                     NPRDRNIMTVEDPVEYELDGISQTQVNPKVDMTFARSLRAILRQDPDVVLVGEIRDGE
                     TAQIAVQASLTGHLVLSTLHTNSAAGALSRLQDMGIPPFLLSTSLLAVLAQRLVRTLC
                     PRCRQPCQVSTELAMDMDIPPETTIWQPAGCQHCSFTGYHGRTGIHELLLIDDRIRTA
                     IYQGEGELGITRLAGSRYLTLRGDGRQKVLAGETSWEEVVRVTESRLQEEE"
     misc_feature    5468..6910
                     /gene="etpE"
                     /locus_tag="pO157p04"
                     /note="type II secretion system protein E; Region:
                     type_II_gspE; TIGR02533"
                     /db_xref="CDD:131585"
     gene            6939..8162
                     /gene="etpF"
                     /locus_tag="pO157p05"
                     /db_xref="GeneID:1789729"
     CDS             6939..8162
                     /gene="etpF"
                     /locus_tag="pO157p05"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpF"
                     /protein_id="NP_052611.1"
                     /db_xref="GeneID:1789729"
                     /translation="MALFHYQASDIHGRKRSGILEADSARHARQLLREQALIPVRLDE
                     KQVHHKHSLRSILRFRPRGGSSAELALLTRQLATLVAASLPLEEALDALLRQSEKPRQ
                     RNLIAAVRTKVLEGHSLAAAMGMFPGTFERLYCAMVAAGETSGRLDVVLSRLADYTEQ
                     RQIMRNRLLQALLYPCVLTLVAVGVIAILLTAVVPKVVEQFIHMKQTLPLSTRVLMGA
                     AEVSQTWGPWLLLAAALGGIAGRMILHQPSQRLAFHHLLLRLPVVGRISRGLNTARYA
                     RTLSILNASAVPLLQAMHISGDVLSNDWARHQLATAAELVREGVSLHQALEQTSLFPP
                     MMRHMIASGENSGELDSMLERAADNQDREFSTQMQLALGLFEPLLVVGMAGVVLFIVL
                     AILQPLLQLNNMMNM"
     misc_feature    6948..8150
                     /gene="etpF"
                     /locus_tag="pO157p05"
                     /note="type II secretion system protein F; Region: GspF;
                     TIGR02120"
                     /db_xref="CDD:273980"
     gene            8193..8627
                     /gene="etpG"
                     /locus_tag="pO157p06"
                     /db_xref="GeneID:1789711"
     CDS             8193..8627
                     /gene="etpG"
                     /locus_tag="pO157p06"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpG"
                     /protein_id="NP_052612.1"
                     /db_xref="GeneID:1789711"
                     /translation="MRKQHQRGFTLLEIMVVIVILGVLASLVVPNLMGNKDKADRQKV
                     MSDLVALESTLDMYRLDNNRYPTTEQGLRALVSKPTVQPEPRNYRQDGYIRRLPQDPW
                     GGDYQLLNPGQYSDIDIFSPGPDGVPNTEDDIGNWTLGNAQP"
     misc_feature    8211..8603
                     /gene="etpG"
                     /locus_tag="pO157p06"
                     /note="type II secretion system protein G; Region:
                     typeII_sec_gspG; TIGR01710"
                     /db_xref="CDD:130771"
     gene            8624..9178
                     /gene="etpH"
                     /locus_tag="pO157p07"
                     /db_xref="GeneID:1789742"
     CDS             8624..9178
                     /gene="etpH"
                     /locus_tag="pO157p07"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpH"
                     /protein_id="NP_052613.1"
                     /db_xref="GeneID:1789742"
                     /translation="MSQRGFTILEMMLILLLMGITAGLVLMSFPDSAQNHLQQQRERL
                     QAQLDYALDRSQQDGLLMGIQVRFDGWKFKVLQRGTAESPPTLAEGGDIWQGYVWQTW
                     QPRRAAMGGKLPDDVRLELQYLRGLQWMSEHDDGAEPDILLLPGGEVTPFRLLFRQVG
                     EEAVVGLQVDENGLMTLFEGEVSL"
     gene            9193..9540
                     /gene="etpI"
                     /locus_tag="pO157p08"
                     /db_xref="GeneID:1789681"
     CDS             9193..9540
                     /gene="etpI"
                     /locus_tag="pO157p08"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpI"
                     /protein_id="NP_052614.1"
                     /db_xref="GeneID:1789681"
                     /translation="MTLLEVIVALVVFALAGMALMQASTQQAAGIGRMEEKVLAGWLA
                     DNQMVQLQLEKTWPENGWGEKTISFAGTEWYLRWGGPDSDVPQPRSLEVEVRRTKEET
                     SALVSLRSSVVRE"
     misc_feature    9193..>9375
                     /gene="etpI"
                     /locus_tag="pO157p08"
                     /note="Tfp pilus assembly protein PilV [Cell motility,
                     Extracellular structures]; Region: PilV; cl28550"
                     /db_xref="CDD:333370"
     misc_feature    9292..9522
                     /gene="etpI"
                     /locus_tag="pO157p08"
                     /note="Type II secretion system (T2SS), protein I; Region:
                     T2SSI; pfam02501"
                     /db_xref="CDD:426802"
     gene            9537..10136
                     /gene="etpJ"
                     /locus_tag="pO157p09"
                     /db_xref="GeneID:1789730"
     CDS             9537..10136
                     /gene="etpJ"
                     /locus_tag="pO157p09"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EptJ"
                     /protein_id="NP_052615.1"
                     /db_xref="GeneID:1789730"
                     /translation="MSQQRVKGFTLLEMLLALAVFAALSISAFQVLQGGIRAHELSRD
                     KVQRLAELQRGISQMERDLTQMLPRHSRGNEGLLLAAPHLLKSDDWGISFTRNSWLNP
                     AGMLPRPELQWVGYRLRQQKLERLSYFHVDHPSGVSPDVRVMLDGVHAFRLRFFVNGD
                     WQARWDSTGILPQAVEVTLVMDDFAELPRLFLVSKETAE"
     misc_feature    9558..10115
                     /gene="etpJ"
                     /locus_tag="pO157p09"
                     /note="Type II secretion system (T2SS), protein J; Region:
                     T2SSJ; cl42010"
                     /db_xref="CDD:455355"
     gene            10133..11110
                     /gene="etpK"
                     /locus_tag="pO157p10"
                     /db_xref="GeneID:1789734"
     CDS             10133..11110
                     /gene="etpK"
                     /locus_tag="pO157p10"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpK"
                     /protein_id="NP_052616.1"
                     /db_xref="GeneID:1789734"
                     /translation="MKLREQGVALLVVLLILSLMVTIAAVIAERNGRTFLRTVAQLDQ
                     LQAKWDGYTAETIAKQILQRSRQESPRKTHLAQNWAQSERQFETRGGDVRGQIVDAQA
                     CFNLNAINYGVVDLTSIPYAARIFQQLLINLQVELLQARQVTAALRDWIDRDDKPVRG
                     GAEDEVYMGMEPPYLAANQPMQDVSELRLIRGIDARLYRKLLPYVCVLPTSDLSVNVN
                     TLLDSQAPLLAALFLTKPDSLPVTELLQRRPRTGWESVAAFLDAPPLKDIDTSAAMPV
                     LAVSSNYFLVRLHVRSGEHLFSQQTLMQWREERFRIIQRQYGLTMREVP"
     misc_feature    10220..11071
                     /gene="etpK"
                     /locus_tag="pO157p10"
                     /note="Type II secretion system (T2SS), protein K; Region:
                     T2SSK; pfam03934"
                     /db_xref="CDD:427597"
     gene            11473..12321
                     /gene="etpL"
                     /locus_tag="pO157p11"
                     /db_xref="GeneID:1789704"
     CDS             11473..12321
                     /gene="etpL"
                     /locus_tag="pO157p11"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpL"
                     /protein_id="NP_052617.1"
                     /db_xref="GeneID:1789704"
                     /translation="MHRWLAYCGQLGVREVRLLPDVLMLPLATEGWSAVKLAGQWLFR
                     RDRYAGMTVELSWLTHFLSLTAPPVIESYSVPPVPCPGPKTTEWRNQPGRDLLQLVAE
                     GDGYDGADLRQGEFARQGTWYARFRPWRYVAGALLACVFLAGSNAGLAHYRLWQQAQF
                     WRYESVRVYQQLFPSEKAVKDPRRQMLRHLQQSTGNNIPELGSVMRQLQQLLSETSTI
                     RLQALAWDSSSQTLKIDLQAASFQALEHFQQIAGEKYLIQPGEIRQQPQGVESRLILR
                     VNNERA"
     misc_feature    <11473..12300
                     /gene="etpL"
                     /locus_tag="pO157p11"
                     /note="type II secretion system protein L; Region:
                     typeII_sec_gspL; TIGR01709"
                     /db_xref="CDD:273768"
     gene            12308..12820
                     /gene="etpM"
                     /locus_tag="pO157p12"
                     /db_xref="GeneID:1789716"
     CDS             12308..12820
                     /gene="etpM"
                     /locus_tag="pO157p12"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EtpM"
                     /protein_id="NP_052618.1"
                     /db_xref="GeneID:1789716"
                     /translation="MNELKKRLQYVSPRERRLLIGCVALLVVVFVYYVLWQPWLIRED
                     KWRTVVTREKNTVEWMKQQVPNIKRREASMPEQGEPLGLSAAVTRTSAAYGVSVTRLQ
                     PQGERLAVTLAPVEFNALMQWLTQLERRHRIRTMVFDVAAQGNPPGQVTVNRLVLSQD
                     DVNKDASLSR"
     misc_feature    12308..12787
                     /gene="etpM"
                     /locus_tag="pO157p12"
                     /note="Type II secretion system (T2SS), protein M; Region:
                     T2SSM; pfam04612"
                     /db_xref="CDD:428034"
     gene            12995..13711
                     /gene="etpN"
                     /locus_tag="pO157p13"
                     /db_xref="GeneID:1789664"
     CDS             12995..13711
                     /gene="etpN"
                     /locus_tag="pO157p13"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EptN"
                     /protein_id="NP_052619.1"
                     /db_xref="GeneID:1789664"
                     /translation="MLERRWRREALTLLAHSVPESGPAFNLMIPQSHCPCCFHPLGIR
                     DNIPLLSYLFLKGKSRCCGERIPVYYPLVEITNSVLFILAASRFPPGLTLAAAWLFIS
                     MLLVLAVIDCHTALLPDVLTLPLLWLGLLFSLQRGVVTLEEAVVGAVSGYLCLWGLYW
                     LFRFATGREGLGYGDFKLAAALGAWMGWQALPSILLFASVSGLIVTVLLRIVTATDFT
                     RPLPFGPWLALSGVCHFLLM"
     misc_feature    13079..13708
                     /gene="etpN"
                     /locus_tag="pO157p13"
                     /note="Prepilin signal peptidase PulO (type II secretory
                     pathway) or related peptidase [Cell motility,
                     Intracellular trafficking, secretion, and vesicular
                     transport]; Region: PulO; COG1989"
                     /db_xref="CDD:224900"
     gene            13803..14204
                     /gene="etpO"
                     /locus_tag="pO157p14"
                     /db_xref="GeneID:1789743"
     CDS             13803..14204
                     /gene="etpO"
                     /locus_tag="pO157p14"
                     /note="type II secretion pathway related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="EptO"
                     /protein_id="NP_052620.1"
                     /db_xref="GeneID:1789743"
                     /translation="MMGNILKKLNCIASLLVLVTISGCHQSPSIHKQATVPPSEQLEQ
                     MASIVSATRYLKMRCNRSDLPDEQSILNVANRIAIGKGWQSLTQEDIRKHSDDIYVRL
                     TRDSTPEYIKCREFNRRLVPFIGELLARGRG"
     misc_feature    13803..14195
                     /gene="etpO"
                     /locus_tag="pO157p14"
                     /note="lipoprotein, PulS/OutS family; Region: PulS_OutS;
                     TIGR01004"
                     /db_xref="CDD:273390"
     gene            14347..14688
                     /locus_tag="pO157p15"
                     /db_xref="GeneID:1789717"
     CDS             14347..14688
                     /locus_tag="pO157p15"
                     /note="hypothetical 12.7 kDa protein encoded in insertion
                     element IS911; similar to SwissProt accession number
                     P39213"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052621.1"
                     /db_xref="GeneID:1789717"
                     /translation="MICSPQNNTGAPMKKRNFSAEFKRESAQLVVDQNYTVADAAKAM
                     DIGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQRIEMENEILKKATTA
                     LLMSDSLNSSR"
     misc_feature    14407..>14643
                     /locus_tag="pO157p15"
                     /note="IS3 family transposase; Region: transpos_IS3;
                     NF033516"
                     /db_xref="CDD:411153"
     gene            14733..15554
                     /locus_tag="pO157p16"
                     /db_xref="GeneID:1789706"
     CDS             14733..15554
                     /locus_tag="pO157p16"
                     /note="similar to PIR accession number S56510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052622.1"
                     /db_xref="GeneID:1789706"
                     /translation="MFGVHRSSYRYWKNRPEKPDGRRVVLRSQVLELHNISHGSAGAR
                     SIATMATLRGFRMGRWLAGRLMKELGLVSCQQPAHRYKRGGREHVTIPNHLGRQFAVT
                     EPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTIKALKMAWEIR
                     SKPAGVMFHSDQGSHYTSRQFRQLLWRYQIKQSLSRRGNCWDNSPMERFFRSLKNEWI
                     PVTGYMNFSDAAHEITDYIVGYYNALRPHEYNGGLPPNESENRYWKNSKAVASFC"
     misc_feature    14736..15533
                     /locus_tag="pO157p16"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            16119..16610
                     /gene="hlyC"
                     /locus_tag="pO157p17"
                     /db_xref="GeneID:1789689"
     CDS             16119..16610
                     /gene="hlyC"
                     /locus_tag="pO157p17"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin C"
                     /protein_id="NP_052623.1"
                     /db_xref="GeneID:1789689"
                     /translation="MGKVAWLWACSPLHKKWPLSVFAINVIPAIQTNQFALLIKDELP
                     VAFCSWASLDLECEVKYINDVTSLYAKDWMSGERKWFIDWIAPFGHNMELYKYMRKKY
                     PYELFRAIRLDESSKTGKIAEFHGGGIDKKLASKIFRQYHHELMSEVKNRQDFNFNIE
                     KEN"
     misc_feature    16119..16490
                     /gene="hlyC"
                     /locus_tag="pO157p17"
                     /note="RTX toxin acyltransferase family; Region: HlyC;
                     cl01131"
                     /db_xref="CDD:445284"
     gene            16612..19608
                     /gene="hlyA"
                     /locus_tag="pO157p18"
                     /db_xref="GeneID:1789686"
     CDS             16612..19608
                     /gene="hlyA"
                     /locus_tag="pO157p18"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin A"
                     /protein_id="NP_052624.1"
                     /db_xref="GeneID:1789686"
                     /translation="MTVNKIKNIFNNATLTTKSAFNTASSSVRSAGKKLILLIPDNYE
                     AQGVGINELVKAADELGIEIHRTERDDTAIANQFFGAAEKVVGLTERGVAIFAPQLDK
                     LLQKYQKVGSKIGGTAENVGNNLGKAGTVLSALQNFTGIALSGMALDELLRKQREGED
                     ISQNDIAKSSIELINQLVDTVSSINSTVDSFSEQLNQLGSFLSSKPRLSSVGGKLQNL
                     PDLGPLGDGLDVVSGILSAVSASFILGNSDAHTGTKAAAGIELTTQVLGNVGKAVSQY
                     ILAQRMAQGLSTTAASAGLITSAVMLAISPLSFLAAADKFERAKQLESYSERFKKLNY
                     EGDALLAAFHKETGAIDAALTTINTVLSSVSAGVSAASSASLIGAPISMLVSALTGTI
                     SGILEASKQAMFEHVAEKFAARINEWEKEHGKNYFENGYDARHAAFLEDSLSLLADFS
                     RQHAVERAVAITQQHWDEKIGELAGITRNADRSQSGKAYINYLENGGLLEAQPKEFTQ
                     QVFDPQKGTIDLSTGNVSSVLTFITPTFTPGEEVRERKQSGKYEYMTSLIVNGKDTWS
                     VKGIKNHKGVYDYSKLIQFVEKNNKHYQARIISELGDKDDVVYSGAGSSEVFAGEGYD
                     TVSYNKTDVGKLTIDATGASKPGEYIVSKNMYGDVKVLQEVVKEQEVSVGKRTEKIQY
                     RDFEFRTGGIPYDVIDNLHSVEELIGGKHDDEFKGGKFNDIFHGADGNDYIEGNYGND
                     RLYGDDGDDYISGGQGDDQLFGGSGNDKLSGGDGNNYLTGGSGNDELQAHGAYNILSG
                     GTGDDKLYGGGGIDLLDGGEGNDYLNGGFGNDIYVYGQNYGHHTIADEGGKGDRLHLS
                     DISFDDIAFKRVGNDLIMNKAINGVLSFNESNDVNGITFKNWFAKDASGADNHLVEVI
                     TDKDGREIKVDKIPHNNNERSGYIKASNIASEKNMVNITSVANDINKIISSVSGFDSG
                     DERLASLYNLSLHQNNTHSTTLTTTV"
     misc_feature    16615..19605
                     /gene="hlyA"
                     /locus_tag="pO157p18"
                     /note="enterohemolysin EhxA; Region: entero_EhxA;
                     NF033203"
                     /db_xref="CDD:380205"
     gene            19658..21778
                     /gene="hlyB"
                     /locus_tag="pO157p19"
                     /db_xref="GeneID:1789727"
     CDS             19658..21778
                     /gene="hlyB"
                     /locus_tag="pO157p19"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin B"
                     /protein_id="NP_052625.1"
                     /db_xref="GeneID:1789727"
                     /translation="MMSKCSSHNSLYALILLAQYHNITVNAETIRHQYNTHTQDFGVT
                     EWLLAAKSIGLKAKYVEKHFSRLSIISLPALIWRDDGKHYILSRITKDSSRYLVYDPE
                     QHQSLTFSRDEFEKLYQGKVILVTSRATVVGELAKFDFSWFIPSVVKYRRILLEVLTV
                     SAFIQFLALITPLFFQVVMDKVLVHRGFSTLNIITIAFIIVILFEVILTGARTYIFSH
                     TTSRIDVELGAKLFRHLLALPVSYFENRRVGETVARVRELEQIRNFLTGQALTSVLDL
                     FFSVIFFCVMWYYSPQLTLVILLSLPCYVIWSLFISPLLRRRLDDKFLRNAENQAFLV
                     ETVTAINTIKSMAVSPQMIATWDKQLAGYVASSFRVNLVAMTGQQGIQLIQKSVMVIS
                     LWMGAHLVISGEISIGQLIAFNMLAGQVIAPVIRLAHLWQDFQQVGISVERLGDVLNT
                     PVEKKSGRNILPEIQGDIEFKNVRFRYSSDGNVILNNINLYISKGDVIGIVGRSGSGK
                     STLTKLLQRFYIPETGQILIDGHDLSLADPEWLRRQIGVVLQENILLNRSIIDNITLA
                     SPAVSMEQAIEAARLAGAHDFIRELKEGYNTIVGEQGVGLSGGQRQRIAIARALVTNP
                     RILIFDEATSALDYESENIIMKNMSRICKNRTVIIIAHRLSTVKNANRIIVMDNGFIS
                     EDGTHKELISKKDSLYAYLYQLQA"
     misc_feature    19688..21772
                     /gene="hlyB"
                     /locus_tag="pO157p19"
                     /note="type I secretion system ABC transporter, HlyB
                     family; Region: type_I_sec_HlyB; TIGR01846"
                     /db_xref="CDD:273831"
     gene            21782..23221
                     /gene="hlyD"
                     /locus_tag="pO157p20"
                     /db_xref="GeneID:1789705"
     CDS             21782..23221
                     /gene="hlyD"
                     /locus_tag="pO157p20"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="NP_052626.1"
                     /db_xref="GeneID:1789705"
                     /translation="MRFYMKGLWDLVCRYKTVFSDVWKIRHTLDAPVREKDEYAFLPA
                     HLELIETPVSRRSHFVVWSILLFVIISLLLSVLGKVEVVSVANGKFTHSGRSKEIKPI
                     ENAIVEKIMVKDGSFVKKNDPLVELTVPGVESDILKSEASLLYEKTEQYRYAILSESI
                     QRNELPEIRITDFPGGEDNAGGEHFQRVSSLIKEQFMTWQNRKNQKQLTLNKKIVERD
                     AALARVSLYEHQVSQEGRKLNDFKYLLNKKAVSQHSVMEQENSYIQAKNEHAVWLAQV
                     SQLEKEIELVREELALETNIFRSEIIEKHRKSTDNIVLLEHELEKNRQRKASSFIKAP
                     VSGTVQELNIHTEGGVVTTAETLMIIVPDNDILEVTASVLNKDIGFIQPGQEVVIKVD
                     AYPYTRHGYLTGKVKNITADSVSVPDTGLVFNVIISVDRNDIQGERKKIPVTAGMTVM
                     AEIKTGVRSVISYLLSPLKETINESLRER"
     misc_feature    21941..23218
                     /gene="hlyD"
                     /locus_tag="pO157p20"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     gene            23288..23482
                     /locus_tag="ECp021.1n"
                     /db_xref="GeneID:2717077"
     CDS             23288..23482
                     /locus_tag="ECp021.1n"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958720.1"
                     /db_xref="GeneID:2717077"
                     /translation="MLFKQTMIQFLSLKIVNGMDSIKLLDKVIIYQQQNEQLYPAQEH
                     LLLQLCMRVTKKLTDILMPP"
     gene            23512..23796
                     /gene="papX"
                     /locus_tag="pO157p21"
                     /db_xref="GeneID:1789696"
     CDS             23512..23796
                     /gene="papX"
                     /locus_tag="pO157p21"
                     /note="similar to SwissProt accession number P42193"
                     /codon_start=1
                     /transl_table=11
                     /product="PapX"
                     /protein_id="NP_052627.1"
                     /db_xref="GeneID:1789696"
                     /translation="MLLALLSSTDNFCLSSTELSERLDVSRTYITRACDSLEKFGFIK
                     RMESKEDRRSKNIYLTSDGNLYLQRTTRIYGRYLKKYGATLQMMKSKHLK"
     misc_feature    23512..23754
                     /gene="papX"
                     /locus_tag="pO157p21"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:451250"
     gene            23965..24195
                     /locus_tag="ECp023"
                     /db_xref="GeneID:2717075"
     CDS             23965..24195
                     /locus_tag="ECp023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958721.1"
                     /db_xref="GeneID:2717075"
                     /translation="MWILNVFQVHKSVRIYIAHFSVFNCHLHPSIDRSLASWHYPNSP
                     KNGKPALSPRHDWLNTGSLLQNVPLRIWFYPQ"
     gene            24316..25056
                     /locus_tag="pO157p22"
                     /db_xref="GeneID:1789708"
     CDS             24316..25056
                     /locus_tag="pO157p22"
                     /note="probable site-specific recombinase in AFA region;
                     similar to SwissProt accession number Q47036"
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="NP_052628.1"
                     /db_xref="GeneID:1789708"
                     /translation="MNNVIPLQNSPERVFLLPIAPGVDFATALSLRRMATSTGATPAY
                     LLAPEVSALLFYMPDQRHHMLFATLWNTGMRIGEARMLTPESFDLDGARPFVRILSEK
                     VRARRGRPPKDEVRLVPLTDISYVRQMESWMITTRPRRREPLWAVTDETMRNWLKQAV
                     RRAEADGVHFSIPVTPHTFRHSYIMHMLYHRQPRKVIQALAGHRDPRSMEVYTRVFAL
                     DMAATLAVPFTGDGRDAAEILRTLPPLR"
     misc_feature    24445..24966
                     /locus_tag="pO157p22"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain; Region: DNA_BRE_C; cl00213"
                     /db_xref="CDD:444754"
     misc_feature    order(24496..24498,24538..24543,24778..24780,24784..24786,
                     24844..24846,24949..24951)
                     /locus_tag="pO157p22"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    order(24538..24540,24844..24846,24853..24855,24922..24924,
                     24949..24951)
                     /locus_tag="pO157p22"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            complement(24745..25062)
                     /locus_tag="pO157p23"
                     /db_xref="GeneID:1789668"
     CDS             complement(24745..25062)
                     /locus_tag="pO157p23"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052629.1"
                     /db_xref="GeneID:1789668"
                     /translation="MPSPQGRQCTQDLRSIPPVTCERHCQRGSHIQRKHSGINLHRTW
                     IPVTCQGLDDFPGLAVIEHMHDIAVPEGVWCDRNRKVYSVSFGPSDSLLQPVAHGFVG
                     HGP"
     gene            complement(25341..26318)
                     /gene="repFIB"
                     /locus_tag="pO157p24"
                     /db_xref="GeneID:1789691"
     CDS             complement(25341..26318)
                     /gene="repFIB"
                     /locus_tag="pO157p24"
                     /note="replication protein RepFIB (P307 replicon); similar
                     to PIR accession number A32310"
                     /codon_start=1
                     /transl_table=11
                     /product="RepFIB"
                     /protein_id="NP_052630.2"
                     /db_xref="GeneID:1789691"
                     /translation="MDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNT
                     LSRTDATEELTRLSLARAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVE
                     LPFVEFAKLCGIPSSQSSRRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSA
                     YYDTERDIVQLQADPRLFELYQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPA
                     PVSLARLRARLNLKSPVFSQNQTVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPR
                     LKAPNDESKENPLPPSPAEKVSPEMAEKLALLEKLGITLDDLEKLFKSR"
     gene            26056..26385
                     /locus_tag="pO157p25"
                     /db_xref="GeneID:1789679"
     CDS             26056..26385
                     /locus_tag="pO157p25"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052631.1"
                     /db_xref="GeneID:1789679"
                     /translation="MIPTQVLKSLSISRRGPVISTLSNPSARARERRVSSSVASVRDS
                     VFFLLFFSDLRVGTKTPRRISATGCTVLLLFGVSVTSSPDDLSTSPNSFLMSEFSFSR
                     KPPACGQ"
     gene            complement(26726..26926)
                     /locus_tag="ECp025.2n"
                     /db_xref="GeneID:2717076"
     CDS             complement(26726..26926)
                     /locus_tag="ECp025.2n"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958722.1"
                     /db_xref="GeneID:2717076"
                     /translation="MKIYHYTDLNGLKGIIESGSLWATHFSFLNDSNELTHGMNCLEN
                     ALQYLRDDFNPKTLKFIEQAPL"
     gene            complement(26923..27543)
                     /locus_tag="pO157p26"
                     /db_xref="GeneID:1789739"
     CDS             complement(26923..27543)
                     /locus_tag="pO157p26"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052632.1"
                     /db_xref="GeneID:1789739"
                     /translation="MRQERVLRIKAFRRALELGGGERADGCRHFPRWKTELRNFPHSS
                     CDLASNTLAYYLKERERCHPCIIFMEGNAGFHEAENSTVHGHVIVLLDGEYIDLTLDQ
                     FDEYPDYIPYEPVESDGQIGKLLRNIMKHEDPVKTRQIDLDGGEELYAWLRDTADEVL
                     AADPEWQARERSIEEAREAAITVFPFLSDVQKTECEQGPDSQEAAR"
     gene            complement(27540..28223)
                     /locus_tag="pO157p27"
                     /db_xref="GeneID:1789712"
     CDS             complement(27540..28223)
                     /locus_tag="pO157p27"
                     /codon_start=1
                     /transl_table=11
                     /product="KfrAs"
                     /protein_id="NP_052633.1"
                     /db_xref="GeneID:1789712"
                     /translation="MYELYCMYCVFFIPGIRWRHSLRNRSQTMTSLSPDTVRRIEDAA
                     AALIAAGTPNPTNEQVRQHLGGGSLSHISPVMRAFRARQREQATPLPPELAQLLTGQL
                     GLLWQAAVKQAEAGALAAREQADDDIARADKERDEALANVAALESELAVLREVVAERD
                     RLLQEVRELRAEALPLREQVARLTATGEHLAAQLQDTKAELKEAREDGRQLQTELLAL
                     ARQDGKVKK"
     misc_feature    complement(27777..28064)
                     /locus_tag="pO157p27"
                     /note="Plasmid replication region DNA-binding N-term;
                     Region: KfrA_N; pfam11740"
                     /db_xref="CDD:432038"
     misc_feature    complement(<27558..>27863)
                     /locus_tag="pO157p27"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:274008"
     gene            28682..28900
                     /gene="letA"
                     /locus_tag="pO157p28"
                     /db_xref="GeneID:1789714"
     CDS             28682..28900
                     /gene="letA"
                     /locus_tag="pO157p28"
                     /note="CcdA protein; protein H; LynA; similar to SwissProt
                     accession number P05702"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein CcdA"
                     /protein_id="NP_052634.1"
                     /db_xref="GeneID:1789714"
                     /translation="MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERW
                     KAENQEGMAEVARFIEMNGSFADENRDW"
     misc_feature    28682..28897
                     /gene="letA"
                     /locus_tag="pO157p28"
                     /note="type II toxin-antitoxin system antitoxin CcdA;
                     Region: PRK13710"
                     /db_xref="CDD:184266"
     gene            28902..29207
                     /gene="letB"
                     /locus_tag="pO157p29"
                     /db_xref="GeneID:1789728"
     CDS             28902..29207
                     /gene="letB"
                     /locus_tag="pO157p29"
                     /note="cytotoxic protein; controlled cell death protein;
                     post-segregation toxin; toxin addiction system"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein CcdB"
                     /protein_id="NP_052635.1"
                     /db_xref="GeneID:1789728"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSD
                     KVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     misc_feature    28902..29204
                     /gene="letB"
                     /locus_tag="pO157p29"
                     /note="type II toxin-antitoxin system toxin CcdB; Region:
                     PRK13708"
                     /db_xref="CDD:184264"
     gene            29208..30014
                     /locus_tag="pO157p30"
                     /db_xref="GeneID:1789694"
     CDS             29208..30014
                     /locus_tag="pO157p30"
                     /note="Protein D;
                     similar to SwissProt accession number P06615"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="NP_052636.1"
                     /db_xref="GeneID:1789694"
                     /translation="MSGSVIHSQSAVMVPAVYSAGQPASLPVAIDYPAALALRQMSMV
                     HDELPKYLLAPEVSALLHYVPNLHRKMLLATLWNTGARINEALALTRGDFSLAPPYPF
                     VQLATLKQRTEKAARTAGRMPAGQQTHRLVPLSDSWYVSQLQTMVATLKIPMERRNRR
                     TGRTEKARIWEVTDRTVRTWIGEAVAAAAADGVTFSVPVTPHTFRHSYAMHMLYAGIP
                     LKVLQSLMGHKSISSKEVYTKVFALDVAARHRVQFAMPESDAVAMLKQLS"
     misc_feature    29358..29933
                     /locus_tag="pO157p30"
                     /note="Phage integrase family; Region: Phage_integrase;
                     pfam00589"
                     /db_xref="CDD:395471"
     misc_feature    order(29409..29411,29451..29456,29733..29735,29739..29741,
                     29811..29813,29916..29918)
                     /locus_tag="pO157p30"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    order(29451..29453,29811..29813,29820..29822,29889..29891,
                     29916..29918)
                     /locus_tag="pO157p30"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            complement(30736..31949)
                     /locus_tag="pO157p31"
                     /db_xref="GeneID:1789677"
     CDS             complement(30736..31626)
                     /locus_tag="pO157p31"
                     /note="similar to SwissProt accession number P16942;
                     transposase encoded in insertion sequence IS629"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_052637.1"
                     /db_xref="GeneID:1789677"
                     /translation="MMPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSAR
                     AQHDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRG
                     KKVRTTISRKAVAAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGYI
                     VGWRVSSSMETTFVLDALEQALWARRPSGTIHHSDKGSQYVSLAYTERLKEAGLLAST
                     GSTGDSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHT
                     PPAEAEKAYYASIGNDDLAA"
     misc_feature    complement(30739..31566)
                     /locus_tag="pO157p31"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            complement(31623..31949)
                     /locus_tag="pO157p83"
                     /db_xref="GeneID:3399562"
     CDS             complement(31623..31949)
                     /locus_tag="pO157p83"
                     /note="hypothetical 12 kDa protein encoded in insertion
                     sequence IS629; similar to SwissProt accession number
                     P16941"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052638.1"
                     /db_xref="GeneID:3399562"
                     /translation="MTKNTRFSPEVRQRAIRMVLESQDEYDSQWAAICSIAPKIGCTP
                     ETLRVWVRQHERDTGGGDGGLTSAERQRLKELERENRELRRSNDILRQASAYFAKAEF
                     DRLWKK"
     misc_feature    complement(<31647..31922)
                     /locus_tag="pO157p83"
                     /note="IS3 family transposase; Region: transpos_IS3;
                     NF033516"
                     /db_xref="CDD:411153"
     misc_feature    32004..32249
                     /note="similar to Rep protein"
     gene            32837..34003
                     /gene="sopA"
                     /locus_tag="pO157p33"
                     /db_xref="GeneID:1789690"
     CDS             32837..34003
                     /gene="sopA"
                     /locus_tag="pO157p33"
                     /note="Protein A; similar to SwissProt accession number
                     P08866"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-partitioning protein SopA"
                     /protein_id="NP_052640.1"
                     /db_xref="GeneID:1789690"
                     /translation="MKLMETLNQCINAGHEMTKAIAIAQFNDDSPEARKITRRWRIGE
                     AADLVGVSSQAIRDAEKAGRLPHPDMEIRGRVEQRVGYTIEQINHMRDVFGTRLRRAE
                     DVFPPVIGVAAHKGGVYKTSVSVHLAQDLALKGLRVLLVEGNDPQGTASMYHGWVPDL
                     HIHAEDTLLPFYLGEKDDVTYAIKPTCWPGLDIIPSCLALHRIETELMGKFDEGKLPT
                     DPHLMLRLAIETVAHDYDVIVIDSAPNLGIGTINVVCAADVLIVPTPAELFDYTSALQ
                     FFDMLRDLLKNVDLKGFEPDVRILLTKYSNSNGSQSPWMEEQIRDAWGSMVLKNVVRE
                     TDEVGKGQIRMRTVFEQAIDQRSSTGAWRNALSIWEPVCNEIFDRLIKPRWEIR"
     misc_feature    32837..34000
                     /gene="sopA"
                     /locus_tag="pO157p33"
                     /note="plasmid-partitioning protein SopA; Provisional;
                     Region: PRK13705"
                     /db_xref="CDD:184261"
     gene            34003..34974
                     /gene="sopB"
                     /locus_tag="pO157p34"
                     /db_xref="GeneID:1789685"
     CDS             34003..34974
                     /gene="sopB"
                     /locus_tag="pO157p34"
                     /note="SopB"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-partitioning protein"
                     /protein_id="NP_052641.1"
                     /db_xref="GeneID:1789685"
                     /translation="MKRAPVIPKHTLNTQPVEDTSLSTPAAPMVDSLIARVGVMARGN
                     AITLPVCGRDVKFTLEVLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQ
                     TPAFGRRVSGVIEIADGSRRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSA
                     YERGQRYASRLQNEFAGNISALADAENISRKIITRCINTAKLPKSVVALFSHPGELSA
                     RSGDALQKAFTDKEELLKQQASNLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLS
                     SRHQFAPGATVLYKGDKMVLNLDRSRVPTECIEKIEAILKELEKPAP"
     misc_feature    34003..34971
                     /gene="sopB"
                     /locus_tag="pO157p34"
                     /note="ParB/RepB/Spo0J family plasmid partition protein;
                     Region: PRK13698"
                     /db_xref="CDD:184254"
     gene            36274..37998
                     /locus_tag="pO157p35"
                     /db_xref="GeneID:1789698"
     CDS             36274..37998
                     /locus_tag="pO157p35"
                     /note="similar to SwissProt accession number P19593"
                     /codon_start=1
                     /transl_table=11
                     /product="reverse transcriptase"
                     /protein_id="NP_052642.1"
                     /db_xref="GeneID:1789698"
                     /translation="MTEQATTCKGASLLNGDSWHSINWRQCYREVRRLQARIVKATRE
                     GKHGKVKSLQWILTHSFSGRAVAVRRVTENSGKRTPGVDGQTWSSPEVKFLAINLLKR
                     RGYKPQPLKRVYIPKSNGKSRPLGIPTMKDRAMQALYLLALEPVAEVTADQRSFGFRT
                     GRSTADAIAQCFCVLAQKTSAEWVLEGDIRGCFDNISHQWLIDNTSTDRQILTKWLKA
                     GYREKGQLFPVNSGTPQGGIISPVLANIALDGLEALLASEFKKRTVKGRLVNPKVNYV
                     RYADDFIITGESKELLESQVLPVVRRFMAERGLMLSPEKTKITHIEEGFDFLGQNIRK
                     YGGKMLIKPSKANVSSFLKKIRAVIKGNKAMDQLTLIRMLNPMIKGWAAYHQHIVAKV
                     AFNKVDNEIWLALWRWAVRRHPNKGKKWIRKRYFHQQGARNWSFSTATGELLANGKPQ
                     YANLRKAIDTPINRFKPIKIAANPFDPQWEMYFEERCADKMRHKLQGRKKLIQIWFEQ
                     RGRCPICDERITSDSQWQVHHIIRRVDGGSNCLSNLIMLHPMCHTLVHAKGIHVVKPA
                     HESGLRKA"
     misc_feature    36328..36573
                     /locus_tag="pO157p35"
                     /note="N-terminal domain of reverse transcriptase; Region:
                     RVT_N; pfam13655"
                     /db_xref="CDD:433382"
     misc_feature    36472..37512
                     /locus_tag="pO157p35"
                     /note="group II intron reverse transcriptase/maturase;
                     Region: group_II_RT_mat; TIGR04416"
                     /db_xref="CDD:275209"
     misc_feature    order(36835..36852,36976..36981,37105..37107,37111..37116,
                     37255..37260)
                     /locus_tag="pO157p35"
                     /note="putative active site [active]"
                     /db_xref="CDD:238828"
     misc_feature    order(36835..36852,36976..36978,37111..37113)
                     /locus_tag="pO157p35"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238828"
     misc_feature    36979..36981
                     /locus_tag="pO157p35"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238828"
     misc_feature    37636..37995
                     /locus_tag="pO157p35"
                     /note="5-methylcytosine-specific restriction endonuclease
                     McrA [Defense mechanisms]; Region: McrA; COG1403"
                     /db_xref="CDD:224321"
     misc_feature    37768..37941
                     /locus_tag="pO157p35"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    order(37849..37851,37855..37863,37867..37869,37900..37905,
                     37915..37920,37927..37929,37939..37941)
                     /locus_tag="pO157p35"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            38075..38977
                     /locus_tag="pO157p36"
                     /db_xref="GeneID:1789718"
     CDS             38075..38977
                     /locus_tag="pO157p36"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052643.1"
                     /db_xref="GeneID:1789718"
                     /translation="MYFSGEPAQIAEIKRLASGAVTPLYRRATNEGIQLFLAGSAGLL
                     QTTEDVRFEPCPGLTAAGRGVVSPENIAFTRWLTHLQDGVLLDEQNCLMLHELWLQSG
                     TGRRRWEELPDDARESITALFTPKRGDWCDIWSNEDVSVWWNRLCDNVLPEKTMPFDL
                     LTVLSTRLDVEVNGFNGGVLNGVPSAYHWYTEQYGVKWPCGYEVNISSQGDNFIQVDF
                     DTPWCQPESDVIAVLSRRFSCMLEHWYAGQGCNFCGWQRYERGELVDVLWGELEWSSP
                     TDDDELPEVTAPEWIVDKVAHYGG"
     misc_feature    38141..38671
                     /locus_tag="pO157p36"
                     /note="Protein of unknown function (DUF1281); Region:
                     DUF1281; pfam06924"
                     /db_xref="CDD:429194"
     misc_feature    38675..38917
                     /locus_tag="pO157p36"
                     /note="Ferredoxin-like domain in Api92-like protein;
                     Region: DUF1281_C; pfam18406"
                     /db_xref="CDD:436475"
     gene            38981..39286
                     /locus_tag="pO157p37"
                     /db_xref="GeneID:1789693"
     CDS             38981..39286
                     /locus_tag="pO157p37"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052644.1"
                     /db_xref="GeneID:1789693"
                     /translation="MTETGGQPPVSFPVKDVAGLLFLLRRLTRRGRNAACGQCPASGR
                     ARDGRFYRSRLASVTVYASPSPFSDERPSSRFRGIFSPSKRRRLRYSTVGLTRYRTR"
     gene            39363..40046
                     /locus_tag="pO157p38"
                     /db_xref="GeneID:1789670"
     CDS             39363..40046
                     /locus_tag="pO157p38"
                     /note="similar to PIR accession number S18997"
                     /codon_start=1
                     /transl_table=11
                     /product="putative methylase"
                     /protein_id="NP_052645.1"
                     /db_xref="GeneID:1789670"
                     /translation="MSRFIQGDCVRVMATIPGNGVDFILTDPPYLVGFRDRQGRTIAG
                     DKTDEWLQPACNEMYRVLKKDALMVSFYGWNRVDRFMAAWKNAGFSVVGHLVFTKTYT
                     SKAAYVGYRHECAYILAKGRPALPQKPLPDVLGWKYSGNRHHPTEKPVTSLQPLIESF
                     THPNAIVLDPFAGSGSTCVAALQSGRRYIGIELLEQYHRAGQQRLAAVQRAMQQGAAN
                     DDWFMPEAA"
     misc_feature    39363..40043
                     /locus_tag="pO157p38"
                     /note="putative methylase; Provisional; Region: PRK13699"
                     /db_xref="CDD:184255"
     gene            40047..40268
                     /locus_tag="ECp042"
                     /db_xref="GeneID:2717073"
     CDS             40047..40268
                     /locus_tag="ECp042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958723.1"
                     /db_xref="GeneID:2717073"
                     /translation="MNYAGHEKLRADVAEVANTMCDLRARLNDMEHRCRFDSDVLVER
                     LARQTLYRANRLFMEAYTEILELDACFKD"
     gene            40162..40716
                     /locus_tag="pO157p39"
                     /db_xref="GeneID:1789700"
     CDS             40162..40716
                     /locus_tag="pO157p39"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052646.1"
                     /db_xref="GeneID:1789700"
                     /translation="MCLLNAWHARRCIAPIACSWRRIPKFWNWMRALKIEKETRMYGT
                     CETLCRELAAKYPGYTPLMLVIWSPEEIQALADGMDISLSDPEIRTVLARLEDIPEDQ
                     RIESGISSAAAMEIISNVSENRQVTVPAELLASLIQTAEQALWKREWAARDYGLAVPE
                     CVTRRQAVVNQARILLKNNTHENG"
     misc_feature    40282..40689
                     /locus_tag="pO157p39"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:429307"
     gene            40762..41538
                     /locus_tag="pO157p40"
                     /db_xref="GeneID:1789709"
     CDS             40762..41538
                     /locus_tag="pO157p40"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052647.1"
                     /db_xref="GeneID:1789709"
                     /translation="MNENTTLNALICRHARNLLLAQGWPEETDVDQRNPKYPGWISIY
                     VLLDAPRLATLLVNRHGGVLPPHLASAIQKLTGTGAELVLSGSQWQSLPVLPADGTQV
                     SFPYAGEWLTEDEIRAVLAAVRDAVRSVSCRVAEDTRRIRAALTTTGQTLLTRQTRRF
                     RLVVKESDHPCWLDEDDENLPVVLDAILNRGARFSAVEMYLVSDCIEHILSSGLACDV
                     LRIPDEPPRRWFDRGVLREVVREARNEIRSMADALAKIRK"
     gene            41411..41983
                     /locus_tag="pO157p41"
                     /db_xref="GeneID:1789736"
     CDS             41411..41983
                     /locus_tag="pO157p41"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052648.1"
                     /db_xref="GeneID:1789736"
                     /translation="MCCVYRMNRPAGGLTVVFCGRWSGKPGTKSAAWRMPWQKSGNDD
                     VGGVNPRLFPAGPRTEHKGSRRWLRFTRPCRAWPCGFSVMWPQRRVRAVPCLHLSRAG
                     VDARVRFAAAVTRSLLPVCRDFPVVRPLRFRGLTLQLPSAVCVRLRLPLRPVHPRLIA
                     RLFWRHGTARCRGICEQRRKTSCNMRNLSL"
     gene            42079..42381
                     /gene="klcA"
                     /locus_tag="pO157p42"
                     /db_xref="GeneID:1789678"
     CDS             42079..42381
                     /gene="klcA"
                     /locus_tag="pO157p42"
                     /note="antirestriction protein; similar to SwissProt
                     accession number P52603"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052649.1"
                     /db_xref="GeneID:1789678"
                     /translation="MMPEYQGGFWHFIRLPDGGGYMMPDGDRFHMVNGANWFDRTVSA
                     DACGIILTSLVINRQLWLYHDSGDAGLTQLYRMRDAQLWRHIEFHPECNAIYAALD"
     misc_feature    42085..42378
                     /gene="klcA"
                     /locus_tag="pO157p42"
                     /note="Antirestriction protein; Region: Antirestrict;
                     pfam03230"
                     /db_xref="CDD:397370"
     gene            42428..42850
                     /locus_tag="pO157p43"
                     /db_xref="GeneID:1789683"
     CDS             42428..42850
                     /locus_tag="pO157p43"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052650.1"
                     /db_xref="GeneID:1789683"
                     /translation="MYCTVKEIIRDVLDTDVPDSECVFAVVLTRGDVRHIAQDWNLSD
                     DELETVMQRLDDAFEYGADVSIVHDVVRELMEEKRASRQVTVPAVMLEKVMALAGSEM
                     KRLYAVGSENGGDGDAFVREEREAMDVVLQALDGEHMS"
     misc_feature    42428..>42721
                     /locus_tag="pO157p43"
                     /note="Protein of unknown function (DUF1380); Region:
                     DUF1380; pfam07128"
                     /db_xref="CDD:399840"
     gene            43157..43546
                     /locus_tag="pO157p44"
                     /db_xref="GeneID:1789726"
     CDS             43157..43546
                     /locus_tag="pO157p44"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052651.1"
                     /db_xref="GeneID:1789726"
                     /translation="MCPECFFLMLFFCGYRACYCSSSFSSSSSSSSFRSSPAYGFSGR
                     PPGGAGCRERSQRSCLRPGGLPSLTRNPGLQRPFRSRSLCRAVACAPGIPAKGRRDVR
                     GNAVSQTALHVVAAGPCSLPAGCHTPV"
     gene            44034..44264
                     /locus_tag="pO157p45"
                     /db_xref="GeneID:1789665"
     CDS             44034..44264
                     /locus_tag="pO157p45"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052652.1"
                     /db_xref="GeneID:1789665"
                     /translation="MTVSIVSPSAAAVKPRRHPRFRREDIPAPEIDPVLKAFGRHIAR
                     SFHRGRGVHIPAMKNTAFGQVLRTLELKRAFN"
     gene            44316..45677
                     /locus_tag="pO157p46"
                     /db_xref="GeneID:1789741"
     CDS             44316..45677
                     /locus_tag="pO157p46"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052653.1"
                     /db_xref="GeneID:1789741"
                     /translation="MTSAAITMTAPEAASPVQMYRATYSPDDNKLRLYAVSRLDPETY
                     KKVHDAGFRWAPKQALFVAPAWTPGREDVLLSLAGEIEDEDSTLAERQEARAERFTGY
                     SGKRASESAQALDEVERLAAMIPPGQPILVGHHSERRARRDAQRIENGMKRAVMLFER
                     AEYWEERGRSALLHAKYKERPDVRWRRIKKIEADLRKAEKTIAQSQKYLTMWRAESLD
                     LNMAKLISSHDHISACFPLDTYPRPAEKSQYEGSRSLWSALDDDIITTEQAREIAIRC
                     HERQIQHQQRWVNHYQNRLNYERAMLDESGGVVTRTQDFEPGGQVFSRGEWLTIIRVN
                     KSNGAVSSVTTPNYSFLGYSGTMKVTPDRITDYKAPSAEEAAVASQAAKRPPVVNYPG
                     EGFREMTKAQWAALPRDCKAVRSVAEAEDHGAYRYRRTMDNNFRLVNVYITDMKITEI
                     PQK"
     misc_feature    44583..44942
                     /locus_tag="pO157p46"
                     /note="Domain of unknown function (DUF3560); Region:
                     DUF3560; pfam12083"
                     /db_xref="CDD:432317"
     gene            45724..46287
                     /locus_tag="pO157p47"
                     /db_xref="GeneID:1789684"
     CDS             45724..46287
                     /locus_tag="pO157p47"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052654.1"
                     /db_xref="GeneID:1789684"
                     /translation="MHSQLKERIRLMRARLDNAAPVAEIRAESQLFVTPAPVCDRLVT
                     LAEISNRDHILEPSAGTGAILRAIRDTAPEAMCDAVEINSGLVRYLRENFNGVRVQCG
                     DFMEWQPVQYYSRVIINPPFSHGQDIRHILRAFSLLRPGGVLVAVCLNGPRQQEKLLP
                     FSDVREELPRGTFAYTDVPTMIIRLRA"
     misc_feature    45883..46170
                     /locus_tag="pO157p47"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(45892..45912,45964..45969,46027..46035,46078..46080)
                     /locus_tag="pO157p47"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(46373..46828)
                     /locus_tag="pO157p48"
                     /db_xref="GeneID:1789721"
     CDS             complement(46373..46828)
                     /locus_tag="pO157p48"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052655.1"
                     /db_xref="GeneID:1789721"
                     /translation="MAPDTTTGRHPPQRREARFAKRRCPLHPGGLLPGCRERRPRRDR
                     GGATGTVAASPGFASGMEARQGGDSSAGSVHDSPPRQGDARKRHKQENNKTDSNQSSR
                     KKKNSSSSSSSSSSSSSSMNNNIISNRQMTGLKRQKPTAECPRNVRGGA"
     gene            47130..47582
                     /gene="ssb"
                     /locus_tag="pO157p49"
                     /db_xref="GeneID:1789738"
     CDS             47130..47582
                     /gene="ssb"
                     /locus_tag="pO157p49"
                     /note="similar to SwissProt accession number P18310;
                     helix-destabilizing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="NP_052656.1"
                     /db_xref="GeneID:1789738"
                     /translation="MAVRGINKVILVGRLGKDPEVRYIPNGGAVANLQVATSESWRDK
                     QTGEMREQTEWHRVVLFGKLAEVAGEYLRKGAQVYIEGQLRTRSWEDNGITRYVTEIL
                     VKTTGTMQMLVRAAGAQTQPEEGQQFSGQPQPQPPEGDDYGFSDDIPF"
     misc_feature    47130..47579
                     /gene="ssb"
                     /locus_tag="pO157p49"
                     /note="single-stranded DNA-binding protein; Provisional;
                     Region: PRK13732"
                     /db_xref="CDD:184284"
     misc_feature    order(47154..47165,47238..47246,47289..47291,47295..47297,
                     47358..47360,47385..47387,47415..47417,47424..47426)
                     /gene="ssb"
                     /locus_tag="pO157p49"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(47169..47177,47193..47195,47223..47225,47244..47249,
                     47283..47288,47292..47294,47298..47300,47304..47306,
                     47310..47312,47349..47354,47376..47378,47382..47384,
                     47388..47393,47427..47429,47433..47435)
                     /gene="ssb"
                     /locus_tag="pO157p49"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     gene            47639..47872
                     /locus_tag="ECp054"
                     /db_xref="GeneID:2717072"
     CDS             47639..47872
                     /locus_tag="ECp054"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958724.1"
                     /db_xref="GeneID:2717072"
                     /translation="MSEYFRILQGLPDGPFTRKHAEAVAAQYRNVFIENDHGEQFRLV
                     VRNNGAMVWRTWNFEDGAGYWMNHVIRDFGIIK"
     misc_feature    47666..47869
                     /locus_tag="ECp054"
                     /note="Bacterial protein of unknown function (DUF905);
                     Region: DUF905; pfam06006"
                     /db_xref="CDD:368702"
     gene            47938..49896
                     /locus_tag="pO157p50"
                     /db_xref="GeneID:1789702"
     CDS             47938..49896
                     /locus_tag="pO157p50"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052657.1"
                     /db_xref="GeneID:1789702"
                     /translation="MSVTESKAKTERKSSRKPAKTQETVLSALLAQTEEVSVPLASLI
                     KSPLNVRTVPYSAESVSELADSIKGVGLLQNLVVHALPGDRYGVAAGGRRLAALNMLA
                     ERDIIPADWPVRVKVIPQELATAASMTENGHRRDMHPAEQIAGFRAMAQEGKTPAQIG
                     DLLGYSPRHVQRMLKLADLAPVILDALAEDRITTEHCQALALENDTARQVQVFEAACQ
                     SGWGGKPEVQTIRRLVTESEVAVAGNSKFRFVGADTFSPDELRTDLFSDDEGGYVDCV
                     ALDAALLEKLQAVAEHLREAEGWEWCAGRMEPVGFCREDAGTYRSLPEPEAVLTEAEE
                     ERLNELMARYDALENQCEESDLLEAEMKLMRCMAKVRAWTPEMRAGSGVVVSWRYGNV
                     CVQRGVQLRSEDDVADNDYRTEQVQEKASVEEISLPLLTKMSSERTLAVQAALMQQSD
                     KSLALLAWTLCLNVFGSGAYSNPARIRLECEHYSLTSDAPSGKEGAAFMAMMAEKARL
                     AALLPDGWARDMTTFLSLSQEVLLSLLSFCTACSIHGVQTREYGHTSRSPLDTLESAI
                     GFHMRDWWQPTKANFFGHLKKPQIIAALNEAGLSGAARDAEKMKKGDAAEHAEHHMKD
                     NRWVPGWMCAPRPQTDATERTDNLADAA"
     misc_feature    48043..48663
                     /locus_tag="pO157p50"
                     /note="Chromosome segregation protein Spo0J, contains
                     ParB-like nuclease domain [Cell cycle control, cell
                     division, chromosome partitioning]; Region: Spo0J;
                     COG1475"
                     /db_xref="CDD:224392"
     misc_feature    48100..48342
                     /locus_tag="pO157p50"
                     /note="ParB N-terminal, parA-binding, -like domain of
                     bacterial and plasmid parABS partitioning systems; Region:
                     ParB_N_like; cd16406"
                     /db_xref="CDD:319263"
     gene            49951..50385
                     /gene="psiB"
                     /locus_tag="pO157p51"
                     /db_xref="GeneID:1789688"
     CDS             49951..50385
                     /gene="psiB"
                     /locus_tag="pO157p51"
                     /note="responsible for plasmid SOS inhibition; similar to
                     PIR accession number S01898"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein B"
                     /protein_id="NP_052658.1"
                     /db_xref="GeneID:1789688"
                     /translation="MKTELTLNVLHTMNAQEYEDIRAAGSDARRELTHAVMRELDAPD
                     NWTMNGEYGSEFGGFFPVQVRFTPAHERFHLALCSPGDVSQVWVLVLVNAGGEPFAVV
                     QVQRRFAPEAVSHSLALAASLDTQGYSVNDIIHILMAEGGQV"
     misc_feature    49951..50382
                     /gene="psiB"
                     /locus_tag="pO157p51"
                     /note="conjugation system SOS inhibitor PsiB; Region:
                     psiB; PRK13701"
                     /db_xref="CDD:237477"
     gene            50382..51143
                     /gene="psiA"
                     /locus_tag="pO157p52"
                     /db_xref="GeneID:1789722"
     CDS             50382..51143
                     /gene="psiA"
                     /locus_tag="pO157p52"
                     /note="PsiA"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid SOS inhibition protein A"
                     /protein_id="NP_052659.1"
                     /db_xref="GeneID:1789722"
                     /translation="MSARSQALVPLSTEQQAAWRAVAETEKRRNQGNTLAEYPYAGAF
                     FRCLNGSRRISLSDLRFFMPSLTAEELHGNRLQWLYAIDVLIETQGEVCLLPLPGDAA
                     ERLFPSVRFCVRERSRHKSALVMQKYSRQQAREAEQKARAYQALVAQAEIELAFHSPE
                     TVGSWYARWSDRVAEHDLETLFWQWGERFPSLAGMERWQWQDMPFWQVIAEASLAAKE
                     AGHAVREMERWMVPNKLREVRDAATITRIARKQPE"
     misc_feature    50382..51098
                     /gene="psiA"
                     /locus_tag="pO157p52"
                     /note="plasmid SOS inhibition protein A; Provisional;
                     Region: PRK13704"
                     /db_xref="CDD:184260"
     gene            51375..51533
                     /gene="parB"
                     /locus_tag="pO157p53"
                     /db_xref="GeneID:1789673"
     CDS             51375..51533
                     /gene="parB"
                     /locus_tag="pO157p53"
                     /note="F leading maintenance protein; similar to SwissProt
                     accession number P16077"
                     /codon_start=1
                     /transl_table=11
                     /product="small toxic polypeptide"
                     /protein_id="NP_052660.1"
                     /db_xref="GeneID:1789673"
                     /translation="MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAA
                     FMAYESGK"
     misc_feature    51375..51530
                     /gene="parB"
                     /locus_tag="pO157p53"
                     /note="small toxic polypeptide; Provisional; Region:
                     PRK09738"
                     /db_xref="CDD:182055"
     gene            51715..53688
                     /gene="nikB"
                     /locus_tag="pO157p54"
                     /db_xref="GeneID:1789737"
     CDS             51715..53688
                     /gene="nikB"
                     /locus_tag="pO157p54"
                     /note="similar to PIR accession number B38529"
                     /codon_start=1
                     /transl_table=11
                     /product="NikB"
                     /protein_id="NP_052661.1"
                     /db_xref="GeneID:1789737"
                     /translation="MSIAGLREEPAQDWLSLHKRLASDGLYITMQEGELVVKDGWDRA
                     REGVALSSFGPLWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAE
                     TESLKQYACRHFAERLPEMARNGELESCLDVHRTLATAGLWMGIQHGHLVLHDGFDKQ
                     QTPVRADSVWPLMTLDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWY
                     RMRMGTGPQGAIKRELFSDKESLWGYTTVQCESLIEDMIAGGNFSWQACHEMFARKGL
                     MLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEPQAGPFEIAGADIFERVKPEC
                     RYNPELAASDEVEPGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRKPDLRYGER
                     LREIHAACRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIEEG
                     KWYPLSYRQWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPL
                     YEDTGVLEARLQKDGSVRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVL
                     FDREPGMGFEPEGSYQQFNDVFAEMVAWHNAAGITGNGHFVISRPDVDLHRQRSEQYY
                     HEYIRQQKSISGGHGASYAPVQDNEWTPPSPGM"
     misc_feature    <51739..51921
                     /gene="nikB"
                     /locus_tag="pO157p54"
                     /note="Relaxase/Mobilisation nuclease domain; Region:
                     Relaxase; cl21589"
                     /db_xref="CDD:389828"
     misc_feature    <52429..>53148
                     /gene="nikB"
                     /locus_tag="pO157p54"
                     /note="conjugal transfer relaxase TraI; Provisional;
                     Region: PRK13878"
                     /db_xref="CDD:237539"
     gene            53756..54187
                     /locus_tag="pO157p55"
                     /db_xref="GeneID:1789666"
     CDS             53756..54187
                     /locus_tag="pO157p55"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052662.1"
                     /db_xref="GeneID:1789666"
                     /translation="MVLRSIWVEEQYMGVKKIVILAILVSFVAGCAPLHPSNCHKTTA
                     LGSCSSGRWDDQDEWGEQARGIRDAINAKLDDPQKWKRKKCRLHMEFSRDGTALKIST
                     SNGDKAYCEAIKSAAHKAKFPAFNNPEVYRDFQKSGFDMRG"
     misc_feature    53915..54175
                     /locus_tag="pO157p55"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; cl10048"
                     /db_xref="CDD:447889"
     gene            complement(54761..55120)
                     /locus_tag="pO157p56"
                     /db_xref="GeneID:1789692"
     CDS             complement(54761..55120)
                     /locus_tag="pO157p56"
                     /note="encoded in insertion sequence IS3"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase Tra5"
                     /protein_id="NP_052663.1"
                     /db_xref="GeneID:1789692"
                     /translation="MDELRAQGYHFKVKTVTESLRRHGLRAKASWNFSPVCYRAHSQP
                     VSENLLEQDFYASGPNQKWAGDITYLRTDEGWPYLAVVTCHYWLINVVTHDGTGAPGT
                     LCYRMSFAKMTDRYTSI"
     misc_feature    complement(<54875..>55117)
                     /locus_tag="pO157p56"
                     /note="IS3 family transposase; Region: transpos_IS3;
                     NF033516"
                     /db_xref="CDD:411153"
     gene            55302..55712
                     /locus_tag="pO157p57"
                     /db_xref="GeneID:1789710"
     CDS             55302..55712
                     /locus_tag="pO157p57"
                     /note="encoded in insertion sequence element IS21; similar
                     to SwissProt accession number P15025"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_052664.1"
                     /db_xref="GeneID:1789710"
                     /translation="MLSREDFYMIKQMRQQGAYIVDIATQIGCSERTVRRYLKYPEPP
                     ARKTRHKMAEMDYIDMRLAENVWNGEVILAEIKAMGYTGGRSMLLRQFRKTPEQRFTQ
                     EHSLFFRLLNRRYEKASIVLTSNKGFADWGRDVR"
     misc_feature    55329..>55613
                     /locus_tag="pO157p57"
                     /note="IS21 family transposase; Region: transpos_IS21;
                     NF033546"
                     /db_xref="CDD:411181"
     misc_feature    <55599..55700
                     /locus_tag="pO157p57"
                     /note="IS21-like element helper ATPase IstB; Region:
                     IS21_help_AAA; NF038214"
                     /db_xref="CDD:439516"
     gene            55981..65490
                     /gene="toxB"
                     /locus_tag="pO157p58"
                     /db_xref="GeneID:1789667"
     CDS             55981..65490
                     /gene="toxB"
                     /locus_tag="pO157p58"
                     /note="similar to SwissProt accession number P18177"
                     /codon_start=1
                     /transl_table=11
                     /product="toxin B"
                     /protein_id="NP_052665.1"
                     /db_xref="GeneID:1789667"
                     /translation="MIHPGSSLDKAINNTRVKNVSTDVKHGQIQERKRNFIYKKNDDI
                     SSRFKLYSSLVKQKNATEDVVLIGKMILDEVRSYRTIHNDRNIVSNSGNWKTSFLCNL
                     ARLLYSIFNGSNYFCSREGENNSSPSSTLLTIHQPEKQELLQQKSIKHLPTSNNIDGY
                     IKIRKTRGAEDQTTTITQSLIINELLNGVDRNTIPFQKISELNDIIHSYENMQIKNSR
                     KGIEILVKQGELLSSLINVNKGNKQLSDNASKIINLLGIEYQSHKVDIEPFIHAVWVA
                     GAPPDNTFSYITAFLNTYKDYTYLLWIDPNAFGAAKFSGILKNIAMNYAIMRLRRTNP
                     HLAEEMNEVILKIQNIQNETIEFKETRERLKELENRYKSLTSETKEKFNVFFLESMIG
                     MQDNYFTYCISNGISNTDDISRLDFLTNVLKLSPEVQNDFKSTVEKNKRDIDLLKNTI
                     SQKFGDRFQLRDINTLESFKKPQDYFFYQQEMLLRWNYAAASDQVRINILKEYGGIYT
                     DTDILPAYSDKVSQIINEKSDDKRFFEDLKLRRIISESILSLIKGEKYSIKHDGLDET
                     TLNQLNNILSEIEKLTIDDYFKPVETKVVRDTFKIFKRYQKWTENTWNIRGNNNFMLT
                     HKGSKCIDFILSGQKKQYLELQRIRDNISYNNLFYTTEDLKSLNNVAIGGIPAKKYLE
                     HGLFSEYRQDGTIPYVVSTLNISGPDMIMRQMKKYYKSLGRIGEVHIKDNKLSDVNFL
                     GVYASSNKDNKSFNWLNPVSVGINDITPDDESSWAVRNNDINKILFEKINCHVPEKLP
                     TSLYYEIDSRSFFQGWDNKSIKHVTEINKDLIKDINLLLTSSNIDVKLLIKLDRELYA
                     ISSKIDNPLALRSIRTLQLQLANYVTSNTFEPENTINFIYDFYRKKQDDLLSAIKLFS
                     RNDADTKIIVWYNSVMEKNVFLREVISCVLRSKKVDSYINENKKNLSKEDAGALRDYA
                     KLKMKELFSMLDDDGYKKIITTNAYIKERDKLSGIIYNIENSIISGHESFDIIRSNQH
                     EWGDLSTVEQFKKFEFYVKSELSSAKSIFDDIKNKYITDPETKRNVLYHQLDSDIKER
                     IAFLDISHYAYPGSLLEKLQLSGYVFSDINIIAEYLLASYGVSGHYSHGVVYPAPSDK
                     LLELLRRHTKSNSEWIEKITPYVYDILSDNVSNVLRPPLSEEQKKILNDIKLEISKSV
                     SEQYFMKLTEQKSSVIGIKYSVDFDRYNENLFLSLPINQNLTLPFMYRYFEMLYDIHI
                     GIIENKANREFIYSKFSSLNLDFLINDERVLNLEGLIKKYKYLSLSEIHRTLTNSTSF
                     ADISIPLLQTICPSITTIIKKTEYYGHQLTNAMTVASVVKPYDFSNLGAINSIDKSVS
                     DVPALHTIVEQAKYNLLSWNDFYNTHASIWDTIARQHKSTNIEFHPQSLLFDRDSKGK
                     CLGLSLLYLDTGGYGGGYQKLRHNIDTASTLYQTKYNDNLKLSNRDDFFLRKTQRIIT
                     MSNELGNNRLKNAQLEVLELKDPILTEGILYQRRISSLLITTEYHSLALQQISSFWRV
                     TDPNFGHCDFHSLAQALTFIKNITSNRNFSSLYGSGIVKIYFSESLNNWKYIKLPLVQ
                     TGSLLRDIYLTTPEKLSTSGGSLNIMGHLVPVSFIYDIGGVINGNRISESTDVKNKIR
                     SLKINGDILQHYINTHYLSEEQTQKIKDIVDFLGIQDNTIKVKLESDIKPISEIQQPL
                     HSILSRQKEHVKNLLSGLLDEFSNKLRKQGLSLKTNVLSVNNFKESKINSDTVEVTVT
                     DLQGRLYRVDIDTRVIGLTFKEGINSLSEALEHMNIDAIMSVIGLVQYARMIKMNDNI
                     SAIDHAGAVSDIKNIVDKFLGGILTLTNNRVYNPGGVSGASLEGFTSSGLEVCASRMG
                     GTAGRYLSNVAKVIKLPLLDIGINIWSLYDSSLNHAKATTQIEYISTAIDVSFSSINT
                     ALSIGAIAYPPLAIAIVPITIFSHEVKNYAVYVNQINERHKLWLEAEKYLDNGSAKVL
                     SINKATGIIDLSNNQVLGNIYLDMRENPPILHGEKSYNSGKNIGSHPDMTDREIMESR
                     AYNFACTKLSDAGEPDIFGWGDKEICNSMELSESQLANGYSNRQWPSQIPVIPEGIYN
                     TVYLGYGETLRANTEVTLSSTGYFYEIARAYTDDELSEPLLTVCNQHSHVIGGKEPLT
                     IIIPAIEHGMLGSNLHMIERFKNYNFSISGGKGGIKLMVGGIGDYNIECTPGVRNIIS
                     FEQLSRDFNLDLDLSDGRKQNFNFHHPSGFYSGKVMSITQKGINAVVGTKLGYDKIRG
                     NNLDNTFSLGSGGGVIYSGGGSNTYFVPATLQDNLHIYISEKSNGNHIILGDMHSRLS
                     IECHFSNNEREFIKMGYYNGCDVILESDTIQKIKSFAKNITIQTADGVMANWDDKLNT
                     LSVYSIDMIAWRDKNKTAKEPLPVDVIQLTNWRMHNTCSLFYDKYQVDIEANKLTYTV
                     LFPDTELPVQLNYTSIIYGNHGAKYTFLNSGSKTIDIHILDKNSDYDTFDFRNIIFEH
                     YTNEIFISFDNQGGFVISILNNATSEAANINVFRKNMTSLDSSGSLIYLPSGDIYHIS
                     DIYKMSRGRKSFKLNVEKKPDIDDIINVAILETSYLQIKKIPNNDDSDYILCLDNPNL
                     SSYTLNFNDLSGYISSLWDNIRGSFTPFHKNTVNIAPNEKKYISLIGLDKLSFNIDVF
                     RQALEVKNKNSYKISKFTWETYGDIVVSPEDRISHLELDGFNYFSQPELDTPISDSFS
                     YLYDNFQIVDSDVHIKLLHLNRETKQITPHRIILKRYFIDSFAKTSITDREKNIYPVI
                     CDSPDHFTSDIYRHPFRIVLGNKTLYPSEELVKFISTSKEYLSNMDVINNVIVPQKTT
                     KKNKLSIVSLNSNIKNDIVLSGVMTGTSKIFHLNNSGDLLLTTSKTHGGGVVVIFKDF
                     INNWWKYNLTLITVPIDNKLSDNRINITPMGIKIQETVSGNDRLFFYPTPLKNGCFIL
                     HNPLYSNSFPSLYSHELFDLIEAYRNPTYSYLQNNIINRYIHTVSEYAGKDGIANMSL
                     SIYAYSTCRFWSKESVAVGDTIKLSNYEHIEFSFNSFSKDYFREQNSDIYKIFFKIAS
                     SSNSVVVDKNTLTQKNFLENNTFFSITGIDESLYEKHIIFITLKVIVPSKK"
     misc_feature    56512..56682
                     /gene="toxB"
                     /locus_tag="pO157p58"
                     /note="TcdB toxin N-terminal helical domain; Region:
                     TcdB_N; pfam12918"
                     /db_xref="CDD:403966"
     misc_feature    56788..58092
                     /gene="toxB"
                     /locus_tag="pO157p58"
                     /note="Glycosyltransferase sugar-binding region containing
                     DXD motif; Region: Gly_transf_sug; cl19952"
                     /db_xref="CDD:418730"
     misc_feature    60238..60792
                     /gene="toxB"
                     /locus_tag="pO157p58"
                     /note="cysteine protease domain, YopT-type; Region:
                     yopT_cys_prot; TIGR01586"
                     /db_xref="CDD:273706"
     misc_feature    62488..64848
                     /gene="toxB"
                     /locus_tag="pO157p58"
                     /note="Protein of unknown function (DUF3491); Region:
                     DUF3491; pfam11996"
                     /db_xref="CDD:314813"
     gene            65582..65854
                     /locus_tag="pO157p59"
                     /db_xref="GeneID:1789744"
     CDS             65582..65854
                     /locus_tag="pO157p59"
                     /note="encoded in insertion sequence IS3"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase Tra5"
                     /protein_id="NP_052666.1"
                     /db_xref="GeneID:1789744"
                     /translation="MDELRAQGYHFKVKTVTESLRRHGLRAKASWNFSPVCYRAHSQP
                     VSENLLEQDFYASGPNQKWAGDITYCVPGVQGEHGGSNEPRVCLEY"
     misc_feature    <65585..>65788
                     /locus_tag="pO157p59"
                     /note="IS3 family transposase; Region: transpos_IS3;
                     NF033516"
                     /db_xref="CDD:411153"
     gene            complement(65781..66284)
                     /gene="IS629"
                     /locus_tag="pO157p60"
                     /db_xref="GeneID:1789703"
     CDS             complement(65781..66284)
                     /gene="IS629"
                     /locus_tag="pO157p60"
                     /note="similar to SwissProt accession number P16941"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052667.1"
                     /db_xref="GeneID:1789703"
                     /translation="MTKNTRFSPEVRQRAVRMVLESQGEYDSQWAAICSIAPKIGCTP
                     ETLRVWVRQHERDTGSGDGGLTTAERQRLKELERENRELRVQFFRLLNRRYEKASIIL
                     TSNKGFADWGEMFGEHVLATAILDRLLHHSTTLNIKGESYRFNIPDRLVVHLSLHARP
                     ELRAHNT"
     misc_feature    complement(66024..66284)
                     /gene="IS629"
                     /locus_tag="pO157p60"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:451250"
     misc_feature    complement(65853..>66068)
                     /gene="IS629"
                     /locus_tag="pO157p60"
                     /note="IS21-like element helper ATPase IstB; Region:
                     IS21_help_AAA; NF038214"
                     /db_xref="CDD:439516"
     misc_feature    66314..67729
                     /note="similar to helicase I"
     gene            67749..68495
                     /gene="traX"
                     /locus_tag="pO157p62"
                     /db_xref="GeneID:1789740"
     CDS             67749..68495
                     /gene="traX"
                     /locus_tag="pO157p62"
                     /note="similar to SwissProt accession number P22710"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer pilus acetylation protein
                     TraX"
                     /protein_id="NP_052669.1"
                     /db_xref="GeneID:1789740"
                     /translation="MTTDNTNTTRNDSLAARTDTWLQSLLVWSPGQRDIIKTVALVLM
                     VLDHANRILHLDQTWMFLAGRGAFPLFALVWGLNLSRHAHIRQSAINRLWGWGIIAQF
                     AYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAAAILLMALWGPLSGTSYGIAG
                     LLMLAVSHRLYRAEDRTERLVLVACLLAVIPALNLASSDAAAVAGLVMTVLTVGLVSC
                     AGKSLPRFWPGDFFPTFYGCHLAVLGILAL"
     misc_feature    67749..68492
                     /gene="traX"
                     /locus_tag="pO157p62"
                     /note="conjugal transfer pilus acetylase TraX; Region:
                     PRK13706"
                     /db_xref="CDD:184262"
     gene            68554..69414
                     /locus_tag="pO157p63"
                     /db_xref="GeneID:1789674"
     CDS             68554..69414
                     /locus_tag="pO157p63"
                     /note="similar to SwissProt accession number Q99390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052670.1"
                     /db_xref="GeneID:1789674"
                     /translation="MKITDHKLSEGIALTFRVPEGNIKHPLIILCHGFCGIRNVLLPC
                     FANAFTEAGFATITFDYRGFGESDGERGRLVPAMQTEDIISVINWAEKQECIDNQRIG
                     LWGTSLGGGHVFSAAAQDQRVKCIVSQLAFADGDVLVTGEMNESERASFLSTLNKMAE
                     KKKNTGKEMFVGVTRVLSDDESKVFFEKIKARHPEMDIKIPFLTVMETLQYKPAESAA
                     SVQCPVLVVIAGQDSVNPPEQGRALYDAVASGTKELYEEADACHYDIYEGAFFERVVA
                     VQTQWFKQYL"
     misc_feature    68629..69360
                     /locus_tag="pO157p63"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_1;
                     pfam00561"
                     /db_xref="CDD:395444"
     gene            69517..70077
                     /gene="finO"
                     /locus_tag="pO157p64"
                     /db_xref="GeneID:1789697"
     CDS             69517..70077
                     /gene="finO"
                     /locus_tag="pO157p64"
                     /note="conjugal transfer repressor; similar to SwissProt
                     accession number P08315"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer fertility inhibition protein
                     FinO"
                     /protein_id="NP_052671.1"
                     /db_xref="GeneID:1789697"
                     /translation="MAEQKRPVLTLKRKTEGETPVRSRKTIINVTTPPKWKVKKQKLA
                     EKAAREAELAAKKAQARQALSIYLNLPTQDEAVNTLKPWWPGLFDGDTPRLLACGIRD
                     VLLEDVAQRNIPLSHKKLRRALKAITRSESYLCAMKAGACRYDTEGYVTEHISQEEEA
                     YAAARLDKIRRQNRIKAELQAVLDEK"
     misc_feature    69517..70071
                     /gene="finO"
                     /locus_tag="pO157p64"
                     /note="fertility inhibition protein FinO; Region:
                     PRK13754"
                     /db_xref="CDD:184304"
     gene            70210..70422
                     /locus_tag="ECp070"
                     /db_xref="GeneID:2717079"
     CDS             70210..70422
                     /locus_tag="ECp070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958725.1"
                     /db_xref="GeneID:2717079"
                     /translation="MNGFRNSSRNGQVWRYQRAGSRAVILEVSGRWMEAAEAWRRAAG
                     VAPRTDWQQFARKRAEHCHRRCRGRG"
     gene            70667..71128
                     /locus_tag="pO157p65"
                     /db_xref="GeneID:1789676"
     CDS             70667..71128
                     /locus_tag="pO157p65"
                     /note="similar to SwissProt accession number Q99342"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052672.1"
                     /db_xref="GeneID:1789676"
                     /translation="MRKYIPLVLFIFSWPVLCADIHGRVVRVLDGDTIEVMDSRKAVR
                     IRLVNIDAPEKKQDYGRWSTDMMKSLVAGKTVTVTYFQRDRYGRMLGQVYAPDGMNVN
                     QFMVRAGAAWVYEQYNTDPVLPVLQNEARQQKRGLWSDADPVPPWIWRHRK"
     misc_feature    70721..71086
                     /locus_tag="pO157p65"
                     /note="Staphylococcal nuclease homologues; Region: SNc;
                     smart00318"
                     /db_xref="CDD:214615"
     gene            71174..71383
                     /locus_tag="ECp072"
                     /db_xref="GeneID:2717074"
     CDS             71174..71383
                     /locus_tag="ECp072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958726.1"
                     /db_xref="GeneID:2717074"
                     /translation="MEKTKQEWLYQLRRCSSVNTLEKIIHKNRDSLSTSERESFNSAA
                     DHRLAELITGKLYDRIPKEIWKYVR"
     misc_feature    71183..71380
                     /locus_tag="ECp072"
                     /note="Haemolysin expression modulating protein; Region:
                     HHA; cl11501"
                     /db_xref="CDD:448287"
     gene            71421..71759
                     /locus_tag="pO157p66"
                     /db_xref="GeneID:1789675"
     CDS             71421..71759
                     /locus_tag="pO157p66"
                     /note="similar to PIR accession number S28661"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052673.1"
                     /db_xref="GeneID:1789675"
                     /translation="MKLIIFILIVLIIAALLIRIILRSVNQHSPLLMQLHAAGIRTGD
                     AERILSGGEYDASHLRPERRRRDILLEEVLRQAGIPLLRSHDARKLLQMTGEWLNTTG
                     AAQQSPEHRS"
     misc_feature    <71577..71669
                     /locus_tag="pO157p66"
                     /note="PDDEXK family nucleases; Region:
                     PDDEXK_nuclease-like; cl40440"
                     /db_xref="CDD:454756"
     gene            71999..72253
                     /gene="repA2"
                     /locus_tag="pO157p67"
                     /db_xref="GeneID:1789682"
     CDS             71999..72253
                     /gene="repA2"
                     /locus_tag="pO157p67"
                     /note="similar to SwissProt accession number P03847"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="NP_052674.1"
                     /db_xref="GeneID:1789682"
                     /translation="MSQTENAVTSSSGAKRAYRKGNPLSDAEKQRLSVARKRASFKEV
                     KVFLEPKYKAMLMQMCHEDGLTQAEVLTALIKSEAQKRCV"
     misc_feature    71999..72250
                     /gene="repA2"
                     /locus_tag="pO157p67"
                     /note="replication regulatory protein RepA; Region:
                     PRK13702"
                     /db_xref="CDD:184258"
     gene            72556..73413
                     /gene="repA1"
                     /locus_tag="pO157p68"
                     /db_xref="GeneID:1789669"
     CDS             72556..73413
                     /gene="repA1"
                     /locus_tag="pO157p68"
                     /note="RepA"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="NP_052675.1"
                     /db_xref="GeneID:1789669"
                     /translation="MTDLQQTYYRQVKNPNPVFTPREGAGTLKFCEKLMEKAVGFTSR
                     FDFAIHVAHARSKGLRRRMPPVLRRRAIDALLQGLCFHYDPLANRVQCSITTLAIECG
                     LATESAAGKLSITRATRALTFLSELGLITYQTEYDPLIGCYIPTDITFTPALFAALDV
                     SEDAVAAARRSRVEWENRLRKKQGLDTLGMDELIAKAWRFVRERFRSYQTELKSRGIK
                     RARARRDAGRERQDIVTLVKRQLTREISEGRFTANREAVKREVERRVKERMILSRNRN
                     YSRLATASP"
     misc_feature    72556..73410
                     /gene="repA1"
                     /locus_tag="pO157p68"
                     /note="replication protein; Provisional; Region: PRK13750"
                     /db_xref="CDD:184300"
     gene            74325..74609
                     /locus_tag="pO157p69"
                     /db_xref="GeneID:1789719"
     CDS             74325..74609
                     /locus_tag="pO157p69"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052676.1"
                     /db_xref="GeneID:1789719"
                     /translation="MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQA
                     LSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAWADSLSTDNPLPVPR"
     misc_feature    74358..74489
                     /locus_tag="pO157p69"
                     /note="ribbon-helix-helix domain of Shewanella oneidensis
                     type II antitoxin CopA(SO), and similar proteins; Region:
                     RHH_CopAso-like; cd22233"
                     /db_xref="CDD:409023"
     misc_feature    order(74358..74381,74388..74393,74397..74402,74409..74411,
                     74421..74423,74436..74438,74442..74450,74454..74471,
                     74475..74483)
                     /locus_tag="pO157p69"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:409023"
     misc_feature    order(74361..74363,74367..74369,74373..74375,74430..74441)
                     /locus_tag="pO157p69"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:409023"
     gene            74609..74884
                     /locus_tag="pO157p70"
                     /db_xref="GeneID:1789745"
     CDS             74609..74884
                     /locus_tag="pO157p70"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052677.1"
                     /db_xref="GeneID:1789745"
                     /translation="MELKWSSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLT
                     HPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIYVLRLWHTRENR"
     misc_feature    74615..74878
                     /locus_tag="pO157p70"
                     /note="ParE toxin of type II toxin-antitoxin system,
                     parDE; Region: ParE_toxin; pfam05016"
                     /db_xref="CDD:398610"
     gene            74979..75185
                     /locus_tag="pO157p71"
                     /db_xref="GeneID:1789723"
     CDS             74979..75185
                     /locus_tag="pO157p71"
                     /note="stability (stb) locus of IncFII plasmid NR1;
                     similar to SwissProt accession number P11907"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052678.1"
                     /db_xref="GeneID:1789723"
                     /translation="MNYDEITKITAERISDYMTEAVNTDSIAVAEMFHNAAWGVRTLW
                     FELVTKIDIDIHKKNRYASYDLDR"
     misc_feature    complement(75270..75650)
                     /note="similar to transposase"
     gene            complement(76062..76526)
                     /locus_tag="pO157p74"
                     /db_xref="GeneID:1789699"
     CDS             complement(76062..76526)
                     /locus_tag="pO157p74"
                     /note="encoded in insertion sequence IS91; similar to PIR
                     accession number S23782"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_052681.1"
                     /db_xref="GeneID:1789699"
                     /translation="MLPRFADIFQQGNRWLNWLEKQPEGSVRPVVIESVTKIMACGTT
                     LMGYTQWCCSSPDCSHIKKVCFRCKSRSCPHCGVKAGAQWIQYLLSLVPDCPWQHIVF
                     TLPCQYWSLVFHNRWLLAEMSRIAADVIQEICRQADVRLRTRTTICQLRQIC"
     misc_feature    complement(<76098..76514)
                     /locus_tag="pO157p74"
                     /note="IS91 family transposase; Region: transpos_IS91;
                     NF033538"
                     /db_xref="CDD:411173"
     gene            79689..80576
                     /locus_tag="pO157p77"
                     /db_xref="GeneID:1789701"
     CDS             79689..80576
                     /locus_tag="pO157p77"
                     /note="encoded in insertion sequence IS629; similar to
                     SwissProt accession number P16942"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_052684.1"
                     /db_xref="GeneID:1789701"
                     /translation="MPLLDKLREQYGVGPVCSELHIAPSTYYHCQQQRHHPDKRSARA
                     QRDDWLKREIQRVYDENHQVYGVRKVWRQLLREGIRVARCTVARLMAVMGLAGVLRGK
                     KIRTTVSRKAVSAGDRVNRQFVAERPDQLWVADFTYVSTWQGFVYVAFIIDVFAGCIV
                     GWRVSSSMETTFVLDALEQALWARRPSGTVHHSDKGSQYVSLAYTERLKEAKLLASTG
                     STGDSYDNAMAESINGLYKAEVIHRKSWKNRAEVELATLTWVDWYNNRRLLGRLGHIP
                     PAEAEKAYYASIRNDDLAA"
     misc_feature    79746..80573
                     /locus_tag="pO157p77"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            80757..84659
                     /gene="espP"
                     /locus_tag="pO157p78"
                     /db_xref="GeneID:1789732"
     CDS             80757..84659
                     /gene="espP"
                     /locus_tag="pO157p78"
                     /note="extracellular serine protease"
                     /codon_start=1
                     /transl_table=11
                     /product="EspP"
                     /protein_id="NP_052685.1"
                     /db_xref="GeneID:1789732"
                     /translation="MNKIYSLKYSHITGGLIAVSELSGRVSSRATGKKKHKRILALCF
                     LGLLQSSYSFASQMDISNFYIRDYMDFAQNKGIFQAGATNIEIVKKDGSTLKLPEVPF
                     PDFSPVANKGSTTSIGGAYSITATHNTKNHHSVATQNWGNSTYKQTDWNTSHPDFAVS
                     RLDKFVVETRGATEGADISLSKQQALERYGVNYKGEKKLIAFRAGSGVVSVKKNGRIT
                     PFNEVSYKPEMLNGSFVHIDDWSGWLILTNNQFDEFNNIASQGDSGSALFVYDNQKKK
                     WVVAGTVWGIYNYANGKNHAAYSKWNQTTIDNLKNKYSYNVDMSGAQVATIENGKLTG
                     TGSDTTDIKNKDLIFTGGGDILLKSSFDNGAGGLVFNDKKTYRVNGDDFTFKGAGVDT
                     RNGSTVEWNIRYDNKDNLHKIGDGTLDVRKTQNTNLKTGEGLVILGAEKTFNNIYITS
                     GDGTVRLNAENALSGGEYNGIFFAKNGGTLDLNGYNQSFNKIAATDSGAVITNTSTKK
                     SILSLNNTADYIYHGNINGNLDVLQHHETKKENRRLILDGGVDTTNDISLRNTQLSMQ
                     GHATEHAIYRDGAFSCSLPAPMRFLCGSDYVAGMQNTEADAVKQNGNAYKTNNAVSDL
                     SQPDWETGTFRFGTLHLENSDFSVGRNANVIGDIQASKSNITIGDTTAYIDLHAGKNI
                     TGDGFGFRQNIVRGNSQGETLFTGGITAEDSTIVIKDKAKALFSNYVYLLNTKATIEN
                     GADVTTQSGMFSTSDISISGNLSMTGNPDKDNKFEPSIYLNDASYLLTDDSARLVAKN
                     KASVVGDIHSTKSASIMFGHDESDLSQLSDRTSKGLALGLLGGFDVSYRGSVNAPSAS
                     ATMNNTWWQLTGDSALKTLKSTNSMVYFTDSANNKKFHTLTVDELATSNSAYAMRTNL
                     SESDKLEVKKHLSGENNILLVDFLQKPTPEKQLNIELVSAPKDTNENVFKASKQTIGF
                     SDVTPVITTRETDDKITWSLTGYNTVANKEATRNAAALFSVDYKAFLNEVNNLNKRMG
                     DLRDINGEAGAWARIMSGTGSASGGFSDNYTHVQVGVDKKHELDGLDLFTGFTVTHTD
                     SSASADVFSGKTKSVGAGLYASAMFDSGAYIDLIGKYVHHDNEYTATFAGLGTRDYST
                     HSWYAGAEAGYRYHVTEDAWIEPQAELVYGSVSGKQFAWKDQGMHLSMKDKDYNPLIG
                     RTGVDVGKSFSGKDWKVTARAGLGYQFDLLANGETVLRDASGEKRIKGEKDSRMLMSV
                     GLNAEIRDNVRFGLEFEKSAFGKYNVDNAVNANFRYSF"
     misc_feature    80757..80900
                     /gene="espP"
                     /locus_tag="pO157p78"
                     /note="Extended Signal Peptide of Type V secretion system;
                     Region: ESPR; pfam13018"
                     /db_xref="CDD:432938"
     misc_feature    80958..82760
                     /gene="espP"
                     /locus_tag="pO157p78"
                     /note="Immunoglobulin A1 protease; Region: Peptidase_S6;
                     pfam02395"
                     /db_xref="CDD:396804"
     misc_feature    83013..83753
                     /gene="espP"
                     /locus_tag="pO157p78"
                     /note="Pertactin-like passenger domains (virulence
                     factors), C-terminal, subgroup 1, of autotransporter
                     proteins of the type V secretion system of Gram-negative
                     bacteria. This subgroup includes the passenger domains of
                     Neisseria and Haemophilus IgA1 proteases; Region:
                     PL1_Passenger_AT; cd01343"
                     /db_xref="CDD:238653"
     misc_feature    83421..84656
                     /gene="espP"
                     /locus_tag="pO157p78"
                     /note="outer membrane autotransporter barrel domain;
                     Region: autotrans_barl; TIGR01414"
                     /db_xref="CDD:273608"
     gene            complement(85124..85396)
                     /locus_tag="ECp088.2c"
                     /db_xref="GeneID:2717078"
     CDS             complement(85124..85396)
                     /locus_tag="ECp088.2c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_958727.1"
                     /db_xref="GeneID:2717078"
                     /translation="MVTVNLHCPRCQSVQVYRHGKNPKGHDRFRCRDCHRVFQLTYRY
                     EARKPGVQDQITEMPFNGAGVRDTARTLKIGINTVIRTLKNARHEE"
     misc_feature    complement(<85136..85375)
                     /locus_tag="ECp088.2c"
                     /note="IS1 family transposase; Region: transpos_IS1;
                     NF033558"
                     /db_xref="CDD:411189"
     gene            87222..87659
                     /locus_tag="pO157p79"
                     /db_xref="GeneID:1789680"
     CDS             87222..87659
                     /locus_tag="pO157p79"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052686.1"
                     /db_xref="GeneID:1789680"
                     /translation="MLRWSEVREMRDSGLVEFHVHTHSHKRWDRLSVSRAEQCRLMKE
                     DILVGKQCLTEKLGFCSSHLCWPEGYYNRDYINLAGKLGFSYLYTTERRMNCPENGSL
                     RIGRISTKEREHSGWLKRRLFYYTTPLFSSVLALHKGPRLPDN"
     misc_feature    <87222..87599
                     /locus_tag="pO157p79"
                     /note="Catalytic NodB homology domain of the carbohydrate
                     esterase 4 superfamily; Region: CE4_SF; cl15692"
                     /db_xref="CDD:449579"
     gene            87659..88765
                     /locus_tag="pO157p80"
                     /db_xref="GeneID:1789671"
     CDS             87659..88765
                     /locus_tag="pO157p80"
                     /function="LPS biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="RfbU-like protein"
                     /protein_id="NP_052687.1"
                     /db_xref="GeneID:1789671"
                     /translation="MMKILFTESSSDIGGQELQALAQMTALQKQGHSVLLACREKSKI
                     APEARKRGHDVTFIPFRNSLHLPSILRLRRIIGEFKPDLVICHSGHDSNIAGLSRLIC
                     CHRFSIVRQKTYITRKTRTFSLNYLCDFIVVPSSAMMAHLMAEGVRTPVTVIPPGFDW
                     PALHNEAMRPLPLHIHAWAASADNVPLIVQVGMLRPEKGHEFMLRVLYQLKMEGKSFR
                     WLVVGAGREEYEARLRQQTEHLGMSGDVLMAGALFPALPVYRIASVVVMPSENEAFGM
                     VLAEASVSGVPVIASETGGIPDVIQKNVTGTLLPVGDVSAWTGALRDFLSRPERFRMM
                     AASAREDIEYRFDINRTAQIIVSLASQAKGKCNR"
     misc_feature    87668..88732
                     /locus_tag="pO157p80"
                     /note="phosphatidyl-myo-inositol mannosyltransferase;
                     Region: GT4_PimA-like; cd03801"
                     /db_xref="CDD:340831"
     gene            88855..90576
                     /locus_tag="pO157p81"
                     /db_xref="GeneID:1789713"
     CDS             88855..90576
                     /locus_tag="pO157p81"
                     /note="similar to SwissProt accession number P32678"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_052688.1"
                     /db_xref="GeneID:1789713"
                     /translation="MHLNTGQNRPTFSWSALGWAIFYFGFFSTLLQVIIFSSGYSGTN
                     GIRDSLLFSCLWLIPVFLYPDRIKIIAAVVGFILWGTSLAALCYYFLYGHEFSQSVLF
                     VMFETNAREAGEYFSQYFSLKLLLISLVYTAVSVFLWTRLRPVYIPLPWRRIVSFLLL
                     YALLLHPVVLKSLIRQEPLNDTLGKLASRMEPAAPWQFVSSYYQYHQQLNALTTFLNE
                     NSALPPLGNLRDESGERPRTLVLVIGESTQRERMSLYGYLRETTPELDALRKTDPGLT
                     VFNNVVASRPYTIEALQQALTFANEKNPDLYLTQPSLMNMMKQAGYKTFWITNQQTIT
                     ARNTMLTVFSRQTDRQYYMNQQRTQSAREYDTNVLKPFREVLNDPAPKKLIIVHLLGT
                     HIKYKYRYPEGQGRFDGITGHIPTGLNAKELEVYNDYDNANLFNDHVVASLIKDFRAT
                     APDGFLLYFSDHGEEVYDTPPYKTQGRNEDNPTRPMYTVPFLLWTSEKWHAAHPRDFS
                     QYVDRKYSLAELIHTWSDLAGLTYDGYDPTRSLVNPQFRETTRWIGNPYKKNGLTDFD
                     TLPYGEP"
     misc_feature    88855..90573
                     /locus_tag="pO157p81"
                     /note="phosphoethanolamine transferase CptA; Region:
                     PRK10649"
                     /db_xref="CDD:182617"
     misc_feature    order(89587..89589,89716..89718,90031..90033,90235..90240,
                     90283..90285)
                     /locus_tag="pO157p81"
                     /note="putative active site [active]"
                     /db_xref="CDD:293741"
     misc_feature    order(89587..89589,89716..89718,90031..90033,90238..90240)
                     /locus_tag="pO157p81"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:293741"
     misc_feature    order(89806..89808,89845..89847,90280..90288)
                     /locus_tag="pO157p81"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293741"
     gene            90650..91648
                     /locus_tag="pO157p82"
                     /db_xref="GeneID:1789687"
     CDS             90650..91648
                     /locus_tag="pO157p82"
                     /function="lipid A biosynthesis"
                     /note="Transfers myristate or laurate, activated on ACP,
                     to the lipid IVA moiety of (KDO)2-(lauroyl)-lipid IVA"
                     /codon_start=1
                     /transl_table=11
                     /product="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
                     acyltransferase"
                     /protein_id="NP_052689.1"
                     /db_xref="GeneID:1789687"
                     /translation="MVPPSAVLCYHNEISRQIPVNMKNIRTEFIPRFNLTLCFPRYWM
                     TWTGIGIICVFAMVPPALRDPLLGKLGMLVGRLGKSARQRALINLSLCFPEYSDKEKE
                     NIVDAMFATASMAVVLMAELALSGPDKISHRIRWNGLEIVEKMAQNNEKVIFLVPHAW
                     GVDIPAMLMAASGRKMAAMFHNQRNPVVDYVWNSVRRRFGGKLHARNDGIASFVRSVR
                     QGYWGYYLPDQDHGPEFSEFADFFATYKATLPVIGRLSRISGARIIPLFPVYDGKTHH
                     LTIHVSPPLAIRQKSDAHIARQINEVVENFVRPHPEQYTWILKLLKTRKEGEEDPY"
     misc_feature    90710..91636
                     /locus_tag="pO157p82"
                     /note="lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA
                     acyltransferase; Validated; Region: PRK08943"
                     /db_xref="CDD:236355"
     misc_feature    order(91121..91123,91130..91132,91136..91138,91187..91198,
                     91334..91342)
                     /locus_tag="pO157p82"
                     /note="putative acyl-acceptor binding pocket [active]"
                     /db_xref="CDD:153246"
CONTIG      join(AB011549.2:1..92721)
//
DBGET integrated database retrieval system