GenomeNet

Database: RefSeq
Entry: NC_003521
LinkDB: NC_003521
Original site: NC_003521 
LOCUS       NC_003521             241087 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Panine herpesvirus 2 strain Heberling, complete genome.
ACCESSION   NC_003521
VERSION     NC_003521.1
DBLINK      Project: 14404
            BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Panine betaherpesvirus 2 (PnHV-2; CCMV)
  ORGANISM  Panine betaherpesvirus 2
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae;
            Cytomegalovirus.
REFERENCE   1  (bases 1 to 241087)
  AUTHORS   Davison,A.J., Dolan,A., Akter,P., Addison,C., Dargan,D.J.,
            Alcendor,D.J., McGeoch,D.J. and Hayward,G.S.
  TITLE     The human cytomegalovirus genome revisited: comparison with the
            chimpanzee cytomegalovirus genome
  JOURNAL   J. Gen. Virol. 84 (PT 1), 17-28 (2003)
   PUBMED   12533697
  REMARK    Erratum:[J Gen Virol. 2003 Apr;84(Pt 4):1053]
REFERENCE   2  (bases 1 to 241087)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-2002) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 241087)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-FEB-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AF480884.
            The original gene nomenclature has been retained. Genes presumably
            inherited from the common ancestor of alpha-, beta- and
            gammaherpesviruses (core genes), from the common ancestor of beta-
            and gammaherpesviruses (betagamma genes), or from the common
            ancestor of betaherpesviruses (beta genes) are indicated. A
            standard protein nomenclature has been applied so that orthologs
            have the same name in all herpesviruses.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..241087
                     /organism="Panine betaherpesvirus 2"
                     /mol_type="genomic DNA"
                     /strain="Heberling"
                     /isolation_source="male chimpanzee (Pan troglodytes number
                     4x148) born in New York on 31 December 1975"
                     /host="Pan troglodytes"
                     /db_xref="taxon:188763"
                     /country="USA"
                     /collected_by="Richard Heberling"
                     /acronym="PnHV-2; CCMV"
                     /note="isolated in chimpanzee lung fibroblast cells, grown
                     to passage 16 in human fibroblast cell lines HFF and MRC5,
                     passaged 4 times in HFF cells, and used to grow virions
                     for DNA preparation; 1 gene is mutated (UL128)"
     repeat_region   1..687
                     /note="TRL"
                     /rpt_type=inverted
     repeat_region   1..297
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     misc_feature    688..200038
                     /note="UL"
     gene            714..1628
                     /gene="RL1"
                     /locus_tag="CCMVgp001"
                     /db_xref="GeneID:935517"
     CDS             714..1628
                     /gene="RL1"
                     /locus_tag="CCMVgp001"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein RL1"
                     /protein_id="NP_612643.1"
                     /db_xref="GeneID:935517"
                     /translation="MRNSTMLNEPSISTTHIPSEGGPLGYPVSREDMKRGGTEWIEGT
                     DYPEDCWCMWGRFGTLNRRPVVRLLLQRQLEGRCDWNVVRCRGMGFRATDNEHGMAIW
                     RQHLVFLLGGHGQRVQLDRPSAGEAEARGLLPRFHLKPRTDTNHIPPLCEPTPGGFYE
                     ARITSDLPHTNTTHTSNTHEQHTQPEHSPYQDMRPDSETEEDSDTDGSHAYMELIEDQ
                     DEDVLLDPDTFYDETPTEEHETNNTRERRLATSGQGDGLWGTPLHRHETHSNDHERLR
                     GWRWARRGERGAWMPAETFTCPQGRRPW"
     gene            complement(5972..6229)
                     /gene="RL8A"
                     /locus_tag="CCMVgr001"
                     /db_xref="GeneID:11468237"
     CDS             complement(5972..6229)
                     /gene="RL8A"
                     /locus_tag="CCMVgr001"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL8A"
                     /protein_id="YP_004940333.1"
                     /db_xref="GeneID:11468237"
                     /translation="MPHSHLPQIVSFCAWPRQGLLLFLGLLVLFLNYHNQIAVAERRR
                     TGRRIPFVDPLPPESEWYDDDSDDEDDDGDGDSVGIGVVFG"
     gene            complement(6274..6492)
                     /gene="RL9A"
                     /locus_tag="CCMVgr002"
                     /db_xref="GeneID:11468238"
     CDS             complement(6274..6492)
                     /gene="RL9A"
                     /locus_tag="CCMVgr002"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein RL9A"
                     /protein_id="YP_004940334.1"
                     /db_xref="GeneID:11468238"
                     /translation="MPWSCRCFSAVMTVNERPEAARPVAAAVAAAPLRDPDRPLWDPD
                     LARVILSLMIIITGLAVALWIFTYVIFL"
     gene            6664..7191
                     /gene="RL10"
                     /locus_tag="CCMVgp002"
                     /db_xref="GeneID:935553"
     CDS             6664..7191
                     /gene="RL10"
                     /locus_tag="CCMVgp002"
                     /note="type 1 membrane protein; possibly related to RL11
                     family"
                     /codon_start=1
                     /product="envelope glycoprotein RL10"
                     /protein_id="NP_612644.1"
                     /db_xref="GeneID:935553"
                     /translation="MRYVTLCSTLLLLAIGATAIHNDVCTSLDGQTRLLCKCNRWNNN
                     SNPKPTATSGTHITCLANCTCKRYTEPLPLISVLGIYSAWGAGSFIATLIILLVIFFV
                     IYSRERPADDDNGTVEDPFLAYRDLTRKKLDSHASKKQNIYERIPYRPCRQLRDDEPP
                     LITNAEDDDEEEDNF"
     misc_feature    6715..7158
                     /gene="RL10"
                     /locus_tag="CCMVgp002"
                     /note="Cytomegalovirus TRL10 protein; Region:
                     Cytomega_TRL10; pfam06084"
                     /db_xref="CDD:283691"
     gene            7202..7900
                     /gene="RL11"
                     /locus_tag="CCMVgp003"
                     /db_xref="GeneID:935554"
     CDS             7202..7900
                     /gene="RL11"
                     /locus_tag="CCMVgp003"
                     /note="type 1 membrane protein; binds IgG Fc; involved in
                     immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein RL11"
                     /protein_id="NP_612645.1"
                     /db_xref="GeneID:935554"
                     /translation="MKRDALTLKYVVSTAFCILSSAKPTPTTDALGPLRLRDTYTTCE
                     TRNRTLASRLNTTGHSVSWVRYALPGHKPTQTMPLCSITDAAHSTTRDVRKARFICTR
                     HSMTLYNVTVEDMGMYVLTDEYTGDAESFYFFIFSRAVCEAYATRCAFWKYLDNRCQT
                     LKPAGTNPPPNDLRDWWLNISIHCAWIAGLLIIVASLVGFLLRLRRVGVQNAYRRLSN
                     RDTEPLLQFDAYSE"
     gene            7939..9021
                     /gene="RL12"
                     /locus_tag="CCMVgp004"
                     /db_xref="GeneID:935557"
     CDS             7939..9021
                     /gene="RL12"
                     /locus_tag="CCMVgp004"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein RL12"
                     /protein_id="NP_612646.1"
                     /db_xref="GeneID:935557"
                     /translation="MSETCSVATTLLLVLALSQLTEEDNTTNSSVNTSTNDSNISFTT
                     TSSPKATSTSPTPSFTPNLTTSTEYLNSTVNSTHTPTLTTTLPTSTTSTHSFQNTTIT
                     EYSTTYNLCNTTETVSSNSTESITATSSCNTANTTFDNTTISTAIQTTTTEIVIKAVW
                     TTVHGKESENVTLHVNSTFQNCTRTVWNHPYNITIHKMRKENKPHTLCEASSGHSVKH
                     NHHKLCLQCTPKNLTLFDLMVNHSGKYIAECDDGQNHAQQGFILTVNATHITNYTRVC
                     QPDKDTVTTRPISTHLFNQNYSYQGHYPGASANSHRGAMAVGLFLMACVLLFFARRVY
                     KKKYRPLRDDVSESEFVVRYTPEHED"
     gene            9123..10124
                     /gene="RL13"
                     /locus_tag="CCMVgp005"
                     /db_xref="GeneID:935558"
     CDS             9123..10124
                     /gene="RL13"
                     /locus_tag="CCMVgp005"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein RL13"
                     /protein_id="NP_612647.1"
                     /db_xref="GeneID:935558"
                     /translation="MVDHFAITWTLVFLTLASGTVTSSCHTSHSVSSTTVATTSSTPS
                     VNTTNSADTSNTSTTESSTTSITSTSNTTSTSLTTGTSAVSSASTTSKPTTPSTTIQS
                     TTTTKTTTVITSTSTVPASPTNTTKFECDTATTKTWINITAKVGDNVTFPACNTSGKY
                     HTARWTKVVNTKETDLCLFGPDYYSTSPQAGICFKCHWQSMTIYDVTTENAGNYIVRV
                     HGDGNHHYDKGYRLQVTSNHTTGTNRKKCPNDFTSYTPDHDKNKETKTIENEFGMNYD
                     QPTFPMGMHAIWAAVVVIVALLALYMGSRSSVTIVKGGKPRYKKLSNKDPDEYWASP"
     misc_feature    9540..9824
                     /gene="RL13"
                     /locus_tag="CCMVgp005"
                     /note="Immunoglobulin like; Region: IG_like; smart00410"
                     /db_xref="CDD:214653"
     gene            complement(10256..10432)
                     /gene="UL2"
                     /locus_tag="CCMVgp006"
                     /db_xref="GeneID:935593"
     CDS             complement(10256..10432)
                     /gene="UL2"
                     /locus_tag="CCMVgp006"
                     /note="contains potential transmembrane domain; contains
                     hydrophobic domain"
                     /codon_start=1
                     /product="protein UL2"
                     /protein_id="NP_612648.1"
                     /db_xref="GeneID:935593"
                     /translation="MRGDAVSILIVEDLDLPSFGSFNASHAYYSFRVLRGIFYVTVVV
                     WVLMWIKLLRDNFF"
     misc_feature    complement(10268..10432)
                     /gene="UL2"
                     /locus_tag="CCMVgp006"
                     /note="UL2 protein; Region: UL2; pfam08196"
                     /db_xref="CDD:285414"
     gene            10504..11097
                     /gene="UL4"
                     /locus_tag="CCMVgp007"
                     /db_xref="GeneID:935547"
     CDS             10504..11097
                     /gene="UL4"
                     /locus_tag="CCMVgp007"
                     /note="contains signal peptide; RL11 family"
                     /codon_start=1
                     /product="envelope glycoprotein UL4"
                     /protein_id="NP_612649.1"
                     /db_xref="GeneID:935547"
                     /translation="MRRRGWRGPPGGATFKYGLLVVLTSWVSVIGGIHYGAYDHHVDR
                     RVIKSGDNVTLTSPFYHLGSNFWYKRNATGTYPVCYSVKTIYTFPVDVRVECKHHMNI
                     TIFNFTEDGWGIYSLVTESPFLNDNKHYTAEFYVTIDTRNNGTEEELDYDYDDYGSGF
                     GSGLGLESSGLGLESGSGNEETSGSGDEIQNGFLITY"
     gene            11469..11924
                     /gene="UL5"
                     /locus_tag="CCMVgp008"
                     /db_xref="GeneID:935532"
     CDS             11469..11924
                     /gene="UL5"
                     /locus_tag="CCMVgp008"
                     /note="contains potential transmembrane domain; RL11
                     family"
                     /codon_start=1
                     /product="protein UL5"
                     /protein_id="NP_612650.1"
                     /db_xref="GeneID:935532"
                     /translation="MFLGYSYDFMRFGFALCRAPGHYQTSVTTLVLLTCAVSSSLTAS
                     TSAARGSTGGYRNLTQRANLSSPDTPTTSTLPRQIAAPPAHSSSGLFEQFYHGLAIHA
                     AWVTAFVLVGFLIFFANVFHVPQTIHGWYRDLRDHRTLFGRRYQRLVNS"
     gene            12130..12981
                     /gene="UL6"
                     /locus_tag="CCMVgp009"
                     /db_xref="GeneID:935524"
     CDS             12130..12981
                     /gene="UL6"
                     /locus_tag="CCMVgp009"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL6"
                     /protein_id="NP_612651.1"
                     /db_xref="GeneID:935524"
                     /translation="MPPPRSFGCGGLNKVWICSCLLILVLVVCAPRGSPHWSRVRRQT
                     SLSLPSCSPVNCTVGGDVSLNSTIPVACNSTEWGRYYNSSFWVPLCQLWGGHMRLSGQ
                     NLRLSLTCSRQHLTLHSTSDGYTGTYYQVGNNCPHHHEIMKTCFNLTVLAKPTTTAAP
                     TTTSVPTPTLILTTRNTVIVGVSFPANTVLSSTWTTTAGNASVANGMFYRQYQPLSLA
                     QTHRTAPLNATDNAEDVANLVATYASWGLVLLLLATVLVLFDLGLPQTAWRWWRDQGR
                     EEQHLLL"
     gene            13052..14305
                     /gene="UL8"
                     /locus_tag="CCMVgp011"
                     /db_xref="GeneID:935536"
     CDS             join(13052..13618,13787..14305)
                     /gene="UL8"
                     /locus_tag="CCMVgp011"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL8"
                     /protein_id="NP_612653.2"
                     /db_xref="GeneID:935536"
                     /translation="MAADPHTTLSMLSGLCNKALWLSICLLIVAFLLASSSTTTMVYV
                     SGPPGRPLSLHANFTQDDDVHWYRLKGNETVSLCSCMVGDGVFIARSNMSLGCLPWQL
                     ILFNMTVNDGGLYYVNGTNGTTRTSTTVWFNVTIGLQFAPKTTKPPKKTTNKRAKLSE
                     RTGMSLFRYARDLDSVRRKDDDNNIHLGLGGIVMNVTGQPPSSPPFPGPSESTWNVTT
                     GGEDGGERSVTTTTVAVSTRPTTLSGKTNASTSTATSTAPVTTTRTTTRVRTTRTNST
                     SGVTTRTTTTTVRPQPDCLLRTQLSYHHTVQAQPQKIAVHYTWLILLILFIVLVILFC
                     LRIPQKLYDKWRNRRRYGQVYVVDTEL"
     gene            13052..13693
                     /gene="UL7"
                     /locus_tag="CCMVgp010"
                     /db_xref="GeneID:935535"
     CDS             13052..13693
                     /gene="UL7"
                     /locus_tag="CCMVgp010"
                     /note="type 1 membrane protein; modulates cytokine
                     production; involved in immune regulation; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL7"
                     /protein_id="NP_612652.1"
                     /db_xref="GeneID:935535"
                     /translation="MAADPHTTLSMLSGLCNKALWLSICLLIVAFLLASSSTTTMVYV
                     SGPPGRPLSLHANFTQDDDVHWYRLKGNETVSLCSCMVGDGVFIARSNMSLGCLPWQL
                     ILFNMTVNDGGLYYVNGTNGTTRTSTTVWFNVTIGLQFAPKTTKPPKKTTNKRAKLSE
                     RTGMSLFRYARDLDSVRRKDDDNNIHLGLVGAGLFVALVIVCLMGWLKILCTH"
     gene            14327..14860
                     /gene="UL9"
                     /locus_tag="CCMVgp012"
                     /db_xref="GeneID:935538"
     CDS             14327..14860
                     /gene="UL9"
                     /locus_tag="CCMVgp012"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL9"
                     /protein_id="NP_612654.1"
                     /db_xref="GeneID:935538"
                     /translation="MFYTFSVLTYVCNKLHEVPREVECNKVTGYIGQNVSLKSITHVW
                     SNSTWSVHTVSSLYMMCERESNDAPFNFYNVTDIQFNCTEEELLLLELTTQYTAVYYY
                     RGYDTVPRPCMLYSTCYNVTVKNRTYEAEKHTFASSIWIPPVAVVTLIILLSVIKIPQ
                     RIWEEWMQYRYRDTVYT"
     gene            14959..15657
                     /gene="UL10"
                     /locus_tag="CCMVgp013"
                     /db_xref="GeneID:935540"
     CDS             14959..15657
                     /gene="UL10"
                     /locus_tag="CCMVgp013"
                     /note="type 1 membrane protein; RL11 family"
                     /codon_start=1
                     /product="membrane protein UL10"
                     /protein_id="NP_612655.1"
                     /db_xref="GeneID:935540"
                     /translation="MPFGSYIVNCGFLTWFVLSAVFKYEFSEACEEHTTYETHPLLLG
                     GKPLLGAHQTAYWYKHKCDSMTSSNDKLTPLCYYPPRNSKGKLDESAENTFINYLCSN
                     STLIIARLNLTDAGEYCRKKNSTRHDSWPTMSCYRVIVRPITKTTSKKPESGPTRVKR
                     TTYDNYSVTLLEEPLLFQTHRSTQNAHIAWLFIAVVIIVVIILFFFKIPQKLFDKWKL
                     HKSYAKTGHFSAFH"
     misc_feature    14959..15654
                     /gene="UL10"
                     /locus_tag="CCMVgp013"
                     /note="envelope glycoprotein M; Provisional; Region:
                     PHA03240"
                     /db_xref="CDD:165499"
     gene            15758..16468
                     /gene="UL11"
                     /locus_tag="CCMVgp014"
                     /db_xref="GeneID:935578"
     CDS             15758..16468
                     /gene="UL11"
                     /locus_tag="CCMVgp014"
                     /note="type 1 membrane protein; disrupts T cell function
                     via inhibition of CD45; involved in immune regulation;
                     RL11 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL11"
                     /protein_id="NP_612656.1"
                     /db_xref="GeneID:935578"
                     /translation="MCHRRLEWFCKTSFYAAMICVFVTSTDLQNACVEEKARQGSNVT
                     FDAIRYSGKNQSTYWFRGSRYNADMMCNFTGNLTVHSTEIRLNYTCQRNFSLTLINVT
                     SEYSNKYYTRTTVRSTSTNSWSFDTCFKLTVTIVKPPKPKRTTTLKRPQEPVTKPKTT
                     YVDRYYDGFGATIAVSPGIVSSQRQSATTISIWICLISIVVIVVILFYFRIPQKLLLP
                     FMCPRPKDETLMIPQTEL"
     misc_feature    15848..16402
                     /gene="UL11"
                     /locus_tag="CCMVgp014"
                     /note="envelope glycoprotein M; Provisional; Region:
                     PHA03240"
                     /db_xref="CDD:165499"
     gene            16623..18392
                     /gene="UL13"
                     /locus_tag="CCMVgp015"
                     /db_xref="GeneID:935579"
     CDS             16623..18392
                     /gene="UL13"
                     /locus_tag="CCMVgp015"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL13"
                     /protein_id="NP_612657.1"
                     /db_xref="GeneID:935579"
                     /translation="MVVVSRGLTSYYLIPLLLCKVPPLLLTWPDSAHGLDIVDEELSH
                     DYEEISVVRFAMQQVGFQMLPAPIMGRRSEIDEDRPSSPAQADVYDVRSPRPPRPPRP
                     RLQSPYHHQERPPLPSGIRWQHEELQFLLQYRQQELLQQREEERRQRQHQQRRRYRWR
                     RPTFPPPDPPSYPARSSILPARFARPSLANGAEQLNARRGYGERRASPSRGMASEPAS
                     SVEEEQYRRVVGNVTRRRHHPQHRSYRRRNALVANGRDSLLLARLRINHQRQTRFTGY
                     RCRYFGRNRGSARRRDDGTGSGAAGHGGSRPGGAGFSQLRERIVTDLQLFRLRCHGWT
                     RQASRRIRTRWEEENTVMSDAASRLRAWFSRRTTYWQRTWVPGENPSAEAGELAVPPA
                     ADGQVKETSQQSMTVTTEGEREQKTEQRVEKAAKGGEETIEKVETDETRVAEETKVVE
                     EVQVVEEEENVVVEETGREERDRDEDAMIIPWGEWWDEDLLSDLETTAAGTEEVAVEK
                     EEETTKGADADTTTVTASETTDDVIQTNELPCELNNAEEISSGRAVVGTCPRREGPHR
                     SFFRLCLGLWASSHLARRAISVS"
     gene            18719..19780
                     /gene="UL14"
                     /locus_tag="CCMVgp016"
                     /db_xref="GeneID:935580"
     CDS             18719..19780
                     /gene="UL14"
                     /locus_tag="CCMVgp016"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; UL14 family"
                     /codon_start=1
                     /product="membrane protein UL14"
                     /protein_id="NP_612658.1"
                     /db_xref="GeneID:935580"
                     /translation="MAGAIRLWLPLAAAIVAAVAPTGRCCDGWCPPPILRSPCLQMLS
                     DRNRERRLSSPKMLPYGDRLDVSCIFPSHAWPEVSIHVRLCYWPEIVRSLVVDAHSGQ
                     LLHNDVTCQISSGRWSFEDGGAAQTLTLSFRLITQTAGTYHCVLGNETHGVVTESTAL
                     VADVHELQKTDRSCDLAFGSRTQTKYLWTPDPSKLRSRDCGWEGERHRLVHYIPGSSG
                     EEPSCEENEHQLCVPFIWKSLADNNCSRQDREDEEEDDEDPSSTAAKRQPSSSQLSRD
                     YWPSDPRIGVLAACSVVFTTTVHLLCYWCSKSYRRLTDEGEEALYRRQVAPETEESDR
                     PGRDKGDEKSDPSSHLKDE"
     misc_feature    18719..19696
                     /gene="UL14"
                     /locus_tag="CCMVgp016"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03189"
                     /db_xref="CDD:223008"
     gene            19740..20045
                     /gene="UL15A"
                     /locus_tag="CCMVgp017"
                     /db_xref="GeneID:935581"
     CDS             19740..20045
                     /gene="UL15A"
                     /locus_tag="CCMVgp017"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL15A"
                     /protein_id="NP_612659.1"
                     /db_xref="GeneID:935581"
                     /translation="MRRVIRRHTLKTSDQQLPHAAYPGSPQDGERRRSSGLLSSPPFS
                     GSGGYSILDKKTIIITTTACGSGWWSWTPQQKAEAYLWLMLLVLGLCSWLAAWIHAY"
     gene            20188..20880
                     /gene="UL16"
                     /locus_tag="CCMVgp018"
                     /db_xref="GeneID:935606"
     CDS             20188..20880
                     /gene="UL16"
                     /locus_tag="CCMVgp018"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters MICB, ULBP1 and ULBP2; acts on
                     activating receptor NKG2D; involved in immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL16"
                     /protein_id="NP_612660.1"
                     /db_xref="GeneID:935606"
                     /translation="MAKDRGSVPMMGIAWILFVGGCFGLIDLEKYSNCTYNATVMGER
                     NVTETWTSTGICLSICYYSNVSDDEVLGVAFVSQYNESYTDAWLYKNGTEIRNFTVMQ
                     YNILQNGLQMRHVPWTKLYTHRIINNHTAGRYDCFRCKNGTLEIVERTYVKLGSLYKS
                     LEEYRMMRHPSMSGEEDSEPPANLARDVMIVSGLTLLFFLLGMRIPQRLFQRLKLRFM
                     FQRQRLRDGEEK"
     misc_feature    20188..20871
                     /gene="UL16"
                     /locus_tag="CCMVgp018"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03351"
                     /db_xref="CDD:177591"
     gene            21011..21316
                     /gene="UL17"
                     /locus_tag="CCMVgp019"
                     /db_xref="GeneID:935522"
     CDS             21011..21316
                     /gene="UL17"
                     /locus_tag="CCMVgp019"
                     /note="possibly related to UL19"
                     /codon_start=1
                     /product="protein UL17"
                     /protein_id="NP_612661.1"
                     /db_xref="GeneID:935522"
                     /translation="MEYALFDHFIGRSRETQLTLLFPDETVGTTTHYTPLRQWRDRPL
                     PPLPTTRQRSQSTGSRRYFSFWRGLCLLLRRLFSRRKSDTEPLLASPTQQDGEPMTE"
     gene            21423..22532
                     /gene="UL18"
                     /locus_tag="CCMVgp020"
                     /db_xref="GeneID:935585"
     CDS             21423..22532
                     /gene="UL18"
                     /locus_tag="CCMVgp020"
                     /note="type 1 membrane protein; similar to MHC-I; inhibits
                     NK cell cytotoxicity; acts on inhibitory receptor LIR-1
                     (ILT2); involved in immune regulation; MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL18"
                     /protein_id="NP_612662.1"
                     /db_xref="GeneID:935585"
                     /translation="MFVTCVVTVSVCIWWEVLTEGMHTLNYRYTGILHNESMVLSIMG
                     YFDEQNFMSYYANLTNNVTVTRINSTVDWMRNITDSYPTYWDGEKHKADLIFNYTQMN
                     LIELFFHLGNENENVLTWFHECNTTTNGSFREGYEVFGWDGYTMMELKGNLSRWSKPD
                     NTQRNWVYKKNSTYMEGKIKGVTENDTMIQRNYLTGNCTEWANIYGGHHTPVTHPEVR
                     AGRRHPNGDMIGMFCTAYGFYPGEINITFVRQDDATLSFHNYDDLEPDNGPVLPHSDG
                     TFHKGSSLTTFDNFVYTCVVHHGNWSVELPIRDVEEEHGVQAPTLPYKATAISGVLFV
                     VLCVLLVVALHYLTTLKQYLRRLASGWRYRKVSAS"
     misc_feature    21483..22025
                     /gene="UL18"
                     /locus_tag="CCMVgp020"
                     /note="Class I Histocompatibility antigen, domains alpha 1
                     and 2; Region: MHC_I; cl08246"
                     /db_xref="CDD:298647"
     misc_feature    22062..22322
                     /gene="UL18"
                     /locus_tag="CCMVgp020"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:299845"
     gene            22529..22837
                     /gene="UL19"
                     /locus_tag="CCMVgp021"
                     /db_xref="GeneID:935529"
     CDS             22529..22837
                     /gene="UL19"
                     /locus_tag="CCMVgp021"
                     /note="possibly related to UL17"
                     /codon_start=1
                     /product="protein UL19"
                     /protein_id="NP_612663.1"
                     /db_xref="GeneID:935529"
                     /translation="MTSNALYELFRRRLPRAPVNTVMFLTRRTRDGPCGRLTSVARDT
                     HRTMYVLDHGFVRIERSRDGDQDCTSFVDSLKRCRLRNSHLTLDKEPDVTPRDVAIRA
                     "
     gene            22980..24020
                     /gene="UL20"
                     /locus_tag="CCMVgp022"
                     /db_xref="GeneID:935528"
     CDS             22980..24020
                     /gene="UL20"
                     /locus_tag="CCMVgp022"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL20"
                     /protein_id="NP_612664.1"
                     /db_xref="GeneID:935528"
                     /translation="MARVHVVLLGLCAWLTVIAASEEANGTHIFVSLLTGDGGFTRTA
                     IGGLNLTMNYTNLLQAWNFTNHNQTNNNSMVTTSNLTRTCVKYDTTYVSTIWIVDCNN
                     NSSFWYKGNAYNHSDDTNNCSRSVSAYLQTMCQTWQNFSHGNVSNVTQMEYETRCMLP
                     KKYSVNATAIWYGDYYGDNGVPNEFMEYGETSSLITVTCSFSEAVMIDEVRYFAFIAE
                     MSFIGITGFTCLITTIAVFLILICYCHCNRLLVCPRGFQMLKEYTEEEEQSDHSDNSS
                     PTEEVSISIPGKTLTSEDIQVQVPINPRRLLIPWVRGNSVWGRPPPLPPRPPHLRRPS
                     SVSPAEVVCVTI"
     gene            complement(24149..24553)
                     /gene="UL21A"
                     /locus_tag="CCMVgp023"
                     /db_xref="GeneID:935568"
     CDS             complement(24149..24553)
                     /gene="UL21A"
                     /locus_tag="CCMVgp023"
                     /note="facilitates viral DNA synthesis"
                     /codon_start=1
                     /product="protein UL21A"
                     /protein_id="NP_612665.1"
                     /db_xref="GeneID:935568"
                     /translation="MGGSPDPDLSVATEGVRPVVRADLFRARRPLRRLAFYAPRARRR
                     LFENYHQHHQHLQVPPPIHRIVAVPGGDEEAIPMDLPREIQVAADIPPDRPLPNPLVL
                     LLDDVPPMPPGFAPFRVPREYPVIREENWEHF"
     gene            24817..25208
                     /gene="UL22A"
                     /locus_tag="CCMVgp024"
                     /db_xref="GeneID:935569"
     CDS             join(24817..24899,24977..25208)
                     /gene="UL22A"
                     /locus_tag="CCMVgp024"
                     /note="contains signal peptide; secreted protein; binds CC
                     chemokine RANTES; involved in immune regulation"
                     /codon_start=1
                     /product="glycoprotein UL22A"
                     /protein_id="NP_612666.1"
                     /db_xref="GeneID:935569"
                     /translation="MSRRVLLLGLLAVSLCVALAAPQKRKRSVENEEPAVTKNGDGIT
                     LQGELKETSDGEYPDDNEEDYDVLIEGTMPPEPVEETNNESPQDSEKEDSSEKFEEVK
                     TE"
     misc_feature    join(24865..24899,24977..25166)
                     /gene="UL22A"
                     /locus_tag="CCMVgp024"
                     /note="Cytomegalovirus UL20A protein; Region:
                     Cytomega_UL20A; pfam05984"
                     /db_xref="CDD:283605"
     gene            complement(25564..26439)
                     /gene="UL23"
                     /locus_tag="CCMVgp025"
                     /note="beta gene"
                     /db_xref="GeneID:935570"
     CDS             complement(25564..26439)
                     /gene="UL23"
                     /locus_tag="CCMVgp025"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL23"
                     /protein_id="NP_612667.1"
                     /db_xref="GeneID:935570"
                     /translation="MAHIVRDHIRDCFYSVLDRWKPPLESRPWKRGQRVALAWPRDRC
                     LVVQQRWRSVRDEGLEAERLAGYLCCSERLRFVGSICTYRFLRKKGGSSRPAELYLAD
                     SGAVYLYTDHIYSDSLTWVAECFTEFLHMGLRRCGFITVPDEVPKNAKLKTLAACKHI
                     LDFATWRNMYSGQTIVLGDHSVVRVSVSQLYAWSELYGWQLMVGCSRVEPLGCLVVPG
                     HIVNIFVDEYMRVFGTSHEGACIVADNLLEFATHGMLRYHYNGMFYGTKGMRRMNKPT
                     CPRGRLHNSVRRRSP"
     misc_feature    complement(26023..26361)
                     /gene="UL23"
                     /locus_tag="CCMVgp025"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(25657..25974)
                     /gene="UL23"
                     /locus_tag="CCMVgp025"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(26616..27677)
                     /gene="UL24"
                     /locus_tag="CCMVgp026"
                     /note="beta gene"
                     /db_xref="GeneID:935572"
     CDS             complement(26616..27677)
                     /gene="UL24"
                     /locus_tag="CCMVgp026"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL24"
                     /protein_id="NP_612668.2"
                     /db_xref="GeneID:935572"
                     /translation="MEGGRGRYIVRVEDGEQTASESDASTARTTVETVYATVGASGRT
                     PPVEFSDRHMTDLASLALTAEFGLGCLEAYVRINNNHEIPVAWPPGWSLVLQEPEVDE
                     EFKPEDVKAWSYYLCCETRLAFVGRIIGEPVLSPDQQKKTIAFLVSEDGYVFCYVRED
                     DAVYFIARNLMEFARTGLRAVESLHCLRYLGSSLVKRYFRPLRRAWSLGFDAVARFII
                     RNHGELLPLTYPPGAELRLCNLKCFESCVDGGHLLRAIKESFGSRVIGLGTVNLKGEQ
                     TPFPYLRWPPERVPIVISYTGGVYACDIRSEQYIRLGDNLCMFMCLGLNLLFENRRFS
                     GHNGVHDRVPDCPKGRQHH"
     misc_feature    complement(26619..27518)
                     /gene="UL24"
                     /locus_tag="CCMVgp026"
                     /note="nuclear protein UL24; Provisional; Region:
                     PHA03219"
                     /db_xref="CDD:165484"
     misc_feature    complement(27123..27488)
                     /gene="UL24"
                     /locus_tag="CCMVgp026"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(26685..27062)
                     /gene="UL24"
                     /locus_tag="CCMVgp026"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            27787..29835
                     /gene="UL25"
                     /locus_tag="CCMVgp027"
                     /db_xref="GeneID:935583"
     CDS             27787..29835
                     /gene="UL25"
                     /locus_tag="CCMVgp027"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL25"
                     /protein_id="NP_612669.1"
                     /db_xref="GeneID:935583"
                     /translation="MSSRRRSSSRRNGEHCTVIYIPSSDEDVFVQPRSRNGTEDLDRM
                     EAGLSSYSASSDTRSSFEFVKETAVETPGGAHGHGGSVSGTSLSSSSTPRGAGPNRGG
                     GETGGGRTTAGKPSRRSPKIEARPTSLALATAATMPATPSSGRMAKSPKVSQPPSFPS
                     LTEEEDGAERNSGGDDSSHTDNESSGSDPGAACGPPVADSEFSFCDSDIEDFEHECRQ
                     INASDNLGFHTSVVSPHEVDFIKFVLTESSLQHVASINACVPMPAFALASLVDPVFRN
                     VSPGERDLTRYVVLHAVFINYYYQALGKARHMDTALENTLQSPTVRQMVAHADNQTRA
                     GRATALALHFLRSDKPVTDGQYLACLRRLDDELRRRGTVESPKLTEVYETLRDYNVLF
                     SMAHYTTRGALYLYRQNLQKLNDDHQGALKLLSGEQFSTDHTLNDLAFLVGIELMVAH
                     FRRTIRALRCYIQHQLQTVSELAYFIYLQLPSLRNEYLELMEILYWASSRGDDQPLFM
                     STGALFDFLRYVRNQDAFICTDYVRCALRLMACPDREAEEDDDEDSPGPGDSYNQRVG
                     QFMIRDRLLRDPNHSRPRDRLLTRDLCLPRMQARPTHRHTPVEHVCIPNSLLTKTFTN
                     PPPEEREEDTLRALALKAFMDRAANHSEPQSQHQQHPSSPPPGNGDRARAGGSGPSSP
                     "
     misc_feature    27820..29820
                     /gene="UL25"
                     /locus_tag="CCMVgp027"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03249"
                     /db_xref="CDD:223023"
     gene            complement(30123..30695)
                     /gene="UL26"
                     /locus_tag="CCMVgp028"
                     /db_xref="GeneID:935586"
     CDS             complement(30123..30695)
                     /gene="UL26"
                     /locus_tag="CCMVgp028"
                     /note="transcriptional activator of major immediate early
                     promoter; involved in gene regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein UL26"
                     /protein_id="NP_612670.1"
                     /db_xref="GeneID:935586"
                     /translation="MTSRRAAGGGLNIDEFMHRQRGRHLDLPYPEGYTLFVCEVEDTI
                     LTKRDMAYWKLLVVTEGQVRVIGTLGRLDMFSWDRSVVGVGGDGSVLCYEIGKENFVV
                     RAADSLAQLLERGLLKSYFDDVERARQGQLRHGNRADLQRDANGRPISESAFYVNRAL
                     MRQRVTPRHRQQELTDAMFEAGNQPSALLP"
     misc_feature    complement(30333..30680)
                     /gene="UL26"
                     /locus_tag="CCMVgp028"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(30754..32676)
                     /gene="UL27"
                     /locus_tag="CCMVgp029"
                     /note="beta gene"
                     /db_xref="GeneID:935587"
     CDS             complement(30754..32676)
                     /gene="UL27"
                     /locus_tag="CCMVgp029"
                     /codon_start=1
                     /product="protein UL27"
                     /protein_id="NP_612671.1"
                     /db_xref="GeneID:935587"
                     /translation="MTELQQSQVQTPEPQQEHAKDEHGELDDDERVYRDPLTTYEYLD
                     DCRGDDDEFCRNFIRAYLTPIRNRQEAVRHGLLCRTPEDLATRHQKPRPAGSGKRSKH
                     AMVYVRRSCLAHSAEVTAHGKYDIRGLTLEWDLAVWAALRAIPTMPDPQHFRWNNAGA
                     FRRLVHRARYLPEISRAAKRMALAVATGQYVVCSLLDYKSFGTRTNYLRQLCTLTEEL
                     YMRLDGTMCLFLDPEEREVIARCLPQFLCRGLAVRYRSHRAAVFFNATFGARAETALK
                     RLYSAFCECGDWRDPDVPVEAAEAVAAASQHAHMLPPPHFHLENAELRLENNRHLGAF
                     HLPAIRHLTVDDISRIRASVSRDLGFAEWSQTLVDDYFLLPTGWACANPRRGYVMYLA
                     SNAVLALRIIRLLHASIRHEQTACVRMLSGDVQRLIRLFKGEAAMLRKGLAQNPVQRR
                     ELSRFRKHVHDLKRVRFTVDGFVESFCDFLDVIHRIPDYRCISLRIKRELLCLHTFKL
                     RRVYRPPPSSLLAGSHHNNSVVLPPPTTTNASSPAPSSPHPDPQLLLRAERLAWHYLR
                     HGDVPQDRSRLPQFSSALSDAELSNNANRCRRKAPVEFAGFAGGPSVRYRAHIQRFDR
                     LYVRRFRPHEVGGHAT"
     misc_feature    complement(30757..32448)
                     /gene="UL27"
                     /locus_tag="CCMVgp029"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03166"
                     /db_xref="CDD:177548"
     gene            complement(32817..35132)
                     /gene="UL29"
                     /locus_tag="CCMVgp031"
                     /note="beta gene"
                     /db_xref="GeneID:935566"
     CDS             complement(join(32817..33879,34078..35132))
                     /gene="UL29"
                     /locus_tag="CCMVgp031"
                     /note="interacts with components of the NuRD complex,
                     promoting accumulation of immediate early RNA; US22
                     family"
                     /codon_start=1
                     /product="protein UL29"
                     /protein_id="NP_612673.2"
                     /db_xref="GeneID:935566"
                     /translation="MSSARRKTCVVAPHGMSVPNRVRRARRKRSLAPETFCARDLADL
                     CVRRDYEGLRRYLLRFEGACVSLGWPSQCFYVVGGSHSPYLLTEIDLEHCQNDFFGEF
                     RDMHLIGVVSYAACRYPVFVDAHGAVFAYDAQEDCLYELASDLGGFFAKGMIRCDPVH
                     ESICARLQPGVSLVHPDHKAELCRRSRVSARGRYLRSLLCFRELLACGDDPQARSAYV
                     ESHRDAQLILTWPERHHLLVRNAQDLGLTASALRRFQRSLYTREPLTALGEIEGPEGK
                     TFFNHVKILCGDTGAVYAALVGHDKLVKLARDLKAFVRVGLALLIDDFRYENIGPIDH
                     TSLHEVNPELKLPFKKRRLIVGYFEPLSSLYLRGQPKFSSLWRGLRDAWIHKRQKLRE
                     RLGGVQLQRYVRATAGRWIPLCWPPLHGLLLGDSNYFGVVRDQKIYRRFSCLRQAGRL
                     YFIGLISVYECVPDARVAPEIWVSSQGHAFAYLPGEDKVYVLGLSFSEFYENGLFAVY
                     SFFERDYVDEVVESTWFKHTFAGMYELSQLLHDRAGLLRVCQLNAGCKIRLGGSPACT
                     FTFGSWNVAEADEANGFVIGVLEKARYAVIGWLEPVQKAIFMDPLGGIHVLLYGTALV
                     KLAESLRGFIRQGSFWFRCPRRFCFSPLGSPAATYAGGGGHGGSTGGAGAKPIGLQTL
                     PVCDVSEYVFSDRRMLEGAGLSP"
     misc_feature    complement(join(33879,34078..35087))
                     /gene="UL29"
                     /locus_tag="CCMVgp031"
                     /note="single-stranded binding protein UL29; Provisional;
                     Region: PHA03222"
                     /db_xref="CDD:165485"
     misc_feature    complement(34653..34994)
                     /gene="UL29"
                     /locus_tag="CCMVgp031"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(34182..34514)
                     /gene="UL29"
                     /locus_tag="CCMVgp031"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(33402..33758)
                     /gene="UL29"
                     /locus_tag="CCMVgp031"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(33000..33317)
                     /gene="UL29"
                     /locus_tag="CCMVgp031"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(35220..35579)
                     /gene="UL30"
                     /locus_tag="CCMVgp032"
                     /db_xref="GeneID:935567"
     CDS             complement(35220..35579)
                     /gene="UL30"
                     /locus_tag="CCMVgp032"
                     /note="UL30 family"
                     /codon_start=1
                     /product="protein UL30"
                     /protein_id="NP_612674.1"
                     /db_xref="GeneID:935567"
                     /translation="MADQFRHLDTLRRLLGGGSCAVHDLRGMMDYHDALTRRQQKAFC
                     RAARVLAEGDSASFLDDGTPPRDENNTNHNNKDVEVSPPVLVCVILSVSRPLCRLAPR
                     GRSIRPARPLSLGPKGG"
     gene            complement(35622..35861)
                     /gene="UL30A"
                     /locus_tag="CCMVgp032A"
                     /db_xref="GeneID:15486052"
     CDS             complement(35622..35861)
                     /gene="UL30A"
                     /locus_tag="CCMVgp032A"
                     /exception="alternative start codon"
                     /note="UL30 family"
                     /codon_start=1
                     /transl_except=(pos:complement(35859..35861),aa:Met)
                     /product="protein UL30A"
                     /protein_id="YP_007969871.1"
                     /db_xref="GeneID:15486052"
                     /translation="MACRDARWIRFVRLRTLWSVQPQPHVADLQDFSAFYRGLSESQQ
                     QEFEEEVELACRSQRVRDLRNARLLKKMDSLCQGG"
     gene            36007..37698
                     /gene="UL31"
                     /locus_tag="CCMVgp033"
                     /note="beta gene"
                     /db_xref="GeneID:935541"
     CDS             36007..37698
                     /gene="UL31"
                     /locus_tag="CCMVgp033"
                     /note="DURP family"
                     /codon_start=1
                     /product="protein UL31"
                     /protein_id="NP_612675.1"
                     /db_xref="GeneID:935541"
                     /translation="MGDEDDEPGLVSDGDGGGGPTTVLALFAVSPPPTQQGGGGASIT
                     TLATLPAVVVTSLPSSTLPEEEDTPDGVPTHLAERLKRCRHMDPEQDYRLPARDVVDS
                     WIEALRTSDRDNYGRCVRYAKIHRSSYHLTAYEHYLMSITEQYNSASSVTEKASYVQG
                     CIFLSFPVIYNNSQGTGYKYDWSNIVTPKSSSAELFFLLCSTSESPVILQPLITKGGL
                     CSSMVVYDEETTKNCQNVHIGFLHTQLVMVPFVPHAYPNYAVPFLSLSKDARGLAGVE
                     DAPFGQAVITRHGPALLCRVEHLTWAGKRVTTYGHKRITRYISQFRGTMEDEEAELPG
                     EHDVWVSSKNVQYEFMGLVFTVNVDTVCVDAENRQLLGTISTSYCHRVSDKITARNMP
                     RGFCFYLLTDDHKSRDLQFSRNPGLFFSGDALNCTLLNEPNLFSLTVHAPYDIHFNHQ
                     PRQTVEIDVRYVQTTERCFLVANLPHEDAFYTGLTVWRGAEPLKVTLWARARATVVPQ
                     GTPIATLYQISDSNGNLYSYNHNTVFRQVRSTSSTVFFLGDFKLPTDNFLTTPRT"
     misc_feature    36292..37560
                     /gene="UL31"
                     /locus_tag="CCMVgp033"
                     /note="Protein of unknown function (DUF570); Region:
                     DUF570; pfam04489"
                     /db_xref="CDD:282358"
     gene            complement(37754..40798)
                     /gene="UL32"
                     /locus_tag="CCMVgp034"
                     /note="beta gene"
                     /db_xref="GeneID:935542"
     CDS             complement(37754..40798)
                     /gene="UL32"
                     /locus_tag="CCMVgp034"
                     /note="major tegument protein; binds to capsids"
                     /codon_start=1
                     /product="tegument protein pp150"
                     /protein_id="NP_612676.1"
                     /db_xref="GeneID:935542"
                     /translation="MSLQFIGLERRDVVHLTGFLKHLINKADVDLEKHPKVLRRCGEK
                     RLHRRTTMFNTLMLWLGYYRELRFHNPDLSPLLEEFEMRCGAVARRGHIYPFRDRARA
                     REHLAVVDSTEFDSEVRHDADIVEKALRSAVILAKLAARTELAKGLNAIEPIVFVNLA
                     EREMQMMEENLEKVRHNMFQVKPLKLNLDRHANAPLINEVNKLVYTGRVIINVRRAWE
                     ELEKKCLTRIQSLCKQLVKELRTCLGFESNYCRNILKHAVTDGDSSDTLLELLAEDIH
                     IYIDAFPQSANTLYGARSPSLEYDDENLFARARLSKTGPTKASSDWTWTTSPWNRDGG
                     AKGGHQTPFHFDVNNNPFLDKKTREEIEREKKRDREWERKQKALRDAATQGRTADAGR
                     TPMRTRRGSPSLFRESSDDDDDDDIDGRTFAPIRNPSTRPSAPGSAGSGIFSAPKLGS
                     NIAPPYRQTAFDILSPIPTRASDNRLRRDAAWESVTPLTVTRSSDWLTEEDSGSDDYQ
                     LRGYAPTGPRPSSSRVSNTLVDLTTPGGNAAQPQQTSYKFETVPLVTPQPSSILMPIR
                     LGTQTPSNPSAAPAPASTPTLGGNSESPLISIDSGTTPPMTEQQAAAIRNNPNRAWAV
                     KVPWLAVNDFAPYAQSTKPTLTPAALSTQPLVPTSVWQPSPNKSSIGSTRLSSATRTP
                     ASIINTDSEDSDSEEATSSDASSVKSQRTVPPKRPFTFKTPTMTGPQKSTRTFTPPVI
                     PSTGTQTPVFGARVRTPAPTARAQTVSSSPVSPAPPVKSQAQPMGSRISTAPTMPASF
                     LTPANVPKTPSPLAVPRPATTAVKTPASATSSPLRSPASMLSSAPTSAPSSATSSPVK
                     LTIRPQPSLKPTHAGKAAVGTAPKMTASKRVLPATATTTPVQARKATVTVEPPSNKPA
                     SAPATTLPSILKPQTASLLSGTKSLPPPYVTPPGATVITMSPSKTTTTSRLVTFDLQS
                     PGGSPAKTGSAVIAGAKTGKEAVESIISKIKGEQEKERKNEE"
     misc_feature    complement(38063..40798)
                     /gene="UL32"
                     /locus_tag="CCMVgp034"
                     /note="Herpesvirus large structural phosphoprotein UL32;
                     Region: Herpes_UL32; pfam06070"
                     /db_xref="CDD:283680"
     gene            40885..42299
                     /gene="UL33"
                     /locus_tag="CCMVgp035"
                     /note="beta gene"
                     /db_xref="GeneID:935546"
     CDS             join(40885..40911,41028..42299)
                     /gene="UL33"
                     /locus_tag="CCMVgp035"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; involved in intracellular
                     signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein UL33"
                     /protein_id="NP_612677.1"
                     /db_xref="GeneID:935546"
                     /translation="MDTLLHNVTNRSGGIPHVRDACNQTETLQAIRTTEAFLNLLIIL
                     VGGPLNAVVLVTQLLSNHVHGYSTPTIYMTNLYSTNFLTLSILPFIVLSNQHLLGTNV
                     ASCKFLSVIYYSSCTVGFATVALIAADRYRVIHRRTYARQSYRSTYVILLITWLMGLI
                     FSTPAAVYTTVVAHDDKNDTMNASDTSNGSDTNNTNASYHTCVMYFVADEVYTVLMSW
                     KVLLTVVWGVAPVVMMTWFYTFFYYTVRRTAQKKKSRTLTFVSVLLLSFVILQTPYVS
                     IMIFNSYATGKWSLECQHQTLRLTVSTLSRLVPNLHCLINPILYALLGNDFLTRLRQC
                     IRGQLFDRRAFLRSQQQHGGTTDAAGTTQLLPTSPTSGATSEHGKTSSGTKPARVKRG
                     QTFNVPGDTPKSRPKTTCRQHGVSLGQRLSQSHHNLSLGV"
     misc_feature    join(40885..40911,41028..42293)
                     /gene="UL33"
                     /locus_tag="CCMVgp035"
                     /note="DNA packaging protein UL33; Provisional; Region:
                     PHA03235"
                     /db_xref="CDD:223017"
     gene            42681..43778
                     /gene="UL34"
                     /locus_tag="CCMVgp036"
                     /db_xref="GeneID:935548"
     CDS             42681..43778
                     /gene="UL34"
                     /locus_tag="CCMVgp036"
                     /note="represses US3 transcription; involved in gene
                     regulation"
                     /codon_start=1
                     /product="protein UL34"
                     /protein_id="NP_612678.1"
                     /db_xref="GeneID:935548"
                     /translation="MEFIITTRDFSNDDSVLRAAEMRDNVAGTISKAYKGTVRAEGKK
                     KLLLKHLPVQPGGCTRRNGNLFVFCTDRDYRKFHQGIAQLKRAPVDLEPSEIQQVTSN
                     IRCRLQPSERDPPAPTDDLQTAVSRVCTLFNQLVFTAQLRHYCEHQEKIVAYARDELT
                     KRCGERSALGVEVHALVALLPHERHRDLCNVLIGLLHQTPHMWARSIRLIAILRHYLQ
                     NSLLNLLVSSGLDISQVFDACYQSEAYRILFQIGNSDSPAPSPSYCVPDEEAAAALEL
                     SQRASAAAVLAAAANIRQRLPPPLPSSRPPAPRRRRRVKHRSSGGDEDDERDDNEDEE
                     EAAAAAGEQRGGEEEQQQEETTTTTPTPLCI"
     misc_feature    42681..>43637
                     /gene="UL34"
                     /locus_tag="CCMVgp036"
                     /note="nuclear-egress-membrane-like protein; Provisional;
                     Region: PHA03325"
                     /db_xref="CDD:223044"
     gene            43857..45815
                     /gene="UL35"
                     /locus_tag="CCMVgp037"
                     /note="beta gene"
                     /db_xref="GeneID:935584"
     CDS             43857..45815
                     /gene="UL35"
                     /locus_tag="CCMVgp037"
                     /note="UL25 family"
                     /codon_start=1
                     /product="tegument protein UL35"
                     /protein_id="NP_612679.1"
                     /db_xref="GeneID:935584"
                     /translation="MSQQPGQPPPAAGPSQAPRPAPGPSPTLPVLPVDDALNFRPDLF
                     GDDHRRLLLDMLTQSCSGFVGLLNHGLPSPTYLLESLVDFQIRNPYLRVKPVAQQIVK
                     ICILANHYRNSRDILVDLRTQLDVLYSGTLRTRILNGLLKLCRRARESGVTPEEISVH
                     LGADDVTYGVLKQVLGKLHRIRDALGLRPTPEAEVRYSTLTAYNLLYLPPPFTTQEAV
                     EVFAENLSNVTQRNNRPMRCMASIKRPGTRSHEDALNDLYFLVSARHLQLRHTLELQM
                     MRLWVLEKCNRLCDDLYFCYTQVPETRQILVTLIRGLQLSRQSTSPAFRPVLYNLLQM
                     LTQLHEAGVYLCPGYLHHAAYQLLEKIQRISDGRGGEDEDEDDEEDGEEGRRHRDPRT
                     LPREISLDLESDPTAVQGETFFLSKNLYGNPDIFRVPDHPSRYLRRRMFVHRQDIPQI
                     FYNIHNGEITTEIYNLRRIYSMMIEGAARQTGLTPKRFLEIMDRAPLGQEPEPELADG
                     YDLFADVERRPMVVTSSSTSSAASSSAVASTSSASDYGTGASSSGVTFTRPTTTAAFY
                     TSPSSRMDLERAPRQRRRMVSVEPFSPYSVAYNQHRHQRRRRRPPPPAPRGPAHTRYQ
                     GPDTERTPYRGDDDEDPRDGLAETLRNL"
     misc_feature    43899..45803
                     /gene="UL35"
                     /locus_tag="CCMVgp037"
                     /note="UL35; Provisional; Region: PHA03250"
                     /db_xref="CDD:165509"
     gene            complement(46071..47603)
                     /gene="UL36"
                     /locus_tag="CCMVgp038"
                     /note="beta gene; immediate early gene"
                     /db_xref="GeneID:935552"
     CDS             complement(join(46071..47305,47402..47603))
                     /gene="UL36"
                     /locus_tag="CCMVgp038"
                     /note="inhibitor of caspase-8-induced apoptosis; involved
                     in apoptosis; US22 family"
                     /codon_start=1
                     /product="tegument protein vICA"
                     /protein_id="NP_612680.1"
                     /db_xref="GeneID:935552"
                     /translation="MDDLRDTLLSYGCIAVRAEDFNSLNEFLDQECGARLHVPWPERC
                     YIQLRSRSALGPFVGKMGTVCSQGAYVCCQEYMHPIGFLEGPGFMRYQIIVLVGKRGG
                     VYCYDDLHDCVYELAATMKEFLRVGFRNCDVFYTMRDYQRPMVEYDDYWNSIMLYRSD
                     VESMSAEIARRGYRSYVIDDPFDECPDTHFAFWTHDGEVMKFKENSFSVVTGGGVIQT
                     MELMIHTVPRISCYHQLLGALGHEVIERREFIVRQYVLIDNFGTVYGYDPAADAVYRL
                     AEDVVMFTCVMGKKGYRNHRFSTRREALVRLEKTPVCQHPKKTPDPMAMFEDDDEADQ
                     PPQPRRIPSHEEAEGRICDAILESMLASAKMVLSDSHIATHMWPQELKALADNSSVMH
                     LCATATEGDVEAVRQKILGKVGTLNHFELSFRFQDDEPETYMGFLWDMPPCERCVRRR
                     RYKVCDAGRRDLIPPGANVMAPLTPPHV"
     misc_feature    complement(join(46074..47305,47402..47603))
                     /gene="UL36"
                     /locus_tag="CCMVgp038"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03244"
                     /db_xref="CDD:177567"
     misc_feature    complement(join(47103..47305,47402..47555))
                     /gene="UL36"
                     /locus_tag="CCMVgp038"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(46620..47039)
                     /gene="UL36"
                     /locus_tag="CCMVgp038"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(47771..50491)
                     /gene="UL37"
                     /locus_tag="CCMVgp039"
                     /note="beta gene; immediate early gene"
                     /db_xref="GeneID:935577"
     CDS             complement(join(47771..48709,48805..48847,50046..50491))
                     /gene="UL37"
                     /locus_tag="CCMVgp039"
                     /note="type 1 membrane protein; involved in apoptosis;
                     involved in gene regulation; viral mitochondrial inhibitor
                     of apoptosis (vMIA) located in N-terminal domain specified
                     by first exon"
                     /codon_start=1
                     /product="envelope glycoprotein UL37"
                     /protein_id="NP_612681.1"
                     /db_xref="GeneID:935577"
                     /translation="MSAMSLPYVHLVGGVGLLTFWYLSYRWIQRKRAEDPLPPWLRSE
                     VRRQQRRTRLQRQYGVIEGEEWPRDLTFALFGRTGQEAEENNNDYSCPDYYAGERRRE
                     EEIETPDPEVNPLDAEGLTGLAREAYDALKKALLRYRSRRQARCETHVGVFYRVAEKR
                     GSQVFITLLALLSACVLTVHGVTAGCTYSAPVNQTDRNGGFQNCKMNCTYNGTVIYCG
                     PCLGAKKALQLNMTFPRKGNRHWHARMLNFGLRFHLEGLFPSWVLNQSDLKSNVSQVD
                     GAIFCNTSLIDRRNITTGLLTLNLTTLNIGYVLRAASNVDVTRRHVYWNVTRNDTDNA
                     TDVVKTVLSRHVESNYIFLQDVCPRLLRRFQRLNVSITNVTVNGGSNNVTAVWNDTES
                     WGMWSKLSVMWKNRRVEFLRSQSRALGHWAMISMFSATAGTLVILSLFCMVSFWRRRD
                     LIEDFRYTRQDDDHFFIDSGVDNAV"
     misc_feature    complement(join(47774..48709,48805..48847,50046..50482))
                     /gene="UL37"
                     /locus_tag="CCMVgp039"
                     /note="UL37 tegument protein; Provisional; Region:
                     PHA03171"
                     /db_xref="CDD:165442"
     gene            complement(48924..49967)
                     /gene="UL38"
                     /locus_tag="CCMVgp040"
                     /note="beta gene"
                     /db_xref="GeneID:935573"
     CDS             complement(48924..49967)
                     /gene="UL38"
                     /locus_tag="CCMVgp040"
                     /note="involved in apoptosis"
                     /codon_start=1
                     /product="protein UL38"
                     /protein_id="NP_612682.1"
                     /db_xref="GeneID:935573"
                     /translation="MAAVATTHATTAIMSMLDEAERQQAQVDVGSLIQASTLGKVALR
                     CLVKKFMKRGVRLPHDSGLYVCICDPTYEFLTMNLAKINWLERHCPPLDQELVMFGVI
                     ESWEEAAPRPTRQVVLFMTPKWDVFAYESGLLFYLAPSMSQFWHGVIVFEYWNALFPV
                     EVRNHIRQYAQSMDDLLMIYHQLDYEKQVLEARRDKNAVGPRTFAKSVNCYVRAILEA
                     ERRIREGKMPVAFVDRDSLRANSLIVTDQPQQQPRQSQQSPQQRRRGHHAHFVDIAPR
                     PTVHRVLSAPPNMLSSANGVTVLPPTTPCEMDESSCSSTSSSTCTASPSPPLIVGAEE
                     TVYTSDDIQMVVV"
     misc_feature    complement(49506..49853)
                     /gene="UL38"
                     /locus_tag="CCMVgp040"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(51007..51606)
                     /gene="UL40"
                     /locus_tag="CCMVgp041"
                     /db_xref="GeneID:935574"
     CDS             complement(51007..51606)
                     /gene="UL40"
                     /locus_tag="CCMVgp041"
                     /note="type 1 membrane protein; sequence in signal peptide
                     inhibits NK cell cytotoxicity; upregulates cell surface
                     expression of HLA-E; acts on inhibitory receptor
                     CD94/NKG2A; involved in immune regulation; contains
                     HLA-E-binding peptide; upregulates HLA-E"
                     /codon_start=1
                     /product="membrane glycoprotein UL40"
                     /protein_id="NP_612683.1"
                     /db_xref="GeneID:935574"
                     /translation="MRTHFMITTMAPKTLLIIVFLGLPGQMTATTPTTTTGAVISSTP
                     KSNTSYCQKVFEGWVYAMYHKGGMNLMTVDVQCCRPKDNNSEKPELLIDVGNKTRTGT
                     CNSHPPSVQPADCHTDIVHVSGLDQSRFYLSSLRSCCLNQPSRLSEKVAYHLRMRPAN
                     FGLETWAMYTIGLLGLGSFSSFYPQLIKNLQTYHYAGKA"
     misc_feature    complement(51013..51603)
                     /gene="UL40"
                     /locus_tag="CCMVgp041"
                     /note="Glycoprotein of human cytomegalovirus HHV-5;
                     Region: UL40; pfam10682"
                     /db_xref="CDD:287634"
     gene            complement(51726..51992)
                     /gene="UL41A"
                     /locus_tag="CCMVgp042"
                     /db_xref="GeneID:935575"
     CDS             complement(51726..51992)
                     /gene="UL41A"
                     /locus_tag="CCMVgp042"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL41A"
                     /protein_id="NP_612684.1"
                     /db_xref="GeneID:935575"
                     /translation="MPTPAIMSSFCYYHSGNDTNASGVDMSVCIGMVGVVCFLIGLFL
                     VICCSTFKAFQSRRQVYRMLSTESDDEETTLWEKKPRRDSDTDF"
     misc_feature    complement(<51819..51938)
                     /gene="UL41A"
                     /locus_tag="CCMVgp042"
                     /note="Protein of unknown function (DUF3262); Region:
                     DUF3262; pfam11660"
                     /db_xref="CDD:288505"
     gene            complement(52048..52488)
                     /gene="UL42"
                     /locus_tag="CCMVgp043"
                     /db_xref="GeneID:935576"
     CDS             complement(52048..52488)
                     /gene="UL42"
                     /locus_tag="CCMVgp043"
                     /note="contains potential transmembrane domain; contains
                     hydrophobic domain"
                     /codon_start=1
                     /product="protein UL42"
                     /protein_id="NP_612685.1"
                     /db_xref="GeneID:935576"
                     /translation="MDPTPILRDEEGRDGGQDDAPPSYEQAVGLGPPPRYEEAGGPHV
                     AITMNAAPDHNNNRLPLPNCSPPPYRPPYCLMSSPPRRHTFDMDMMDIPATMHPPTTA
                     YLDQSWKWSAALMVVAVLGIIFLAVVFTVVLNRRNGNTVTGTSG"
     gene            complement(52531..53796)
                     /gene="UL43"
                     /locus_tag="CCMVgp044"
                     /note="beta gene"
                     /db_xref="GeneID:935560"
     CDS             complement(52531..53796)
                     /gene="UL43"
                     /locus_tag="CCMVgp044"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein UL43"
                     /protein_id="NP_612686.1"
                     /db_xref="GeneID:935560"
                     /translation="MESSQKPRDRVPCITNMPGGGRSGSNVRRRPACIGDIRRRSSSL
                     SQVSFEAAPGELERRDSGTSTRSGQHHRPLRRRSSGLDVMKERSLEDALAAELVNETF
                     RCSVAPDARKELQKLVRRVSGTVLHIGWPFNWYFTYCDLLRLDYFSHLNIKGLEKVFL
                     CCDRFLLPVGTACQGEPGRAPLAIFIGEGGRVYCYAPSGDCVYLISRSGFHGFVSNGL
                     RNFAPLREELGWTHFDSGGDLGWEFVVARDLMSLWRLCMKHEGSVFSWVDNRESMTTC
                     VLNGGQTYESPHHPTWLKDTGSLNVLQIFTVKAVQVEPHRRLDISILVNECGLVFGVH
                     PETNRAHFLARGLQTFFNVGFLRFNNNYCFGRDCFSHPESVLPAFRATSCPRDVFCRR
                     LRKKRGLFGGSSSPRSLPPTLSSSPLLRR"
     misc_feature    complement(52588..53796)
                     /gene="UL43"
                     /locus_tag="CCMVgp044"
                     /note="UL43 envelope protein; Provisional; Region:
                     PHA03175"
                     /db_xref="CDD:177551"
     misc_feature    complement(53122..53478)
                     /gene="UL43"
                     /locus_tag="CCMVgp044"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(52711..53061)
                     /gene="UL43"
                     /locus_tag="CCMVgp044"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(53845..55122)
                     /gene="UL44"
                     /locus_tag="CCMVgp045"
                     /note="core gene"
                     /db_xref="GeneID:935561"
     CDS             complement(53845..55122)
                     /gene="UL44"
                     /locus_tag="CCMVgp045"
                     /note="dsDNA-binding protein; involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="NP_612687.1"
                     /db_xref="GeneID:935561"
                     /translation="MERKTRLSEPPTLALRLKPYKSAIQQLRSVIRALKENTTVTFLP
                     TPALILQTVRSHCVSKITFNSSCLYITDKSFQPKTINNSTPLLGNFMYLTSSKDLTKF
                     YVQDISDLSAKISMCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDYAVVAELIKWI
                     GPHTRVKRNVKKPPGPSGAVQILVHAGPPAIKFILGNGSELEFTANNRVSFHGVKNMR
                     IGVQLKNFYQTLLNCAVTKLPCTVRLVTEHDALLYVASRNGLFAVENFLTEEPFQRGD
                     PFDKGYGGGGGGGKSTSRGGGGGGGLSNAGGSSMHDDGSGLENDLLGEPMLGLGGIGG
                     GGGGGGGGGKKHGGSSSRNKMGNVERDHDHGKDKYEQHKITSYLTSKGGAGGGGGGER
                     NSSSYFNDAKEESDSEDSVTFEFVPNPKKQKCG"
     misc_feature    complement(53848..54777)
                     /gene="UL44"
                     /locus_tag="CCMVgp045"
                     /note="Herpesvirus polymerase accessory protein; Region:
                     Herpes_PAP; pfam03325"
                     /db_xref="CDD:281337"
     gene            complement(55334..58171)
                     /gene="UL45"
                     /locus_tag="CCMVgp046"
                     /note="core gene"
                     /db_xref="GeneID:935562"
     CDS             complement(55334..58171)
                     /gene="UL45"
                     /locus_tag="CCMVgp046"
                     /note="enzymatically inactive; tegument protein"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="NP_612688.1"
                     /db_xref="GeneID:935562"
                     /translation="MSQGEDSPLLPSSPYRVAASSNTRAPSSSSSLFSAIGGADNSSE
                     DDDDSEIEEGPLSSSSEDEAVAGHVDIMETEESGESVSSSDGVRRHRPSFMRQLGVVE
                     EHDENGDCGIVAVGPVLGDGDLFCDSLLSPGCGGRIPVQTQTVSSSSSPSRPVSAPVT
                     CLERDGTLTRGSPPAPSKAREDEEDFGASLCKISPVISAVRAVMGKKCHCHGYWGRFR
                     FCGVQEPVRETVGDRTALWREIDALARHGGGLGSFRLFQMVMRHGPSLIHQSPRTDLL
                     LGRFYIKANWPRESRSPLSYASELCDDSLRRFVLRHADDLPRVADETYRFVELAGCWG
                     LYPAILCLDKICRQLHGQDECLGGVFIRVAASVTAAIEESLHSRIYRFLLNVRHEAEV
                     LEAVLRRCRDGQLSLSTFAMSTVGFDKMPCYDFLISADSFARDAGWAAMCKWMSSLSC
                     GVSVSINVTRLDVDATSVIRCLGGYCDLVREREVHRPVVRFFVDLWDVAAIRVINHIL
                     KECTSEPTGVCYAFNVPSLLMKRYRGRQPQYCLFGRAVARRLSDLGHEAAFDREYRRC
                     EESCPKVTVNTEDFLKKVLVCALRGRASVVFIHHVVKYSMLACESNLCLPACLSPDMA
                     SCHFGEYDAPVQRLMVNLSRCVFARSEQHEPHSPDVVLGNTRRYFDLRVLRELVTEAV
                     IWGNARLDALVAASDWWVENAVDRLRPLHIGVVGLHTVLMRLGFTYFASWDLIERIFE
                     HMYFAAVRASVDLCKAGLPRCDWFERTIYAGGKFIFELYRRPRLSLPPARWEALRADM
                     LEHGMRNCQFLSVGPDDEVAHLWSVTPSVWAARDCVYDEETVWSLCPLNRECYFPSSA
                     RRSLRVPVVNYAWLEHQEDGKAAQCLFQRAAQIQNDVEVSCVNLSVFVDHCVTPLFYY
                     DSSMTPDVLLSRMLKWYHLHLKVGVYKYCSS"
     misc_feature    complement(55655..>56614)
                     /gene="UL45"
                     /locus_tag="CCMVgp046"
                     /note="ribonucleoside-diphosphate reductase, alpha
                     subunit; Region: NrdE_NrdA; TIGR02506"
                     /db_xref="CDD:274170"
     misc_feature    complement(55733..>56170)
                     /gene="UL45"
                     /locus_tag="CCMVgp046"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:299130"
     gene            complement(58307..59185)
                     /gene="UL46"
                     /locus_tag="CCMVgp047"
                     /note="core gene"
                     /db_xref="GeneID:935590"
     CDS             complement(58307..59185)
                     /gene="UL46"
                     /locus_tag="CCMVgp047"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="NP_612689.1"
                     /db_xref="GeneID:935590"
                     /translation="MMDARTLAKRPRDPADEDNELETALKAKREVNTISVRYLYHADH
                     QCLTARFFAPEGLVEFEAQPGSLILRMETGCDSPRHLYVGLYLLGIRASNVTAATRCL
                     LETVYASSPARAALQWLDLSPQWLLHRRLETVGCVKAVSLGMTSLLTCVMRGYLYNTL
                     KTEVFALMIPKDMYLTLEESKGRLQFVYLMIIYDYEEGENKPAIYVVTTCLGHWQTLV
                     DVVRGKFARQRCGFVNRRITRPRQIPLCTGVIQKLGWCLADDIHTSFITHKETKLSVF
                     RLDNFCVEIGEFREFV"
     misc_feature    complement(58310..59095)
                     /gene="UL46"
                     /locus_tag="CCMVgp047"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03262"
                     /db_xref="CDD:223027"
     gene            59184..62132
                     /gene="UL47"
                     /locus_tag="CCMVgp048"
                     /note="core gene"
                     /db_xref="GeneID:935512"
     CDS             59184..62132
                     /gene="UL47"
                     /locus_tag="CCMVgp048"
                     /note="complexed with large tegument protein; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="NP_612690.1"
                     /db_xref="GeneID:935512"
                     /translation="MSKRTVDLKKLVDQLRHGAAGSQETLNILSRVEIGALDALEVNV
                     GLLRAFVSALQNVSGYHFGFVRNHTVFYVLSHATLQAARQPLDAAQHLYDHLEKFVAR
                     DSGAAAGSELEVYDNTKTLDAFKKLIEAVRELFTIVESQHPFPASGAAGVSSEKRAKK
                     DGSGGGPGGDRGSQALVRQTLARLEELRRQVEPYLNCRAVAELVDMAYQHVTYWACTL
                     MFYTAFRKDTDTALDRVLLMYYFYTHYGPVNGDVAAEFQEYVRNARSLKAFLVSDVDA
                     DQQPGAEQIRDVSYRLFTGSLQQRDSTGLTFPVISTKPSVVSNHHLTPERLFFHPGLV
                     TRLLSEEVSSTQASRQRLEPLQTVCARIIDRYFASQLKVTKMQDLIDVAHDLVGLGFN
                     YNTCSAYAQTALMQPANLRSPLFVDETKNQLIMIIYNAYMFFLCLYVYSPTFFFEHRR
                     RQILEQNQSTLVGSREELHGIWETVLLNVRAYFPLRYTEEQFEAHTRGTTNAEREYLY
                     RDLSIKWGTMLFVLRPRGGPGGGAGRTTPLPSLDGVTRNDIVRQCGMLRLSDGPVSYE
                     PLLAFSSHQDFPQVFAQLVLVPQFSEIFGIPQGQFETVGSPRLMTLIQLCRILMPDQV
                     TLYQNLVSIYNLTHFVRQVDASVFKTVRDCTLEIAVILSQLSGETVKPNIDLLVQLML
                     QSLSHNLATTVDPVIRDITRSSSGSLQNFIRHTRLCYCLALSRAHLSKDMQTVYLEIE
                     SRHLHLPTARFLQQLKDLIRADKLLSDSMRHLSERLQVIRTRVKQVTQDTEEISRYSR
                     GHPSTTEMGRSLKKMTTQLRQLETRVQNSLQGAQRSNGRVIASLERVLKTFEVLSTQN
                     LERQGLTLCLTEAAGLVQEARSFQPFPVTGTAAGSGVDAEKTLRDFFEGPWEGAAEPR
                     RLSMTTTTDSEQMPPFPDVMGDRYDPQNPIGDLLNWYIVSVDQAQRDIFSSIDPPAGH
                     ASPVPRTPQP"
     misc_feature    59205..61967
                     /gene="UL47"
                     /locus_tag="CCMVgp048"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     gene            62129..68956
                     /gene="UL48"
                     /locus_tag="CCMVgp049"
                     /note="core gene"
                     /db_xref="GeneID:935563"
     CDS             62129..68956
                     /gene="UL48"
                     /locus_tag="CCMVgp049"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region); involved
                     in capsid transport"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="NP_612691.1"
                     /db_xref="GeneID:935563"
                     /translation="MKTFQATCDQSNRERFGARAGNQCVCNSAMFIHAAHLLGLSPSS
                     PLLAQEALDAVLQEGARLDARLEKDLQKKQPGKKLPVYRMGDEVPRRIDSSFGSTVHA
                     LSRPFNGTTETQDLGGYQCLGIFDFLRYAYAKQRPVYMLIIVNSLARAVIITPQDLIF
                     VFDPHRTSQCSNAAAYQCESLHEVVMLLTSFGAALSNFYYDALFLYMLDLSSGPALPE
                     AQINSLIVTTYRDRDLDLPVPTSLTGPASLTTVAASVLPALPAPPQVCPASDIPPGTD
                     RPLPIPPDDALPLAPLVPPPKKTPEKRRKEPGESKHGGKKKPAAPTTPTSGQAPSALA
                     TTATPYSCAGALPALQQYQQMVSQMEQQLRGLTIDAPPQTSWTLYSSSPSADSGSGTA
                     GTGGAATFDESFLGDRVQQLLIHAINHLSCLESDCDPTSTAAQTVSSFYGFNTGINAF
                     LSNWAHHGLNLRKMHDYLQHKKSISSVLDRALIDKMLKVFEPWAQRHGAALVTWVDEL
                     MRQVERTQLSDLQRRLEKYRTRNPVPVNQSFVCLRPSDFKKITQTIGTRQESIQRQRE
                     KSQNLYNQLAGMLISIDIHDIGSTEINKREVSKALTQVDEAARRELQQLGTHKMLELQ
                     QDVNRLSVELLARRHNQILAGFLPLEELQALERTIDQVLEVLNDLTVLGLCEPGLEAG
                     FQNVKDQFSYLMTGNAVNEYSLLEEITRLRQQYLLATQQREDVLIQVQDLIFSLENLV
                     KDPSPQRGSQTTLAMVHEQMSQLQALGALDMPEVRARLQNVERGLNKLYEEEDETREY
                     LRTLSYDNPPTDQGLKRYGRLKAMLRDDADARLLLLNTILRIFDDMVKRLARDDTLRP
                     QVFDAVNSLINHLPPGSEEMENLRAANAIYSQLSKKMDAVAKTPAGAAPGDPKRLQTL
                     KELTYFFMSNDQFFTHMLKLNVGADVRELYERYKRELEQLHVERLEKEWQEEAEKLPV
                     TSHDDVRRFLDRAPSTRILARVQPRLMTRLHEFLDKENRRQEEERRRQLDEYRQMAQA
                     DLARAVESVRNDTLSTVPGMRLEETQEILAGLDPRAQEELLRKFNHDMLGALSQLRKT
                     LDDRISQCMQDVLSGETARRRSYAEHATQTRASLTHLRRVMGPRLMQETQRTLDEVTR
                     QATFIERCQLGDAETVFTGTDYEQDYARYRQGQQQLQQQLNTAREELTRASQDLENAI
                     RDPKQLPGPGKKDSGAAAALAGKKGIDARTLTGRITPPPDNFGRPLFKTMLDKQAETA
                     KKALQDETELMNQKLQSTVKLREEYVTSLQNQWAELVTRMKMEWLDVATPDTKSLLEN
                     PVWALTEMLGKTVPTMPYVAAERALRWAALFIQEAVKQISGDPSHPQRAQQQMYETLQ
                     QRTAQSLDTVTRNVNVNAACENFVSQQQQEGGGLAGTADPEVIQAVEAAWQQLDPARV
                     AGGEQRHQRVRETLHRLSQSLTELELQDALVSEYLQLLHNIQTFSYGLDFKAQLDKIA
                     DLKTRFTDLARQRNVRLSSDAPLPDPRDPNVGASHLSTFVRGLQALERHVLSALTYLT
                     EQVNQCPAIVPRLDDIPRVMPPAQTDGSLVTQDRLKRMCFSRRDDLFIQVLDVFGTEQ
                     LVTPKGESIQFTAGYGNVVFKYLALRQDERSLARKCSGLKNVVSVKYKAVTVSVAIAQ
                     TLKAFWPQITRYDLKPYFSQQQQQQRAAQDGGSVPLGPAQPPEANTLLNLKLFCYVVL
                     MAWDQQIDPWQEGGQGGQPLRLTPDEFCIVMTTFSPEYIYTIMKYPLQMSLASLTTGI
                     QRDIVNNALSNTSMPPDYSGDQVKGFAFDRTLWPQVSLSKLFWDSEIMRQLCQAAGPA
                     GQSRQHAGKLLMYALCTLVFPQDMLHCLWLELKPKYAEVYASVQELVQVLFKIFSQQC
                     RLLNEANTQTQLPTGERVLQSIRVQRQEREKNDTDSGWGGTGGDDSDLLETFINTETA
                     LDMALGSWLFGIPVCIGVYVTDLAKGQRVLVTRHIEYTNNDPDFKNIQRIKDLNLNPL
                     VSKTWTETPYEQCWYQAQVLRLRQYLRHPVRFVYTPLVVYTPQERYVHLAVRPPTPGQ
                     RHEIPRLTVENPFVPYPLDEDSYPADGAPLPALPPLSSSSSSSASGPAATAPPAPLNR
                     VPVSIDFLRQNPPPLTRPPRPAWRHRHRTAAAAANYQQQLPESSVDPEDYGTSAFFDS
                     ALSTQTFNDPIFQPQSVEEAAMCRDELMTVAPSAARTDFITPPLTVLTQNILSALEIL
                     RAVRIDLRALAQSVNETLNRLRFLYLL"
     misc_feature    62147..62692
                     /gene="UL48"
                     /locus_tag="CCMVgp049"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:282670"
     misc_feature    62834..63178
                     /gene="UL48"
                     /locus_tag="CCMVgp049"
                     /note="TonB N-terminal region; Region: TonB_N; pfam16031"
                     /db_xref="CDD:292650"
     misc_feature    63521..>65743
                     /gene="UL48"
                     /locus_tag="CCMVgp049"
                     /note="Chromosome segregation ATPase [Cell cycle control,
                     cell division, chromosome partitioning]; Region: Smc;
                     COG1196"
                     /db_xref="CDD:224117"
     gene            complement(69018..69272)
                     /gene="UL48A"
                     /locus_tag="CCMVgp050"
                     /note="core gene"
                     /db_xref="GeneID:935448"
     CDS             complement(69018..69272)
                     /gene="UL48A"
                     /locus_tag="CCMVgp050"
                     /note="located externally on capsid hexons; involved in
                     capsid morphogenesis; possibly involved in capsid
                     transport"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="NP_612692.1"
                     /db_xref="GeneID:935448"
                     /translation="MSSAAAAGVGSVGGMTSNKRDDKQRHVAGVVLELPTELMPDNNN
                     HHPVVGAMLSKYVRMSSLFADKNAFKLDFMRMLAVSRTRR"
     misc_feature    complement(69021..69236)
                     /gene="UL48A"
                     /locus_tag="CCMVgp050"
                     /note="Small capsid protein of Herpesviridae; Region:
                     HV_small_capsid; pfam17086"
                     /db_xref="CDD:293691"
     gene            complement(69265..70959)
                     /gene="UL49"
                     /locus_tag="CCMVgp051"
                     /note="betagamma gene"
                     /db_xref="GeneID:935556"
     CDS             complement(69265..70959)
                     /gene="UL49"
                     /locus_tag="CCMVgp051"
                     /codon_start=1
                     /product="protein UL49"
                     /protein_id="NP_612693.1"
                     /db_xref="GeneID:935556"
                     /translation="MSSLLSSWEAAAGDAFHEALLRLFGPLCVHDDHFHVQLVIGRGA
                     LQLDEVPVHPAQAPTQLAAQTPSVFQQQLQHQPQRACVLHLFVTDKRFLNRELGDRLY
                     QRFLREWLLCRPAEREAVTSVFKRLVMTKPYFVFLAYVYSMNCFHAVSATVAFLRFER
                     YDARYLYRRLRLYPADKLNALLDGVTASLLGDLHRFLFGADLRLPVLHPTSSPCLALL
                     RAKRFEGRPDLPVYHRNEWTRDRQPRSPQLEALIAALRRHAGQVPCGNPLYVLARQAV
                     QTFCDTCPRYLVPLRSLGLHDETRVGFSAGAGAGGQASGVAKQARQVEPTKIVLYGLG
                     VALRGGLIGSVIDLPLWCLCRLKCERHLDGRSLVAVVCRQCGHCLNLGKEKLHCQQNF
                     PLNSMFYYRDRQEKSVIFNTNAELVHCSLCGSQRVVKQRVYELVSETLCGLRCIRVGW
                     KAVLGLNAACAVYDHRLTFDVILPCASRTCDSTVVVRAVTVPRLLRLTWHGHGLLCSR
                     CQTGEYRDSCLESEDGAALCRGCALVKQTACHVGHHHHQHQRNPSGGGSAADVGYV"
     misc_feature    complement(69430..70221)
                     /gene="UL49"
                     /locus_tag="CCMVgp051"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     gene            complement(70907..72148)
                     /gene="UL50"
                     /locus_tag="CCMVgp052"
                     /note="core gene"
                     /db_xref="GeneID:935564"
     CDS             complement(70907..72148)
                     /gene="UL50"
                     /locus_tag="CCMVgp052"
                     /note="type 2 membrane protein; interacts with nuclear
                     egress lamina protein; involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress membrane protein"
                     /protein_id="NP_612694.1"
                     /db_xref="GeneID:935564"
                     /translation="MEMSKGLHQDLVQATRRILKLGPSELRVTDAGLICKNPNYSVCD
                     AMLKTDTVYCVEYLLSYWESRTDHVPCFIFKNTGCAVSLCCFVRAPVKLVSARHVGEF
                     NVLKVNESLIVTLKDIEEIKPSAYGVLTKCVVRRSNSASVFNIELIAFGPENENEYEN
                     LLRELYAKKAASSSAAGSVTSAGVGRSVAAGVVSGCASLFSGRMSSPAIPASSSVRFG
                     AAASLTRTTASAAAGSSPGASSLAKKRLYRTPPPQVLVPQGPVPRPPPPPMLAGSWRL
                     CCQCRGCRGRGGCEFEEVDLEDAEEAEEATAEEEAATSPPTSPKSDVRRRRDYDQQRR
                     PMAPRFGRSRDYPPPVSSQRQSVRSSWFSSPSAWLRPEPLRSLLWTLLALTALTALLA
                     LVWRYVVVALLLGGGGGGRFP"
     misc_feature    complement(71384..72148)
                     /gene="UL50"
                     /locus_tag="CCMVgp052"
                     /note="nuclear egress membrane protein; Provisional;
                     Region: PHA03326"
                     /db_xref="CDD:223045"
     gene            complement(72178..72660)
                     /gene="UL51"
                     /locus_tag="CCMVgp053"
                     /note="core gene"
                     /db_xref="GeneID:935490"
     CDS             complement(72178..72660)
                     /gene="UL51"
                     /locus_tag="CCMVgp053"
                     /note="interacts with DNA packaging terminase subunit 2;
                     involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging protein UL51"
                     /protein_id="NP_612695.1"
                     /db_xref="GeneID:935490"
                     /translation="MATLRGRETTTPSPPPPQLGGEDPGREVDDYKGGEGRFEVDDSR
                     DDDGEDSPSSSVPPPLVIDEDAEYGLGEAEDDLLVQFEPMLPRVYDLLLPSLDARLNF
                     VNAGQKYAAFLKYVHGECASCSHGQILREKTQLLTAIVTKLMDINGILEGKDELASGK
                     "
     misc_feature    complement(72208..72426)
                     /gene="UL51"
                     /locus_tag="CCMVgp053"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     gene            72724..74646
                     /gene="UL52"
                     /locus_tag="CCMVgp054"
                     /note="core gene"
                     /db_xref="GeneID:935600"
     CDS             72724..74646
                     /gene="UL52"
                     /locus_tag="CCMVgp054"
                     /note="involved in DNA encapsidation; possibly involved in
                     capsid transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="NP_612696.1"
                     /db_xref="GeneID:935600"
                     /translation="MNSTMGLGGAPIPPRPPTALSSSAIHASSVFADLCSPPRLEHPP
                     SAAQLQDPHAYHHQQQQAHRDGLGAATVGTAVVVTAGSRYTGWSAEHTQWDSELTTEL
                     LWHAHPHQVADEPAAVVPGGVQLLSNADLGLNFDDHAMSVTLSSAGHRSATQSTVATE
                     VLHGGGSGGGAASACDLDAELAGIDVTDPERLRRLCAPLSIDTRCNLCAIISICLRQD
                     AEQTWLLDYSLLCFKCNYAPRTALSTLIVMSEFIHLLRRHFPDLHADELFRHHVLTVF
                     DFHLHFFIHRCFEKQVGDAVENENITLNHLAVVRALVMNEDLAPYTKMRRACQPKQKA
                     SAAAASKTPEAPKALLKSFVERSDPGRDRFVQLLFYMWAGTGVMSATPLPELTEIKFN
                     RLDALTAEGNDVNHSDESLPPPEIRKAVGPVYLCPVPVFLTKNQTSTVCLLCELMSCS
                     YYDNLVLRELYRRVTSYCQNNVKMVDRIQLVLADMLRDCATPMGAVQDDVARHGAQVP
                     LADCAAAPGARPDAVFCHVLRQVGVTGIYKHFFCDPQCAGNIRITNEAVLFGRLHPQH
                     LHEMKLGICHDNYYISPLPRRVWLYIALFKAFQIAKRSNKSKTQLTDFVRDFAQLLEQ
                     SGIKLVEPSYVVDKYV"
     misc_feature    72961..74643
                     /gene="UL52"
                     /locus_tag="CCMVgp054"
                     /note="DNA packaging protein UL32; Provisional; Region:
                     PHA03233"
                     /db_xref="CDD:223016"
     gene            74639..75835
                     /gene="UL53"
                     /locus_tag="CCMVgp055"
                     /note="core gene"
                     /db_xref="GeneID:935519"
     CDS             74639..75835
                     /gene="UL53"
                     /locus_tag="CCMVgp055"
                     /note="interacts with nuclear egress membrane protein;
                     involved in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="NP_612697.1"
                     /db_xref="GeneID:935519"
                     /translation="MSEGGDGAAARRPAAGAPRRRANSGVVRGTLERRSALRSLYRKQ
                     QRRRRRGSGSLLSCSSSVSRLASPSTWLEYDDGGSGSGETRTDGAERDGVPRLTLHDL
                     HDIFREHPDLEVKYLNMMKMAITGKESICLPFNFHSHRQHTCLDISPYGNEQVSRIAC
                     TSCEEHQILPTASDAMVAFINQTSNIMKNRNFYYGFCKSTELLKLSTNQPPIFQIYYI
                     LHAANHDIVPFMHAEEGRLHMHVIFENPDVHIPCDCVTQMLTAARDDYHLTLNIVRGH
                     VVVSVLCHTVSGSSVKIDVTILQRKIDEMDIPNDVSESFERYKELIQELCQFSGAGGG
                     YASALLSSSSSSASRSGGATAQSPTMTTATAAQSHHHHHHHAGTAVQPPSAPQPPLFL
                     NSIRAP"
     misc_feature    74927..75607
                     /gene="UL53"
                     /locus_tag="CCMVgp055"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     pfam02718"
                     /db_xref="CDD:280816"
     gene            complement(75813..79886)
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="core gene"
                     /db_xref="GeneID:935523"
     CDS             complement(75813..79886)
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="NP_612698.1"
                     /db_xref="GeneID:935523"
                     /translation="MFFNPYLNAGPHRPGADVGTSVGGGGLVGNCRINAAAGGRGRRS
                     QQSPLQQQTTPRRRGRPGKFDGGGSGSSGQDQSSDGGNSSSSEGACFPLPTSKRSGVQ
                     KQFMQIVPRGVMFDGQTGLIKHKTGRVPIMFYREIKHLLTPDLIWPCPLRETLVGRVV
                     GPIRFHTYDQVDGVLFFDSPENVSPRYRGHLVPSGNVLRFFGATEHGYSICVNVFGQR
                     TYFYCEYGDTERLREVIASVGELVPEPRTPYAMSVTPATKTSIYGYGTRPVPDLQCVS
                     ISNWSMARKIGEYLLERGFPVYEARVDPLTRLVIDRRITTFGWCSVNRYDWRHQGRSS
                     TCDIEVDCDVSDLVAVPDDNSWPLYRCLSFDIECMSADGGFPCAEKPDDIVIQISCVC
                     YETGGGSADGAGGVGVNGGATPAPTQSHHGNGESGGIPYYPQAATAGVGAQPPVFGRS
                     GLHLFTIGTCDPVGEADVYEFPSEYELLLGFMLFFQRYAPSFMTGYNINSFDLKYILT
                     RLEYLYKLDVQRFCKVPVAQGGRFFLHSPTLYRRHQDRASFAAAAANAPTKVYISGCV
                     VVDMYPVCMAKTNSPNYKLNTMAELYLGQRKDDLSYKEIPVKFVANAQGRAQVGRYCL
                     QDALLVRDLFNTINFHYEAGAIARLAKIPMRRVIFDGQQIRIYTSLLDECACRDYILP
                     NHYQTPPTEAAVANNAATAVFASVPPGLLSPDGSSNTSILSAGAVTGAPGDVGSATAV
                     FNALTPVSSEETTSSCDGVSTVSGASGTSGGCSGSSGGGSVTGTNGGILSAVAPSSAA
                     AAYQGATVFEPVVGYYNDPVAVFDFASLYPSIIMAHNLCYSTLLVPGGEYPVDPADVY
                     SVTLENGITHRFVRASVRVSVLSELLNKWVSQRKAVRECMRECRDPMRRMLLDKEQMA
                     LKVTCNAFYGFTGVVNGMMPCLPIAASITRIGRDMLERTARFIEDNFSEPCFLRNFFN
                     QEDYAVASEDEDAREEEEEEGDVVHGDLEMIVEEEGGGGGGENGVGGRTHSLVFTAAA
                     GATATRTRRRLHRHIPYKRPRVGEEAERRGGGGSGGWTVEARVIYGDTDSVFVHYRGL
                     TAQALVSRGPALADYVTACLFNEPVKLEFEKVFVSLMMICKKRYIGKVEGAAGLSMKG
                     VDLVRKTACEFVKGVTRDVLSLLFDDREVSQAAVRLSRLTLEDVRAQGVPAGFWPILW
                     RLTQARDDLYLRRVRVEDLVLSSVLSKDISLYRQSNLPHIAVIKRLAARSEELPSVGD
                     RVFYVLTAPGEGRSSSGVCNYEVAEDPTYVREHNVPIHADKYFDQVLKAVTNVLSPIF
                     PEGEIGRKDRFLSMVLPRRLHLEAAFLPYSVKEHECC"
     misc_feature    complement(76983..78818)
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="DNA polymerase type-B family; Region: POLBc;
                     smart00486"
                     /db_xref="CDD:214691"
     misc_feature    complement(77970..78818)
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:299142"
     misc_feature    complement(order(78009..78011,78381..78389,78396..78401,
                     78783..78794))
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="active site"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(78009..78011,78381..78383,78786..78788,
                     78792..78794))
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(78009..78011,78384..78389,78396..78401,
                     78783..78791))
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176647"
     misc_feature    complement(75870..77486)
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:278562"
     misc_feature    complement(75927..77486)
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="DNA polymerase type-B family catalytic domain.
                     DNA-directed DNA polymerases elongate DNA by adding
                     nucleotide triphosphate (dNTP) residues to the 5'-end of
                     the growing chain of DNA. DNA-directed DNA polymerases are
                     multifunctional with both synthetic...; Region: POLBc;
                     cl10023"
                     /db_xref="CDD:271693"
     misc_feature    complement(order(76650..76652,77127..77129,77139..77141,
                     77220..77222,77406..77414,77421..77423))
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    complement(order(76647..76652,76656..76658))
                     /gene="UL54"
                     /locus_tag="CCMVgp056"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            complement(80018..82783)
                     /gene="UL55"
                     /locus_tag="CCMVgp057"
                     /note="core gene"
                     /db_xref="GeneID:935516"
     CDS             complement(80018..82783)
                     /gene="UL55"
                     /locus_tag="CCMVgp057"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     binds cell surface heparan sulphate; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein B"
                     /protein_id="NP_612699.1"
                     /db_xref="GeneID:935516"
                     /translation="MWAKIWCLVVCVSLLRTPSSGGVYGAPSSSSTSGQPPTPSVPGG
                     SSSSGRTTTRTTQQESTTNGTEYIFNTTLRPDDVIGVNISKYPYRVCSMAQGTDLIRF
                     DRNIHCTSVKPTKEDLDEGMMVVYKRNIQAHTFKVRVFQKVLTFRRSYAYIYSTYLLG
                     SNTEYVPPPMWEVHFINNNGQCYNSYSKVMGDTVFVAYHEDSYENKTMKLIPDDYSNT
                     HSTRYVTVKEQYHTRGSTWLYRETCSLNCMVTVTTARSKYPYHFFATSTGDVVDISPF
                     YNKTNGKYFGENADKFYLIANYSMVEDYGQWNSHKKTHKLVAFLERGDSVLSWDVEDE
                     QNTTCQYAYWESSDRTIRAETHDSLHFTSSKMTATFLSKKTPVNISDPGLACIKDKAL
                     TQLETMFNSSYNETYVKHGKVEVFETTGGLVVFWQGIKQKSLADLEDFAKIQNETLER
                     MRNGTRHKRDTSTSQLSYNSTDVIHNVMYAQLQFTYDTLRNYINKALAQIAEAWCVDQ
                     RRTLEVFKELSKINPSAILSAIYDKPIAARFMGDVLGLAQCVNINQTSVKVLRDMHTK
                     EKGRCYSRPVVMFTFVNSSHVQYGQLGEDNEILLGNHRTEECQLPSLKIFIAGNSSYE
                     YVDYMFKRMIDLSTIATVDSMIALDINPLENTDFRALELYSQQELRSSNVFDLEDIMR
                     EFNSYKQRVKYVEDKVVNPLPPYLKGLDDLMSGLGSAGKAVGTAIGAVGGAVASVVEG
                     VAAFLKNPFGAFTIILVALAVLVIIYLIYTRQRRMYMQPLEQLFPYMIQSRSSSTTVT
                     STSDAPSSSNQAPPSYEDSVYNSGHKSATTSVQPYTTEQAFQMLLALQRLDAQHRPQK
                     HKGAPNIVVAPSAPPMSRDNNGASSEDNSSNKKQQPQQKPPKPNLLDRIRHRKNGYQH
                     LGSEEDV"
     misc_feature    complement(80021..82594)
                     /gene="UL55"
                     /locus_tag="CCMVgp057"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     gene            complement(82746..85265)
                     /gene="UL56"
                     /locus_tag="CCMVgp058"
                     /note="core gene"
                     /db_xref="GeneID:935450"
     CDS             complement(82746..85265)
                     /gene="UL56"
                     /locus_tag="CCMVgp058"
                     /note="involved in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="NP_612700.1"
                     /db_xref="GeneID:935450"
                     /translation="MNLLQKLCVVCSKCNEYAMELECLKYCDPNVLLAECTPFKRNAA
                     AIVYLYRKIYPEVVAQNRTQSSLLTLYLEMLLKALHEDTALLDRALTAYSRHPDRAAF
                     YRTVLRLDHCDRHHTVELRFTDSVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEV
                     CTQLLALLRRLCGISPVARQEAYVEGTTCAQCYEELTIIPNQGRSLNKRLQGLLCNHI
                     AVHRPSSQSDVNIQTVEQDLLELTERIPRLAGVLSALKSLFSSSSAYHSYIQEAEEAL
                     REYNLFTDIPERIYSLSDFTYWSRTSEVIVKRVGVTIQQLNVYHHLCRVLMNTISRHL
                     YGEDVEDIFALGEKVLAGEERMFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKLHES
                     NEMYTKIKRILEEIRRPLPDGTGGDGPERGTSRHPQMHPKTGSRTEEEESMEGTGTYG
                     HNGSSRFRGRGRRSAAGGAATLSQAPRGEEEHEALDPLDARSRVHNVTREVNVRKRAY
                     LQKVSEVGYGKVIRCIKAQERLTTKLIDVNLVGPVCLDFLSKMMNGFIYRSRYGQDRE
                     MLDVGQSLTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHN
                     VDMAYACDNAGVLPHAKDDLVKCAEGTVYPSEWMVVKYMSFFNFSECQDLNVLQKEMW
                     MHVRELVLSVALYNETFGKQLSIACLRDELNPDRDLILTYNKEWPLLLRHEGSLYKSK
                     DLYLLLYRHLSRPDESGDAPTAGAVFREPNPQQQAWAPPPVPPGALLSSASSSSTSSL
                     CSTARRSRVISSRKRTRNAASLLDLARIDHVGQDLVPGSLR"
     misc_feature    complement(83223..85256)
                     /gene="UL56"
                     /locus_tag="CCMVgp058"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            complement(85475..89146)
                     /gene="UL57"
                     /locus_tag="CCMVgp059"
                     /note="core gene"
                     /db_xref="GeneID:935446"
     CDS             complement(85475..89146)
                     /gene="UL57"
                     /locus_tag="CCMVgp059"
                     /EC_number="2.7.7.7"
                     /note="contains zinc-finger; involved in DNA replication;
                     possibly involved in gene regulation; similar to HSV-1
                     UL29"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="NP_612701.1"
                     /db_xref="GeneID:935446"
                     /translation="MSGEELTAVAPVGPAAFLYLTKLGDETREVLAALSLCDRCSPVV
                     IAPLLVGLTVDHDFAVSVRTPVLCYDGGVLTKVTSFCPFVLFFHNTRGIVDFSEDHGD
                     VRRLCEETRLKYGLETFVPEPGRRPTDLAALCASLGCDPDEVTAHVAVGNGLKEFLYA
                     GQLVPCPEEAVSVRLHGCESLRVPLYPPTLFNSLQPDAEADDVSLETRSAFVQERGLY
                     VPDVSETLFYYVYTSWGQSLRFGETRILIEAALRQFVHDSQHSVKLAPHKRYFGYMSQ
                     KLSSLEKDHLMLSDAVTCELGFSFASVFFDSAYEAADSMNFAEWPVVTGAADHRDLIR
                     ALNELKLHLSTHVSALVFSSNSVLYYNRLVYLSSMKSMPGAAASQESLLKSIHFANGL
                     ASACEDTYNDGRKVIKFQGVVPKDERYGPQHLALACATCPQLVSGFVWHLNRVCIYNT
                     GLSGASTLSNHIVGCASSLCEACGGTCCHTCYNTAFVRVRTRLPVIHKLPKREPCVVV
                     MQSRFLSDVDVLGTFGRRYSAESKDVGGGLDGKGDDPLGVSVGVTSAASSSTSASSSG
                     SGSGRLVSASVDRTHRLHRILDYCRKMRLIDPLTGEDTVNVSGRSDFVNVFSALNKFV
                     DDEAMSFVSEVRMKSSRDEVVGATQAFNLDLNPYAAAFHPLLSYEYFRVVFLVIQHVA
                     LITAASYIVDNPLTASLVSKWVSQHFQSIHGAFSTTSSRKGFLFTKNIKSSKNSDHDR
                     LLDFRLYGRGTYAVVPMEIKLSRLSVPSLLMFRVKNRPISRPGKGGSASVFFRRDHVV
                     KRNPAKGCLGFLLYRHHERFFPGCGVPCLQFWQKVCSNALPKNVPIGDMADFNAFVKF
                     LVHVTSDYNDHDLIDVPPDCVLSYVENRFHNKFLCYYGFKDYIGSLHGLTTRLTCQNH
                     AQFPYVLGATPNFASPADFALHVKELKAAGVPPPFASTVARESLVRTVFEQRSLVTVP
                     FSIEKYAGVNNSKEIYQFGQIGYFSGNGVERNLNVSSLGGHDYRFMRQRCLLATKLSE
                     VLIKRSRRENVLFDADLTKSRVMSALDSENPDCDPEVMALYEIMSTREDFPERDDVLF
                     FVDGCEALATSLMAKFAALQEQGVEDFSLENLRRVLDAGSEQLAAAAAGGEVHDLSAL
                     FAPSVESVVVVGGGGGGASGPSLGNAMGFGVLGETTAGPGGGAGTGTTTTTFLAGADD
                     EAGGGLGTGGLLPAKRSRL"
     misc_feature    complement(85700..89146)
                     /gene="UL57"
                     /locus_tag="CCMVgp059"
                     /note="single-stranded DNA binding protein; Provisional;
                     Region: PHA03367"
                     /db_xref="CDD:223059"
     gene            complement(98395..101154)
                     /gene="UL69"
                     /locus_tag="CCMVgp060"
                     /note="core gene"
                     /db_xref="GeneID:935444"
     CDS             complement(98395..101154)
                     /gene="UL69"
                     /locus_tag="CCMVgp060"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally;
                     involved in gene regulation; involved in RNA metabolism
                     and transport"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="NP_612702.1"
                     /db_xref="GeneID:935444"
                     /translation="MELHGRARQDAPLSSLSERERRARRARRFCLDYEPVPRKSRRER
                     SPPSPTSYQSTQQHGAVPAGASHRPCVPAQQSQSQPRRPSSCSSSSRYEQDDGEAPDD
                     DMNPPPPPSAAAAAPPHQHHHYHHPQPTQRGGTAGFRGPPAKRRFAASSTGPYGGKSD
                     AEGEYRRRIPSCPATVHRPTPAVPPGGGSNGRHHSSSAALLPSAAASSHHHHHNNHPP
                     MFALLDDELDAMDEEELQHLSRLIEKKKQARLHKGGGCCGGGGDSSSSGTSPSSTSPA
                     YDLQRYTAESLRLAPYPNDLKSPTAFPQDRQPRGRILLSHDELMHTDYLLHIRQQFDW
                     LDEPLLRRLVVEKIFAVFNTPNLHTLLAIIDETLSYMKYHYLHGLPVNPHDPYMETVA
                     AMRQLLFNKLSNLDLGCILDHQEGWGDNCNLLKRLVKKPGQMSGWVRDDACDLQKRPP
                     ETFGNPVHRAMAYVCSFSRVAVALRRRALQVTNAPQFFDQFDANNAMGTYRCGTVSDL
                     ILGALQRHECQNEMCELRIQRCLAPYRFMLAYCPFDEQTLLDLTIFADDHQQQQQPHR
                     LPPHHPSSLGAKSHHHNNGAIAPTSQSSGTTTTSSSSHTPKGPRTPPYPPPPPSAPRP
                     EKQSSTAYERRSRKRRSPHQYSEGELEDEEDDSSSQDLVKVPTSDRPGAGAIVYKTTA
                     VPPLTPPKGAAVASRHHPSPLGPAIRHNSPMFSAATTAPPSTSGGSSTNTTITSSPSP
                     QIPAVPSSLLFGTTTTTASNNSNNTTTTTTPAAGTLRCDVNFGTTSILKKPKQPPAEE
                     EDEEEEEEERRGGRSRKKRRGLPDHDSWSAGDDDGSEEEEDEESQMSTTTTQPSLPTT
                     TTTTTTSSSASSHRTPAPPPPDNNSSSAAEASGATSPESVVMRCQTPDYEEEMLCYSD
                     DMDEY"
     misc_feature    complement(99529..100212)
                     /gene="UL69"
                     /locus_tag="CCMVgp060"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; pfam05459"
                     /db_xref="CDD:283185"
     gene            complement(101280..104234)
                     /gene="UL70"
                     /locus_tag="CCMVgp061"
                     /note="core gene"
                     /db_xref="GeneID:935591"
     CDS             complement(101280..104234)
                     /gene="UL70"
                     /locus_tag="CCMVgp061"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="NP_612703.1"
                     /db_xref="GeneID:935591"
                     /translation="MTLVLFATEYDSAHIVTNVLAQTASEHCVYPLLVKHHASRRVYF
                     CLQTQKCTDSRRVAPVFAVDNDVLNLSRYLTARQPIPLSALIASLDEAETRPLYSHLF
                     RTVISPEHGGEVREFKHLVYFHHAAVLRHLNLVFLCPTSPSWFISTFGHTEGQVLLSM
                     AYYLFEGQYSTVPTVEEYVRSFCAGDLGPVIPTHASMSEFARLLLGSPFRQRVPQFVA
                     YAVARNRRDLAELTHVDAQINTFREHARLPDTVCVHYVYLAYRTALARQRLLEYRRVV
                     AYDETAPAEQQCTREPLFLGRRLAGDLIQVMERYFSLDNFLHDYVETRLLPLGSPHQP
                     HPASYPPPSHPQQQPSPAHPPCLQHLRMSGYGYRTDGASLTGFFGTSSQLLRKLDQIN
                     RLSDSVFSSIERSLSGVLRLCASLRTAQTYATGALARFSQRRYLLPPELAAAGAVIAQ
                     PLPLYRVHLPNDQHVFCAVFSETWHRSMFPFDLLKHVPDSRFTDEALTDMIWLHDDDV
                     ASASPETQFYYTRHEIFNERLPVFNFVADMDLRLRDGVSGLSKHTVFEICRGLRRVWI
                     AVWTSLFGYTYQDRHPVYFFKSACRHPGVGAHAHDDDAADAYYDGDEYLNFENEEHEG
                     RDATEEGEMRREEEGQRVGESRHPKTKEEEGGDATGDKNNSPLYCRCTEKLGLRIITP
                     FPANTVVLNPAVLRAVAQVLNHALCLDTQLHRLLDPISHPENSLDTGIYHHGRSVRLP
                     YMYKMDQDDGYFMYRRLLPLFIVPEAYRDRPLGFVRAQLDLRNLLHHHPPHDLPAFPI
                     SPPPRIVLSVQDKICPSPDANFIETRSLNVTRYQRRALADVLSYHLYGAPRAERGDDD
                     AVVVYETELQRLLVGRVWPPLLEHLTRHYEAHVSEQFTAPNVLLFQPHGLSCVAVKRR
                     DGSRTRDFRCLNYVHRNPQETVQVFIDLRTEHSYALWASLWSRCFTKKCHSNAKNVHI
                     SVKIRPPGADAV"
     misc_feature    complement(101313..104234)
                     /gene="UL70"
                     /locus_tag="CCMVgp061"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03139"
                     /db_xref="CDD:165411"
     misc_feature    complement(101334..>103817)
                     /gene="UL70"
                     /locus_tag="CCMVgp061"
                     /note="helicase-primase primase subunit; Provisional;
                     Region: PHA03146"
                     /db_xref="CDD:177543"
     gene            104250..105371
                     /gene="UL71"
                     /locus_tag="CCMVgp062"
                     /note="core gene"
                     /db_xref="GeneID:935474"
     CDS             104250..105371
                     /gene="UL71"
                     /locus_tag="CCMVgp062"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="NP_612704.1"
                     /db_xref="GeneID:935474"
                     /translation="MELARRLCGFLLCRRRPAPVADYVLLQPSEDVELRELQAFLEEN
                     FKQLDITPEDLRSFSRDTEVVNHLLKLVPLYRQCQSKCLFLKGYLADGCLPHTRPAAE
                     VECRKSQRILEALDILILKLVVGEFVMSDTESLEMLLDKFSTDQASLLEVQKVMGLVD
                     MDCEKSAFMLDAAASSENAELEGAVGGVDVPSTAVSSSVSSPASVAASHLVGAFTCPS
                     ITATSLIPENTGVTRPPDTLGEITTLSTPSVIRFDPSLLPSDDDDDERDAVGYSKVVP
                     RGRRETSEESSSLLQERERERFEDGPPVREQPQGRSHRRHHRSSSGEREVLSLLRQTP
                     EVPQDEVVTTPPTLGPPPIVGSARELRGVKKKRASILTV"
     misc_feature    104250..105002
                     /gene="UL71"
                     /locus_tag="CCMVgp062"
                     /note="tegument protein; Provisional; Region: PHA03373"
                     /db_xref="CDD:223062"
     gene            complement(105564..106724)
                     /gene="UL72"
                     /locus_tag="CCMVgp063"
                     /note="core gene"
                     /db_xref="GeneID:935475"
     CDS             complement(105564..106724)
                     /gene="UL72"
                     /locus_tag="CCMVgp063"
                     /note="enzymatically inactive; DURP family"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="NP_612705.1"
                     /db_xref="GeneID:935475"
                     /translation="MLTVLTDRIDSQIVLSRPAHSRFQRFWEPPSLIIKDNGDPPPPM
                     LAEKSLNMRYCVRFASDTDFQNLFTPPDDGGGGGDGGSPLPQPKIPYKWLPSSFIVKQ
                     CQTQLAFHNKHIIWLSRERKIPTSLGISLYIPEGFFGITFYKCLDAQFVCMPELIEPG
                     LQMPQMDIVNLSYNFQAIFPGTIEGDIGVFPCFAPEPWQLMNVPPPNEHGFFTLRTRH
                     TVIIRAGHTQTVYFDAAYVHAPGICALIVGTRHFSQSDLIIRPTIWLPGTVACVTVVN
                     ASGTTVCISPNTTMTKVVFTTRRFAYLLVGSHPIGQLIVPPTPELGFTHTPEHALLQR
                     LSGCAGGGDDTAADADDEEDEDTGATWSHRKRAVHHWDVVDRPYSSHEDDSF"
     misc_feature    complement(105582..106724)
                     /gene="UL72"
                     /locus_tag="CCMVgp063"
                     /note="dUTPase; Provisional; Region: PHA03128"
                     /db_xref="CDD:165400"
     gene            106752..107168
                     /gene="UL73"
                     /locus_tag="CCMVgp064"
                     /note="core gene"
                     /db_xref="GeneID:935477"
     CDS             106752..107168
                     /gene="UL73"
                     /locus_tag="CCMVgp064"
                     /note="type 1 membrane protein; complexed with envelope
                     glycoprotein M; involved in virion morphogenesis; involved
                     in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein N"
                     /protein_id="NP_612706.1"
                     /db_xref="GeneID:935477"
                     /translation="MANKLMVLILVVSTVATNMTSTSPSSTKSTSSTTTTTTTTTTRT
                     SSSTTRKVSSSSSSVTSARMSTHVTTHHIFHPMKIHNNSDFYNENCTSHMYHISFKVF
                     AAWWTLINLFILVGAFCMVLRHCCFQTFTSATTKGY"
     misc_feature    <106980..107156
                     /gene="UL73"
                     /locus_tag="CCMVgp064"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            complement(107149..108534)
                     /gene="UL74"
                     /locus_tag="CCMVgp065"
                     /note="beta gene"
                     /db_xref="GeneID:935478"
     CDS             complement(107149..108534)
                     /gene="UL74"
                     /locus_tag="CCMVgp065"
                     /note="contains signal peptide; associated with envelope
                     glycoprotein H and envelope glycoprotein L; involved in
                     virion morphogenesis"
                     /codon_start=1
                     /product="envelope glycoprotein O"
                     /protein_id="NP_612707.1"
                     /db_xref="GeneID:935478"
                     /translation="MARHGVGLACGACLALWCFVLCQVAAQRPVQTNPPHIQKIFNEY
                     RQPTREQLLEILKLKLEIETRKRSRGRYKVKTIKTPQTRDNSTDYAPLILNNVTVAPM
                     PKFPKRYILAGPKTMNVTYLWLDFYSNQLRRARYVYSKYDNVTKNITFLLPPCGNVPS
                     MRCLSEMLNISISRRNETGENDDDCRNFTTYNPMLYNVPRWNTLITVGSQRISVDSQT
                     VYFMGLSALILRYVQRNCTSSFYLANAMSRNMFRVPKYFNSTKLKNTMRKLKRKQTAK
                     EITLPKTQKRTKRNATVTTNNVTTTTIHAITTSANVTRNGVSKNASVTLPTKSCDVNE
                     GACFKNPILATQLQDLVTWVYSTFRYYSEPYCQRSRNLTAISDTVRHTHQVAHNQTPS
                     TIYGTLNLTSLYQEAPEVNRSHILLRQNYIDPLWDYIDSMVFKEEIRNRTNITLRHRP
                     ENVSSLSSLWW"
     misc_feature    complement(107215..108240)
                     /gene="UL74"
                     /locus_tag="CCMVgp065"
                     /note="Herpes UL74 glycoproteins; Region: Herpes_UL74;
                     pfam07982"
                     /db_xref="CDD:285256"
     gene            107798..108741
                     /gene="UL74A"
                     /locus_tag="CCMVgr003"
                     /note="beta gene"
                     /db_xref="GeneID:11468239"
     CDS             join(107798..107811,108540..108741)
                     /gene="UL74A"
                     /locus_tag="CCMVgr003"
                     /note="type 2 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein 24"
                     /protein_id="YP_004940335.1"
                     /db_xref="GeneID:11468239"
                     /translation="MALARDPAPSVCITVWLALVYSLMILAILLFVYRCVVGFDGDLV
                     TRTLAVYHLCHSQRGPPLSCQHNTSTS"
     gene            complement(108978..111281)
                     /gene="UL75"
                     /locus_tag="CCMVgp066"
                     /note="core gene"
                     /db_xref="GeneID:935479"
     CDS             complement(108978..111281)
                     /gene="UL75"
                     /locus_tag="CCMVgp066"
                     /note="type 1 membrane protein; putative membrane fusogen;
                     complexed with envelope glycoprotein L; involved in cell
                     entry; involved in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein H"
                     /protein_id="NP_612708.1"
                     /db_xref="GeneID:935479"
                     /translation="MRTVPWPQRYDLSIYLCYLCILLYLYLCQSRYGTTTKTRVAWGA
                     EAVQVDPNSFDLLINTYGRPVRFLRENNTQCTNGTVRNSTVVKENAISFNFFRSFNEY
                     DVFQMPRCLFSGLLAEQLLNQVDLSETLEAYYRRLDVYALVSTRDLPSYRAFDLKLEA
                     TDALADRAVTVPAPGEMPMPAVQMQPPSPKDLVFTLPYVDHPEQVHRPAFQQTCHLFK
                     DHDLLFSALIPCLEQEFLPLGTNNRRSVLTLTLTEDFFALRATIDDAPALLLFGDLSR
                     VAFKAPYQRDNFVLRQTQKHELLVLIKKSHLHRHPYLKEPDFLEAALKINYLDMSAIM
                     AAFHGYAVKALKNGRCQSPLDRSAVELAFGYGLTLLSAGSPQRAHESRVHISRLLDRQ
                     AALLQAQDFMTVCLRRQIDPPSGNTTLSYPRAVEMARKAFTAVGAVSTVPSLTRAAYI
                     LARHNDEKAIPKWAMQQLGQFAVTLHKSHLASFLSAFARQELYLLGAMIHSMSEHTNE
                     RRLIFIIETGLCSLAELAHFTRMLADDHHEYLSDLYTPCSSSGRRDHSLERLARMFPD
                     APIPETVPTALSILAMMQPRTLSAFRDLACLPLDESFSALTVSEHTSYVTGEKYLLKG
                     TSYPVSTTVVGQSLIITRTESHEECELTRNMHTTRPIVAAFNISLEDCAFCQSALMEY
                     DDTQGIVNLMYLHDGEDVLFALDAGNNVVVPSPRTHYLMLLKNGTVLEVTDVVIDATD
                     SRALMMAIYALSAIVAIYLIYRLLKLC"
     misc_feature    complement(108981..111104)
                     /gene="UL75"
                     /locus_tag="CCMVgp066"
                     /note="envelope glycoprotein H; Provisional; Region:
                     PHA03295"
                     /db_xref="CDD:223036"
     gene            111462..112424
                     /gene="UL76"
                     /locus_tag="CCMVgp067"
                     /note="core gene"
                     /db_xref="GeneID:935589"
     CDS             111462..112424
                     /gene="UL76"
                     /locus_tag="CCMVgp067"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="NP_612709.1"
                     /db_xref="GeneID:935589"
                     /translation="MSFSSDPGAGTSGDGGDALQRLPHFCKRAGKRKHLDIYRRLLRA
                     FPSFAALNRLLGDLFPPPLKKYRRRLYLEVRLSRRVPDCVVVFLSPRGDEVEPPAKPK
                     PPHAVCYVIEFKTTQSDADVQSVRRHATHSLQYAEGLRQLKGALVDFEFLRVPSGGAS
                     EIWSVVPSIVFFQRHAASPSFGRTFRAARFDLCTDAALDYLARRQDESVAHILAATHR
                     RLRAPPGKRSAVPRPRTATPAGGRRGGDQGRLAGRLHHGSGAQAVSARGAARPQRQGT
                     HLLRGSGGARVRSGGAAQSAVRGRRGTAAVPGESRRHSARTRSL"
     misc_feature    111522..112094
                     /gene="UL76"
                     /locus_tag="CCMVgp067"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; pfam01646"
                     /db_xref="CDD:279917"
     gene            112078..113994
                     /gene="UL77"
                     /locus_tag="CCMVgp068"
                     /note="core gene"
                     /db_xref="GeneID:935588"
     CDS             112078..113994
                     /gene="UL77"
                     /locus_tag="CCMVgp068"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome; involved in
                     DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="NP_612710.1"
                     /db_xref="GeneID:935588"
                     /translation="MSLLRTFWQLPIAVYEPHRENVLRCPDRVLRRLLEDAAVGIRGG
                     WREDFIMDRVRKRYLREELRDLNDKVHTYCEDLEGRVSEAEALLNQQCEVVEVLPPSQ
                     GSHGGTLPEHALYSRHDAITGPDGGVIATPYARGGCGVSSTWLAQCADRPPFGPTPAQ
                     AAQAALVGAPGGATYFGITQNDPFIRFHTDFRGELVSTMFENASTWTFSFGIWYYRLK
                     RGLYTQPRWKRVYHLAQMENFSISQELLLGVVNALESVTVYPAYDCVLSDLEAAMCLL
                     AAYGHALWDGRDPPDSVAGVMAELPQLLPRLADDVSREIAAWEGPVTGNYYAYRDPPE
                     MRYYMPLSGGRHYHPGTFDRHVLVRLFHKRAVLQHLPGYEAQTAAVVQERLSGQVRDD
                     VLSLWTRRLLAAKMGREVPVFVHEQQYLRSGLTCITGLLLLWKIANSDSVFAPRSGKF
                     TLSDLLGQDAGGLPGGRAGGEEEGYGGRRGRVRNFEFLVQYYLTPWYARDQTLTFSQL
                     FPGLALMAVTESVRSGWDPSRRDDHQREEDAVGLGLGGNGGGALLMQLSRVNPVAEYM
                     FAQSSKQYGDLRRLEVHDALLFHYEHGLGRLSSVALPRHRVSILGSSLFNVNDIYELL
                     YFLVLGFLPSVAVV"
     misc_feature    112078..113991
                     /gene="UL77"
                     /locus_tag="CCMVgp068"
                     /note="DNA packaging tegument protein UL25; Provisional;
                     Region: PHA03252"
                     /db_xref="CDD:223024"
     gene            114146..115408
                     /gene="UL78"
                     /locus_tag="CCMVgp069"
                     /note="beta gene"
                     /db_xref="GeneID:935455"
     CDS             114146..115408
                     /gene="UL78"
                     /locus_tag="CCMVgp069"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein UL78"
                     /protein_id="NP_612711.1"
                     /db_xref="GeneID:935455"
                     /translation="MTVALSSSTSLNVAKIVVPNAAMIADRAASDLLTGMFASISVLN
                     LLAIVGCLWMLRVTRPSIAVQVFTWNLVLSQFFSIVATVFSKGMTLSVYNAADLGFCR
                     LALFVEDVGLYSTSLLFLFLILDRLAAIAQGRDLWRHQTRENVSLALYVVAFIWVLSV
                     VAAVPTAATGTIDFRWRGCEIPLQYSGVDLTIKMWFVMGAPMIAVLSYVVDLSYNDKR
                     DAAWPYVGRVCSYYVTCLLLYVPHYCFRVLRSVVEPGDTTFGIMDYMELGTRTVLMLR
                     LSVLPLFIVALFSSNPTQDLDVSLERLLESCSRSGGCCGVSRLLRKLMEMLKRMLHSV
                     ELVVRFDFGSTSEKPDVAQKPCSCAVAAPVVTAGVSTTSDKATLVEHVEDVAYDDVPS
                     TTIEVVSAESSSVLCAAVVGGSMPVTGI"
     misc_feature    114251..>114775
                     /gene="UL78"
                     /locus_tag="CCMVgp069"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cd14964"
                     /db_xref="CDD:320095"
     misc_feature    114251..114325
                     /gene="UL78"
                     /locus_tag="CCMVgp069"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320095"
     misc_feature    114350..114409
                     /gene="UL78"
                     /locus_tag="CCMVgp069"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320095"
     misc_feature    114449..114517
                     /gene="UL78"
                     /locus_tag="CCMVgp069"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320095"
     misc_feature    114593..114640
                     /gene="UL78"
                     /locus_tag="CCMVgp069"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320095"
     gene            complement(115480..116367)
                     /gene="UL79"
                     /locus_tag="CCMVgp070"
                     /note="betagamma gene"
                     /db_xref="GeneID:935453"
     CDS             complement(115480..116367)
                     /gene="UL79"
                     /locus_tag="CCMVgp070"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL79"
                     /protein_id="NP_612712.1"
                     /db_xref="GeneID:935453"
                     /translation="MADEDDEAAATATSPSSPRPQEQQQVRTGKFSFTCANHLILQIS
                     EKMSRGQPLHSLRLEELKILRLICVMLFHRGLETLLLRETMNNLGVSDNAVLSRKTPQ
                     PYWPHLYRELTQAFPGLDFNAAVFDEACAARLSQRLLSHPRLSGGLLTRFVRRHTGLL
                     ISFPEDLARNGNILFSLGTLYGHRLFRLAAFFTRHWGADTHEPLIRIICQKMWYFYLI
                     GTGKMRITPDAFEIQRSRHETGIFTFIMEDYRTFAGTLSLHHYHRPHNHRHPRAAALS
                     PEAVAAARALHMPALASDA"
     misc_feature    complement(115486..116295)
                     /gene="UL79"
                     /locus_tag="CCMVgp070"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03364"
                     /db_xref="CDD:223057"
     gene            116400..118532
                     /gene="UL80"
                     /locus_tag="CCMVgp071"
                     /note="core gene"
                     /db_xref="GeneID:935451"
     CDS             116400..118532
                     /gene="UL80"
                     /locus_tag="CCMVgp071"
                     /EC_number="3.4.21.97"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus);
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="NP_612713.1"
                     /db_xref="GeneID:935451"
                     /translation="MAGGDLSSPSSSVVYVGGFLTRYDQPPDEAELLLPRDVVERWLG
                     SGGDGTPMPLNVNHDDAAVVGHVAAMKSVRDGLFCLGCVTSPRFLEIVSRASEKSELV
                     SRGPPCKSLRPDKVVEFLSGSYAGLSLSSRRCCPSSVEASEAPSTSTAVPESAPFKHV
                     ALCSVGRRRGTLAVYGRDPDWVLQRFPDLTAADRDDLRAQWRGCGGAPAGDPFRSDSY
                     GLLGNSVDALYIRERLPKLRYDKQLVGVTERESYVKASVSPEAAAEPAVTPCDIKADE
                     AASAAQPPPPLPPPRRSAPAPSKPNPPSLPPPEAVEMSHPLTAAAAPGAAAIPPPPSS
                     AVVPAPLTLPHDGVYLPKDAFFSLIGASRQPAVPATAPPSYPAVGAVPAYPHHPSPYS
                     HQPPPPPPHPATGLSGGAYGGMHSVGYDDLAARHFGAYDPGVYWARRYDHLPPPPSYP
                     APYAAYGPPPPPPPQQQHHHHHRRRDMMDDAPSTWERYPYDGAPPPPPSQQHGGGGHR
                     QKQRSGKRRKEASQSSSSDEDLSFPGEAEHGRARKKLKNHGGAQDGGGGEHHRGGGQH
                     QRYDELRDAIHELKRDLFAARQGSALLSAAIPVPGVSHSAAPSPTTTTASSPAETPMI
                     TGDATPPPQTTPAGKVGAAERAAAAVAGVVNASCRVDHAVAGTSGGSSSTTTAAGLPA
                     AALALQNPPKDMVDLNRRLFVAALNKME"
     misc_feature    116490..117551
                     /gene="UL80"
                     /locus_tag="CCMVgp071"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     misc_feature    116550..>117191
                     /gene="UL80"
                     /locus_tag="CCMVgp071"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03160"
                     /db_xref="CDD:165431"
     gene            117336..118532
                     /gene="UL80.5"
                     /locus_tag="CCMVgp072"
                     /note="core gene"
                     /db_xref="GeneID:935452"
     CDS             117336..118532
                     /gene="UL80.5"
                     /locus_tag="CCMVgp072"
                     /note="clipped near C terminus; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="NP_612714.2"
                     /db_xref="GeneID:935452"
                     /translation="MSHPLTAAAAPGAAAIPPPPSSAVVPAPLTLPHDGVYLPKDAFF
                     SLIGASRQPAVPATAPPSYPAVGAVPAYPHHPSPYSHQPPPPPPHPATGLSGGAYGGM
                     HSVGYDDLAARHFGAYDPGVYWARRYDHLPPPPSYPAPYAAYGPPPPPPPQQQHHHHH
                     RRRDMMDDAPSTWERYPYDGAPPPPPSQQHGGGGHRQKQRSGKRRKEASQSSSSDEDL
                     SFPGEAEHGRARKKLKNHGGAQDGGGGEHHRGGGQHQRYDELRDAIHELKRDLFAARQ
                     GSALLSAAIPVPGVSHSAAPSPTTTTASSPAETPMITGDATPPPQTTPAGKVGAAERA
                     AAAVAGVVNASCRVDHAVAGTSGGSSSTTTAAGLPAAALALQNPPKDMVDLNRRLFVA
                     ALNKME"
     misc_feature    <117429..117551
                     /gene="UL80.5"
                     /locus_tag="CCMVgp072"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     gene            complement(118780..120456)
                     /gene="UL82"
                     /locus_tag="CCMVgp073"
                     /db_xref="GeneID:935515"
     CDS             complement(118780..120456)
                     /gene="UL82"
                     /locus_tag="CCMVgp073"
                     /note="upper matrix protein; involved in gene regulation;
                     transcriptional activator; targeted to ND10; targets Rb
                     proteins for ubiquitin-independent proteosomal
                     degradation; DURP family"
                     /codon_start=1
                     /product="tegument protein pp71"
                     /protein_id="NP_612715.1"
                     /db_xref="GeneID:935515"
                     /translation="MSRSPSPGEGPSAAGGPGGAPGDNGSTFGRMHCQVLRLVTNHDS
                     SLEPDRLKILDLRTSVEVSRTSVLCLFQENKSQHDTVDLTDLNVKGHCAVGERDQLKA
                     DLINYSQRRMSPGSSTPISVLAFGLPLERVPVSGIHLFQAHPRGDEENRLRTEARVDI
                     RRTAYHWGVRTTVSPRWRRKVDRSLEAEQIFTTEFIFRAGAIPLRLVDAVELLSCSDR
                     NTYIHKAETDARGQWVNVHLQHETLHPPPSVFLHFSLYTHGAEVVLRHNPYPHLTRHG
                     DNGFTLHAPRGFTLSRLHREYIVQVQNAFETNNTHDVIFFPADIPGVSMEAGPLPDRV
                     RITIRLTWTGENSVRIEHMQILGTIHLFKRGVLNLLPGKTEKIKRPQIQLRAGLFPRR
                     AVMRGEVSEFRPQSPGELPLEGEEEEEEEEERSSTPTPPALSESVFAAFEESSEEEES
                     DTEEGLSRALALTGRRRPRRGADEGEDLMLVIPSWNVFVNIDNLVPLTGSVEQAALKP
                     TSYLRSEMQGDVRTAADFTSNLQPVPVPRPSPMSLPSTSGTAASRSRPRI"
     misc_feature    complement(119356..120375)
                     /gene="UL82"
                     /locus_tag="CCMVgp073"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(120673..122340)
                     /gene="UL83"
                     /locus_tag="CCMVgp074"
                     /note="beta gene"
                     /db_xref="GeneID:935518"
     CDS             complement(120673..122340)
                     /gene="UL83"
                     /locus_tag="CCMVgp074"
                     /note="lower matrix protein; involved in immune
                     regulation; suppresses interferon response; inhibits NK
                     cell cytotoxicity; binds NKp30; DURP family"
                     /codon_start=1
                     /product="tegument protein pp65"
                     /protein_id="NP_612716.1"
                     /db_xref="GeneID:935518"
                     /translation="MESRGRRQPEMINVLGPISGHVLKAVFSRGETPLQPHETKSLQT
                     GIDVKVSQHSLILISQYTPESTPCHRGDNHLMVQHTYHTGEEVQNVTVNVHNPTGRAI
                     CPSQEPMSLYVYAMPLKMVNVPDINVHHYPTTAERKYRHLPVADTIIHQSGKQVWQAR
                     LTVSNLSWARQQNQWKEPDVYYTTSFIFNTKDVALRQVVSASQLVCSLENTRVVKMQV
                     VAEHYMKVYLESFHEDVPACKLFLHLSLGSDEEEDLTMTRNPQPFMRKHQRNGFTIMA
                     PKSLVIKPGKTAHVMLDVAFTSHEHFGLICPKVIPGLSISSNLLMSGQHIFLELRALR
                     ETVEIRQYDALAALFFFDRDMLMLRGPQYSEHPTFTDQFRVCGKLEYQHTWDRRSGDE
                     VGAAEEVWSSGSDSDEDELADRKPPRPLPLAGAAAAGSRKRKQPPPTTCTGVMTRGRL
                     KAESSMAPEEDTDEDSDIDSSNPAVFTWPQWQAGIQARHLVPLVATVQGHNLKYQEFF
                     WDADDVYRIFHDLEGVWVPCPLPKRRRYRQEPAAAPCIASTPKKHRG"
     misc_feature    complement(121273..122298)
                     /gene="UL83"
                     /locus_tag="CCMVgp074"
                     /note="Betaherpesvirus UL82/83 protein N terminus; Region:
                     Herpes_UL82_83; pfam05784"
                     /db_xref="CDD:283448"
     gene            complement(122672..124393)
                     /gene="UL84"
                     /locus_tag="CCMVgp075"
                     /note="beta gene"
                     /db_xref="GeneID:935520"
     CDS             complement(122672..124393)
                     /gene="UL84"
                     /locus_tag="CCMVgp075"
                     /note="involved in gene regulation; involved in DNA
                     replication; DURP family"
                     /codon_start=1
                     /product="protein UL84"
                     /protein_id="NP_612717.1"
                     /db_xref="GeneID:935520"
                     /translation="MPRGDPTLRNRARSRARKGPLTPSRQAHRRYRLHGSGGGGSGAG
                     GNHHSDALLPAHAVGPDDDTILTLTDKHNAKQPLTHRGTYHLIQLHIDLRPEELQHPF
                     QILLSAPLQLVENSAARRQHATASEERTAGNEEKEGAGEEEEDEDDRNEDRERGILCV
                     VSNEDSDIRPAFSLFPARPGCHIVRSMIDQQLAQMAIVRLSLNLFALRIITPLLRRLP
                     LRRKGTHHAALHDCLALHLPELTFEATRIAGGSGDDDTPPATDTELTPSLTVQVRHAL
                     CWHRVEGGISGPRGLTSRLSVRLSEATAAALGPSVFGRLELDAESPADLTLSSLTLYQ
                     DCVLRFNVTCDRSEGPSDPVSFRLRLRRETVRRPFFSDAPLPYFVQRPGEDGLEVRVP
                     YELCLKASHTLRIYRRFYGPYLGLFVPQNRQGLKMPVTVWLPRTWLEITVLVSGNHSN
                     AADSSNASGDGVVNHSNHHNQSGQDDDGSGGVSLPRDSVLGRLYFISSKHTLNRGCLS
                     ALTYQVKSALHNRPAPQLSVLGASIALQDLLPMRLLSAEPTQEQQQTPATEKPSPVTL
                     AMICGDL"
     misc_feature    complement(122678..124393)
                     /gene="UL84"
                     /locus_tag="CCMVgp075"
                     /note="Cytomegalovirus UL84 protein; Region:
                     Cytomega_UL84; pfam06284"
                     /db_xref="CDD:283854"
     gene            complement(124425..125339)
                     /gene="UL85"
                     /locus_tag="CCMVgp076"
                     /note="core gene"
                     /db_xref="GeneID:935525"
     CDS             complement(124425..125339)
                     /gene="UL85"
                     /locus_tag="CCMVgp076"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons; involved in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="NP_612718.1"
                     /db_xref="GeneID:935525"
                     /translation="MAAMESTIFCTFDHKLTIADLGKLAKLTAAVVPIPQRLHLIKHL
                     QLGLHQYTDHTRGYPRMRSLLRNMTLTLLRRVEGNQILLHVPTHGLLYTVLNTGPVLW
                     EKGDALCLLPPLFNGPMARENLLTLGKWELVLPWVIPVPLAQEINQRLLIMGLFSLDR
                     SYEEVKAAVHQLKTITYRDATFTLPDPVIDNYLLLDMKTACLSMSMVANLASDLIVTY
                     VRKLALEDSSMLLVKCQELLTRTDRERGGERVPPRPNHVSPDEEISRLSALFVMLRQL
                     DDLIREQTIFTVCDVSPDNKSATCIFKG"
     misc_feature    complement(124428..125330)
                     /gene="UL85"
                     /locus_tag="CCMVgp076"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03259"
                     /db_xref="CDD:165517"
     gene            complement(125515..129675)
                     /gene="UL86"
                     /locus_tag="CCMVgp077"
                     /note="core gene"
                     /db_xref="GeneID:935480"
     CDS             complement(125515..129675)
                     /gene="UL86"
                     /locus_tag="CCMVgp077"
                     /note="6 copies form hexons, 5 copies form pentons;
                     involved in capsid morphogenesis"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="NP_612719.1"
                     /db_xref="GeneID:935480"
                     /translation="MENWSALELLPKVGIPADFLTHVKTSAGEEMFEALRIYYGDDPE
                     RYNIHFEAIFGTFCNRLEWVYFLTSGLAAAAHAIKFHDLNKLTTGKMLFHIQVPRVAS
                     GAGLPTTRQTTIMVTKYSEKSPITIPFELSAACLTYLRETFEGTILDKILNVEAMHTV
                     LRALKNTADAMERGLIHSFLQTLLRKAPPYFVVQTLVENATLARQALNRIQRSNILQS
                     FKQKLLATLFLLNRTKDRDYIVKFLTRLVEAATDSILENPTTYTTGSGAKISGVMVST
                     ANVMQIIMSLLSGLISKETVSAPATYGNFVLSPENAVTAIAYHSILADFNSYKGHLTS
                     GQPHLPSDSLSQAGAHSLTPLPMDVIRLGERSVILENLRRVYKNTDTKDPLERNVDLT
                     FFFPVGLYLPEDRGYTTVESKLKLTDTIRNALPTTAYLLNRDRAIQKMDFVDALKTLC
                     HPVLHDPTPCLQAFAERGPPSDPMMQRLLESRFQREPMGGIARRVGHFYRVRREVPRT
                     VNEMKQDFVVTDFYKVGNLTLYTELHPFFDFTHCQDNSETVPLCTPRILVGNLPDGLA
                     PGPFHELRAWQIMEHVRLRPPPDYEETLRLFKSTVTNANYPELFYLVDVLVHGNTDAF
                     LILRNFVARCIVNMYQTRSLLAFAHSYSLVTLIAEHLADGVLPPHMLFHYRNLVAILR
                     LVTRISALAGVNNGQLADEPLAAYVNALHDHRLWPPFITHLPRTTEGVQIVADRQPLT
                     NANIEARHHGVSDVPRLGAMDADEPLFVEDHRASDDEWTLQKVFYLCLMPAMTNNRAC
                     GLGLNLKTLLVDLFYRPTFLLAADRQAASTTATASATGTAAASSGTATSGSGSGAAGD
                     DGAGSAAAQRQQVGELLSELVEDIATDAHVSLTQACRELFLAVQFVGEHAKVLEVRAE
                     LDHAQRQGLPDFTSLQFVLYNGCCAVTAPKIMVEYCLAVPFHRFYSDPVIGSGINDDI
                     KRYITDFPHYHRHDGGFPLPTAFAHEYHSWLRSPFSRYSATCPNVLHSVMTLASMLYK
                     ISPVSLVLQTKAHIHPGFALTAVRTDTFEVDMLLYSGKSCTSVIITNPIVTKEERDIS
                     TTYHVSQNINTVDMGLGYTSNTCVAYVNRVRTDMGVRVQDLFAVFPMHVYRHDEIDRW
                     IRHAVGVARPQLLDTETISMLTFGSMSERNAAATVHGQKAVCELVLTPASADINYYKI
                     TNNPRGRASCMLGVDPYDTDAATKALYDHREPDAQTFTATHNPWASQAGCLSDVLYNT
                     RHREKLGYNCKFYSPCAQFFDTDEIINSNKTLFKTIDEYLLRAKDCIRGDTDTQYICV
                     EGTEQLIENPCRLTQEALPILSTTTLGLMETKMKGGAGAFATSETHFGNYVVGEIIPL
                     QQHMLFNS"
     misc_feature    complement(125536..129639)
                     /gene="UL86"
                     /locus_tag="CCMVgp077"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:281162"
     gene            129706..132726
                     /gene="UL87"
                     /locus_tag="CCMVgp078"
                     /note="betagamma gene"
                     /db_xref="GeneID:935485"
     CDS             129706..132726
                     /gene="UL87"
                     /locus_tag="CCMVgp078"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL87"
                     /protein_id="NP_612720.1"
                     /db_xref="GeneID:935485"
                     /translation="MAAPPRRAGRDALIVESPAARRVLNVPVHVNSYNLTQELSTGED
                     ARFCRPRPVDAERVRAVFAALYRACPAHVRAEADRVKLVLGRLLLGPVAVPCYCDEWV
                     TAGEEEDDDGAAARLLREHLAETAQFCRGPLLYVHRRCRCAGGGAQRPLAFSVMEGHV
                     ATHVFRGLLSLAEWNCQLPGLFCPCVVGGAAAAATERYALACLPRDLSLHMDDYPYLM
                     VEIGRVLGVSEVDDYVGALSGYLGEAAAPRIQVHYKLLFGLNVRPQAPCALSATGDFF
                     LLELQKLWLGVEYHNEVTAEFFGRVLAQLHRERGRVMMALRLPEQTVCHLSAFVLSRF
                     KRQVLYFKLQVSYGKYKHAHASGLHPNLLCYRRLSVTFADTDTVWRNLFYVYYELSRD
                     VSAGASAAPGEQKGKKTATKEEEGEQEEKNGESRGHHGEDDDEDEEYQRRHRLSSSGH
                     GVGGRGRTQLLVAPPPPVTSLSGRSHDVAISVPPSSTSRLLGGGGGPLDAVAATAARA
                     GSGRRGGAAAGKGQRDPSADRIRRYVCIISRLMFARYGERGRRQRQRRDGDADGSGAF
                     DFTGQNLRRAYQEHRRRRHLAVQRFAPCRRKLIGGMEFAEVTGVSLDRIAVNAFNTNR
                     VINMKAALSASSASCAGCCRLNRLPKNMTHSFVMYKHTFKEPACTVSTFVSNDAVYLN
                     SLNVNIRGSYLEFLYSLGVYRLHVNIDHFFLPAVVCNSNSSLDVHGLEDQAVIRSERS
                     RVYWTTNFPCMISHTNNVNVGWFKAATAIVPRVSGSDLEAILLKELSCIKNMRDVCID
                     YGLHRVFTQLELRNSYQIPFLSKQLILFIRVCLLKLHGREKRLYLDRLVFEAAQRGLF
                     DYSKNLTAHTKIKHTCALIGSRLANNVPKILARNKKVKLDHLGRNANLLTVCRHVEAN
                     KISRVRLRVLVEVLSTLQGISGTPHTREVIRQTLFRLCGDAAGSGGGLFGASGQPSSE
                     TAVGADVIFASGLTSSSPPPPPSVPPSSPVDTRR"
     misc_feature    129712..132564
                     /gene="UL87"
                     /locus_tag="CCMVgp078"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03375"
                     /db_xref="CDD:223064"
     misc_feature    129730..130416
                     /gene="UL87"
                     /locus_tag="CCMVgp078"
                     /note="Protein of unknown function (DUF587); Region:
                     DUF587; pfam04532"
                     /db_xref="CDD:282400"
     misc_feature    130426..132501
                     /gene="UL87"
                     /locus_tag="CCMVgp078"
                     /note="Herpesvirus UL87 family; Region: Herpes_UL87;
                     pfam03043"
                     /db_xref="CDD:281093"
     gene            132723..134267
                     /gene="UL88"
                     /locus_tag="CCMVgp079"
                     /note="betagamma gene"
                     /db_xref="GeneID:935487"
     CDS             132723..134267
                     /gene="UL88"
                     /locus_tag="CCMVgp079"
                     /codon_start=1
                     /product="tegument protein UL88"
                     /protein_id="NP_612721.1"
                     /db_xref="GeneID:935487"
                     /translation="MMEAAASASATASRLGGGATGGSASSSFLEEDDRLAPGWRDAAL
                     VQGDGSVREHAFKNVALSELVRRVIPPPPDADEGVVFASELSLYSSGRVSRISSVFSI
                     YWQGHSELVYILTGLTHCTKLVVECGQMKGTVTGDRGWDGDSRHRHSISSPHHSGSSS
                     SSHSHRSRHTGYSNSRPRHSHSSGSSTSTTTSSSRDTSSGGLGDRDDRGRGAGSGAMA
                     VEDDLLYEVPGIYMIRVSDGNMGPRNVVWPKTSVLWAPDVEISTVRRHSAAVRAFASA
                     LRNYMFWMGRRSQEELEVCPPEVEDHLAPLLRGPTRGDSEIFDGLVGSAYQRLRQSDI
                     PRSSSLLLEHCVGMASLKKLLLLDLPRLENFYLCQVCLYELDEDEVGEEMLGMLAGRP
                     GDSGDAAEFFLHRKTMKVAACLALMLNCLHKYQEGLSTIEQLQSVLQQQRLDENDLIL
                     VALRRYYRHRTGVHARTLAAAKALISEFAENFSPMGSYTRLGFDRLGALDAEVSIQDL
                     VAVLRA"
     misc_feature    132825..134264
                     /gene="UL88"
                     /locus_tag="CCMVgp079"
                     /note="Herpesvirus U59 protein; Region: Herpes_U59;
                     pfam04529"
                     /db_xref="CDD:282397"
     gene            complement(134264..140376)
                     /gene="UL89"
                     /locus_tag="CCMVgp080"
                     /note="core gene"
                     /db_xref="GeneID:935488"
     CDS             complement(join(134264..135400,139495..140376))
                     /gene="UL89"
                     /locus_tag="CCMVgp080"
                     /note="contains ATPase domain; involved in DNA
                     encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="NP_612722.1"
                     /db_xref="GeneID:935488"
                     /translation="MLHGDSAAKIQERYEELQKRKNHPTSCISTAFTNVAALCRKRYQ
                     MMHPELGLAHSCNEAFLPLMAFCGRYRDYHSPEEKRELVFHERLKSALDELAFRPCPE
                     EQRASYQKLDALTELYRDPQFVQINSFMTDFKKWLDGGFATAEGDAKPIRLEPFQKNL
                     LIHVIFFIAVTKIPVLANRVLQYLIHAFQIDFLSQTSIEIFKQKATVFLVPRRHGKTW
                     FIIPIISFLLKHMIGISIGYVAHQKHVSQFVLKEVEFRCRYTFARDYLVENKDNVISI
                     DHRGAKSTALFASCYNTNSIRGQNFHLLLVDEAHFIKKEAFNTILGFLAQNTTKIIFI
                     SSTNTTSDATCFLTRLNNAPFDMLNVVSYVCEEHLHSFTEKGDATACPCYRLHKPTFI
                     SLNSQVRKTANMFMPGAFMDEIIGGTNKIAQNNVLITDQSREEFDILRYSTLNTNAYD
                     YFGKTLYIYLDPAFTTNRKASGTGVAAVGTYRHQFIIYGLEHFFLRDLSESSEVAISE
                     CAAHMAVSILSLHPYLDELRIAVEGNSNQAAAVRIACLIRQSVQSTKLIRVLFYHTPD
                     TNRIQQPFYLMGHDKALAVEQFISRFNSGYIKASQEVVSYTIKLNHDPIEYLLEQLQN
                     LHRVTLAEGGAGSYSAKRHQRFSDDLIIAVIMATYLCDEMHAIHFRVS"
     misc_feature    complement(join(134267..135400,139495..140376))
                     /gene="UL89"
                     /locus_tag="CCMVgp080"
                     /note="DNA packaging terminase subunit 1; Provisional;
                     Region: PHA03372"
                     /db_xref="CDD:177609"
     misc_feature    complement(join(135392..135400,139495..140253))
                     /gene="UL89"
                     /locus_tag="CCMVgp080"
                     /note="Probable DNA packing protein, N-terminus; Region:
                     DNA_pack_N; pfam02500"
                     /db_xref="CDD:280634"
     misc_feature    complement(134276..135313)
                     /gene="UL89"
                     /locus_tag="CCMVgp080"
                     /note="Probable DNA packing protein, C-terminus; Region:
                     DNA_pack_C; pfam02499"
                     /db_xref="CDD:280633"
     gene            135679..136110
                     /gene="UL91"
                     /locus_tag="CCMVgp081"
                     /note="betagamma gene"
                     /db_xref="GeneID:935491"
     CDS             135679..136110
                     /gene="UL91"
                     /locus_tag="CCMVgp081"
                     /codon_start=1
                     /product="protein UL91"
                     /protein_id="NP_612723.1"
                     /db_xref="GeneID:935491"
                     /translation="MNALLTELNRLGVAHASSEDVFLFVDRLFHNFAFLFQTEESSPR
                     RLELVSGLFEHLTVECVNDIVDACNHPDVPGTEGGGGSGAAGGGAAAEGGAATNAPVP
                     MSTGNVSPSVVSSSKLSCDSPVFVPASATAAGCATPRAPAT"
     gene            136080..136688
                     /gene="UL92"
                     /locus_tag="CCMVgp082"
                     /note="betagamma gene"
                     /db_xref="GeneID:935469"
     CDS             136080..136688
                     /gene="UL92"
                     /locus_tag="CCMVgp082"
                     /codon_start=1
                     /product="protein UL92"
                     /protein_id="NP_612724.1"
                     /db_xref="GeneID:935469"
                     /translation="MCDASGACDMRHVHNAFTEEIQLHSLYACTRCFRTHLCDLGSGC
                     ALISTLEGSVCVKTGLVYEALYPVARRHHLLEPIEETSLDDVNIIGAVLSGVYSYLMT
                     HAGRYADVIQEVVERDRLKKQVEDSIYFTFNKVFRSMHNVNRISVPVISQLFIQLIIG
                     IYSKQTKYDSCVIKVSRKKREDALLKQMRSEYGNAPVFGSGL"
     misc_feature    136101..136664
                     /gene="UL92"
                     /locus_tag="CCMVgp082"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     gene            136654..138474
                     /gene="UL93"
                     /locus_tag="CCMVgp083"
                     /note="core gene"
                     /db_xref="GeneID:935470"
     CDS             136654..138474
                     /gene="UL93"
                     /locus_tag="CCMVgp083"
                     /note="capsid-associated; involved in DNA encapsidation;
                     involved in capsid transport; similar to HSV-1 UL17"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="NP_612725.1"
                     /db_xref="GeneID:935470"
                     /translation="METHLYSDLAFEARFAADWQLPLHLVLDHSALSCEEAETLRYVY
                     YRNAVRPAPPPQSTEQGGPEQDAAEDWQRAAFRVLPRPLELLAYLRDSGLTVTLPADD
                     PGVRMYYAVFTTLGLRCPDKRISGSQMLYLRLMWDQGRQRDWEFLARDLLREEIEANR
                     IDRHQRELAEARAVNNRRLTSGTARPLLSSATTSSAPSHPLLGSEPAFGRSDSPAMAA
                     AAAAAAELPPLESAAGTPFFQIPRAPAGADGGSGQSGGPSDLELRVARLLRGDPEFTY
                     HAGPLEPPSRIRGRELVQTRVDINPDLMYATSAQEPVEVSRTDEWKGAGVSRRREVWD
                     VQRRVRFHVLWYVNSFWRTCGLTYDDNEADLYRALDAYRSRIAVEYVLIRAVRDEIRL
                     VLQHRRALRQLFACHVVRKMSWIHVWELFRHALELWIDRADERSCIIKALTPRLGRPA
                     RAPTPERLDRDASALKPYPWLAGRGSLPEEPERVWYADVVRCVRAQVDLGVEVRVRRC
                     RRTGLWVARDRRGQLRRWPSQAEVCVLYVTPELHFHWVLPGGFAVSSRLCLDGLGQRG
                     LRERFQVGEAVFTRGMHLATGLQGPEAPRVSGNLLQVGDL"
     misc_feature    136654..138330
                     /gene="UL93"
                     /locus_tag="CCMVgp083"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:282425"
     gene            138332..139372
                     /gene="UL94"
                     /locus_tag="CCMVgp084"
                     /note="core gene"
                     /db_xref="GeneID:935472"
     CDS             138332..139372
                     /gene="UL94"
                     /locus_tag="CCMVgp084"
                     /note="possibly involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="NP_612726.1"
                     /db_xref="GeneID:935472"
                     /translation="MAWGNGVCANDSRSVRQFLQEECIWRLVSKGQKHREYRAICCKS
                     AIFSTQDDSSCILCQLILLRRNRHEYIICLNANGKYQGHYSSPRVHRRRRHICHLPPV
                     YQLIITGPLGPAHLDFLPRFNHVVSSMSCRGISPDTMYEVCQVVSEDEAKRVVIKGDG
                     AVSLTGDKAVSLGGTGAWLVVRPEGYVLYFYILCYDLYTSCGNRQEMPSMARLMAAAT
                     ACGQMGCTFCVDHGGHVDPTGEYAGSVSDHGGCFCYIPCGPMTQSAIHNPEPATFFCE
                     DEKAQFLCTCGSKTAPQITLASGLDYVFGVKDAEGGWLQAKQDVWDLVKVEEPVSRML
                     VCSCPVLKNLVH"
     misc_feature    138335..139369
                     /gene="UL94"
                     /locus_tag="CCMVgp084"
                     /note="tegument protein UL16; Provisional; Region:
                     PHA03352"
                     /db_xref="CDD:223053"
     gene            140375..141913
                     /gene="UL95"
                     /locus_tag="CCMVgp085"
                     /note="betagamma gene"
                     /db_xref="GeneID:935473"
     CDS             140375..141913
                     /gene="UL95"
                     /locus_tag="CCMVgp085"
                     /note="promotes accumulation of late transcripts"
                     /codon_start=1
                     /product="protein UL95"
                     /protein_id="NP_612727.1"
                     /db_xref="GeneID:935473"
                     /translation="MMAAPSASSSSSCPPSVSRKRASRAGPSTSLQASHRVDADVVSL
                     ISSSSTSDSSPPPSPPPSSSFVSPVFSPASVPSPSPVRVASPRLRKAPASLSGVSTSL
                     CAVERMVELSTQAPPEDFAAGETLRFEEAVNMALVACEAVSPYDRFRLIETPSENFLL
                     VTNVIPRESSSAVEAPASVPGDDDEEGGGGEDNSSSSRFSAFRHDVLERFAVSAEAPP
                     PPCVRDYALRNADRVTYDGQLIYGSYLLYRKSHVELALSSNKAQHVEAVLRQVYTPGL
                     LDHHNVCDVEALLWLLYCGPRSFCARDTCFGREKNGCPFPALLPKLFYEPVRDYMTYM
                     NLAELYVFVWYRGYEFPASATGAGAGGAPEPSSASSSSAVPTGAAAVGDAVPDDDSNG
                     GELHLPLKPVSLDRLREVLQVVRSRFSGREVPTWPASSRTCLLCALYSQNRLCLDLAR
                     DDARTVSYSPIVIQDCAAAVTDVTLSHILPGQSTVSLFPVYHVGKLLDAISLTDAGLI
                     TLNL"
     misc_feature    140696..141886
                     /gene="UL95"
                     /locus_tag="CCMVgp085"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            141910..142305
                     /gene="UL96"
                     /locus_tag="CCMVgp086"
                     /note="core gene"
                     /db_xref="GeneID:935462"
     CDS             141910..142305
                     /gene="UL96"
                     /locus_tag="CCMVgp086"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="NP_612728.1"
                     /db_xref="GeneID:935462"
                     /translation="MTSANKQLLKEVMRLDLERQQHQFLRRAYGSRHRLTSHQALSVM
                     RTAVREQTHYSRLTVQRVGAHLLGDERQELQRELARAKQLQRLDVDGALDSLTELKDT
                     VDDVNCAFVDSVSSTCDLELEADDAENAT"
     misc_feature    141946..142215
                     /gene="UL96"
                     /locus_tag="CCMVgp086"
                     /note="Protein of unknown function (DUF2664); Region:
                     DUF2664; pfam10867"
                     /db_xref="CDD:287800"
     gene            142371..144683
                     /gene="UL97"
                     /locus_tag="CCMVgp087"
                     /note="core gene"
                     /db_xref="GeneID:935460"
     CDS             142371..144683
                     /gene="UL97"
                     /locus_tag="CCMVgp087"
                     /EC_number="2.7.11.1"
                     /note="involved in protein phosphorylation"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="NP_612729.1"
                     /db_xref="GeneID:935460"
                     /translation="MASSLRSRARSSSADSGSGWDPPPLQRPSRARRRNWVREAAATA
                     AAAAAASSNVAQEAAALAALANVTTSVGTSVFRHASSSGRNRVVSASATTVVAAATTS
                     SSSLRSDGLSPARLAVPAVAAPASPPPTPLPADSNKENRGLSGRRSAVSSDGGSSYHG
                     LRCRESSDMWSFEYEGDDGVTSVRGGVVGATNGGGGNSLGFGIGTNTSVLGSVLLSSR
                     SSGDPLESGAISRRRRRCSSGGQGQRGPLVSLARTPLCRTGGRAVRVKNHVAASTFRD
                     LDGGGGAGGDTSDSQPPPEDEDDESATTDGEGVGVLDDPVGVGPGAAANVEPEHDDVH
                     CTCSNEHVITTSIRGLTCDPRMFERLDHPELCEVSLSYLLVYVPKDEDFCQKVCYAVD
                     LSDESFRLGQGSFGEVWPLDRQRVLKIARKHSETVLTVWMSGLIRTRAAGDEQQPPSL
                     AGTGVYRGLLTATGCCLLHNVTVHRRFHTDLFHHDHWKLACVDSYRRAFCTLADAIKF
                     LNHRCRVCHFDITPMNVLIDVNPRNPSEIVRAALCDYSLSEPYPDCNDRCVAVFQETG
                     TARRIPNCSHRLRECYHPAFRPMPLQKLVVCNPHARFPVSGLRRFCMAELAALGNVLG
                     FCLMRLLDRRGLDEVRLGSEALLFKHAGAACRALENGKLQQCADACLLIMGAQISYHA
                     CLLGEHGDSLLPHALRFVDNKVSSCRVRAFRRFYTECSHVMLHEYVRKNLERLLATAD
                     GLYLYNAFRRATTITCEEDLDADCRQMFPE"
     misc_feature    <143838..>144023
                     /gene="UL97"
                     /locus_tag="CCMVgp087"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:304357"
     misc_feature    143940..144485
                     /gene="UL97"
                     /locus_tag="CCMVgp087"
                     /note="Region: UL97; pfam06734"
                     /db_xref="CDD:284210"
     gene            144859..146550
                     /gene="UL98"
                     /locus_tag="CCMVgp088"
                     /note="core gene"
                     /db_xref="GeneID:935555"
     CDS             144859..146550
                     /gene="UL98"
                     /locus_tag="CCMVgp088"
                     /note="involved in DNA processing; similar to HSV-1 UL12"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="NP_612730.1"
                     /db_xref="GeneID:935555"
                     /translation="MWGVSNLNYDDDEELTRLLAVWDDEPLSLFLMNTFLLHQEGFRN
                     LPFTVLRLSYAYRIFAKMLRAHGMPVAEEFMSRVAALARDEGLRDILSQRHATEASRA
                     DIADALDRVAERHDDRLGGSDDYLWLSRLLDLAPNYRQVELFQLLEKESRGQSRNSVW
                     HLLRLDTVSATKFYEAFVSGCLQGASSASAASSRAGVSPGIQFGLKHEGLVKTLVECH
                     VMHGREPVRDGLGLLIDPTSGLLGASVDLCFGVLKQGGTRTLQVEPCARVYEIKCRYK
                     YLRKKEDPFVQNVLRRHDAAAVASLLQSHPVPGVEFRAEREVPSAREFLLSHDAELFK
                     ATLKRARPLKAPEPLRDYLSDLLYLNKTERSEVIVFDAKHLDDGTINASLGPAAGGAD
                     DEAAGGGSSGGSQTAFEDENTPELLGRLNIYELARFPLPAFVNPRHQYYFQMLIQQYV
                     LSQYYIKKHSDPERIDFRDLPTVYLVSAIFREREESEVGRELLAGGRPFNCDHIPLLI
                     IVTPVVFDPQFTRHAVSTVLDRWSRDLSRKTNLPIWVPNSANEYVVSSVPRPATP"
     misc_feature    144910..146505
                     /gene="UL98"
                     /locus_tag="CCMVgp088"
                     /note="YqaJ-like viral recombinase domain; Region: YqaJ;
                     cl09232"
                     /db_xref="CDD:298855"
     gene            146487..147170
                     /gene="UL99"
                     /locus_tag="CCMVgp089"
                     /note="core gene"
                     /db_xref="GeneID:935582"
     CDS             146487..147170
                     /gene="UL99"
                     /locus_tag="CCMVgp089"
                     /note="envelope-associated; involved in virion
                     morphogenesis"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="NP_612731.1"
                     /db_xref="GeneID:935582"
                     /translation="MGAELCKRVCCEFGAPSGDPLRDVMGRRVNLRGYDNMPHTSSSE
                     SDLEEDDDVDYPSADPQKRRLHPGPSGGGSVLSQKKKHASQQNVYEHPYHEPVVVFKG
                     PGHDDGEEDGNEADRSSLSTVRSSFRQDNKKKKKTKKKKTTSQQSSIMQETDDDPDLD
                     DERSACLGGASSSPPPLPPRGGSQTTAGSGSRRLPRPATPMPSKKIKSRSGSESTTSS
                     RVSMSSSCY"
     gene            complement(147480..148571)
                     /gene="UL100"
                     /locus_tag="CCMVgp090"
                     /note="core gene"
                     /db_xref="GeneID:935496"
     CDS             complement(147480..148571)
                     /gene="UL100"
                     /locus_tag="CCMVgp090"
                     /note="type 3 membrane protein; 8 transmembrane domains;
                     complexed with envelope glycoprotein N; involved in virion
                     morphogenesis; involved in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein M"
                     /protein_id="NP_612732.1"
                     /db_xref="GeneID:935496"
                     /translation="MAPSHVDRVNTRTWGASIVFMVLTFVNVSVHLVLSNFPDLGYPC
                     VYYHVVDFKKINMSAFNVMHLHTPTLFLDSVQLVCYAVFMQLVFLAVTVYYLVCWVKI
                     AWRRDQSTVLNQSTRDISYMGDSLTAFLFILCMDTFQLLTLTMSFRLPSMIAFMSVVH
                     FFCLTVFNISMVTHYQSYKRTLFHFSRLHPRLHGTVQFRTMIVNLVQVALGFNTVVVA
                     MGLCYGFGNNFFVRTGHMVLAVFVVYAVISIVYFLMIESVFFQYVKVQFGYHLGTFFG
                     LCGLIYPIIKYEQLVGDNYLPVISWCFGAVFLIWATFTACRAIRYFRARSLFKYQALK
                     TTSEEEIASLKHNEAAMPESDEDEESEGA"
     misc_feature    complement(147528..148571)
                     /gene="UL100"
                     /locus_tag="CCMVgp090"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     pfam01528"
                     /db_xref="CDD:279822"
     gene            148816..151524
                     /gene="UL102"
                     /locus_tag="CCMVgp091"
                     /note="core gene"
                     /db_xref="GeneID:935492"
     CDS             148816..151524
                     /gene="UL102"
                     /locus_tag="CCMVgp091"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="NP_612733.1"
                     /db_xref="GeneID:935492"
                     /translation="MAANHYTLVGASCHLSWYGILEASVPIVQCLFMDLGALGGRAEE
                     PRLRTFIVRGDRLPSAEVRAVHRASYASLASAVADAEERRRGIEHRSAVLARVLLEGS
                     AIIRVLARTFTPVQIQTDPSGVEILEAVPALGFDAAALSHALSLYHVAKLVVIGSYPE
                     IHDAVATSSSVSARVATGGHEDYATQAHKKLRRGYYAYDVAMSFRVGAHKYVLERDDA
                     AAVVSRLFEVREVCFLRTCLRLVTPVGFVAVAVTDEQCCLLLKSAWTHLYDALFRGFA
                     GQTPLRDYLGPDLFESGGARSFFFPGFPPVPIYVVNGLHALMRETALDAAGEVLSWCG
                     LPDIVGPAGKLEVEPCELSLGVPDDEWQVFCGEGGRAVRLNATAFRERPAVTDLLQLQ
                     QQHRRSPPPPAHTTSSSSIARAHPSSDEDDNAPSSSSPSPSPSAVVSSSTGGAHPPHD
                     DATFTVHVRDATLHRVVIVDLVECVLAKCIRGRDFNPYVRYSNRLHTHAVCERFIENL
                     RYRSRRAFWQVHSLLGYISEHVTSACTAAGLSWVLSRGHREFYLYDGRSGHGPVSAEV
                     CVRTVVDCYWRKLFGGDEPGPVCRVQESAPGVLLVWGGERLVGPFSFYGAGGALLGAG
                     AVGSGGGGAGGGGGGGAAPPPHYHVPVGCCGGCCAGGGVRDEGGSPAAAPLLLGCCCA
                     GGDWLSAVGHVLGRLPGLLRERVGVPELEAVYREILFRFVARRNDVDFWLLQFQPGEN
                     EVRPHAGVIDCAPFHGVWAERGQIIVQSRDAALAADIGYGVYVEKAFAMLTACIEVCA
                     QDILSSSAAPAAVTAPVPTSSTRSPLLSSVLPPPAVLSPSSVPSCSSAATVTTTVTAA
                     PSSSSSAAWDGDDEERDEWARSLGSDARKAARRVASEGLRFFRLNA"
     misc_feature    148948..>149364
                     /gene="UL102"
                     /locus_tag="CCMVgp091"
                     /note="flagellar biosynthesis regulator FlhF; Provisional;
                     Region: PRK12727"
                     /db_xref="CDD:237182"
     gene            complement(151729..152472)
                     /gene="UL103"
                     /locus_tag="CCMVgp092"
                     /note="core gene"
                     /db_xref="GeneID:935571"
     CDS             complement(151729..152472)
                     /gene="UL103"
                     /locus_tag="CCMVgp092"
                     /note="involved in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="NP_612734.1"
                     /db_xref="GeneID:935571"
                     /translation="MESLMIRGVLEVRTDFTKHNVMIMVPRVMDFTVKDDRLWVQTVQ
                     SPMLSMSEYRAELLHGTSFVGYSTVFLLETEDAITQLKLTDLRVKHRCGLVKPDNLMH
                     FSLCTILSCVENCNLSRQCLFDLLSYLRMMNVRDSFGKLLQHSARRLICSALYLFFEE
                     KDADVVEHVPATFMLYLQARHSCLEIVTRFFFRITRQDEDHVFSLKLTDRKTLDGWAV
                     GLALLDVLNANFPNLPGPPKISPSGVLTR"
     misc_feature    complement(151780..152451)
                     /gene="UL103"
                     /locus_tag="CCMVgp092"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7;
                     pfam01677"
                     /db_xref="CDD:279943"
     gene            complement(152420..154435)
                     /gene="UL104"
                     /locus_tag="CCMVgp093"
                     /note="core gene"
                     /db_xref="GeneID:935471"
     CDS             complement(152420..154435)
                     /gene="UL104"
                     /locus_tag="CCMVgp093"
                     /note="dodecamer located at one capsid vertex in place of
                     penton; involved in DNA encapsidation"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="NP_612735.1"
                     /db_xref="GeneID:935471"
                     /translation="MERNHWNEKSSAAKRSRERDLTLSTIRSILAADDRLRISASSYL
                     AGRGGDDEAVIDIFPTGQTMSFLRLLHGFMGACRGKSMHQVLRDPCVLRKQLLYGVCK
                     TLFDTMTARRVAEEWKLHAALFPYRALDDEDLEQYLLVWSASIRQSVETGVLGTLREI
                     LYQYADNDEYGLYVDWWATVGIVPLVDARPKEREVLERAQFVRAAVQRSTETHPLAQE
                     LLSANLALLLQVVERLCAVRVANGPEVRVFKKVRSERLEAQLRGKGIRVYVACEPLAY
                     ERDRLLLTTPVAHLHEEILRYDGLCRHQKICQLLNTFPVKAVTMSRHELNCKKMVEMM
                     EKHDRGSDAKKSIMKFLLNVSDSKSRIGIEDSVESFLQDLTPSLVDQSRLLPSRAPGG
                     VVGPGPGPGGGGGLGAASSVSGGLGQERDIRDVFKKQVIKCLEEQIEAQVDEIQDLRT
                     LNQTWEHRVHELRDLLTRYASRREDSVNLGARDAELYHLPVTEAVRKAQEATPFRALP
                     VEDNRLVANSFFSQYVPSTEPLERLLTQLWENEYFRTFRLRRLVTNQGAEEAIVYSNY
                     TVERVTLPYLSSVLGLSALDPIPEAYLHLSFGEIVAAAYDDSKFRQYVELICNREKAR
                     HRQMTRVEGAPPRPAPEQRRRGPERVDRFRNGVPDDPRRAGGPYGLH"
     misc_feature    complement(152573..154246)
                     /gene="UL104"
                     /locus_tag="CCMVgp093"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            154266..157145
                     /gene="UL105"
                     /locus_tag="CCMVgp094"
                     /note="core gene"
                     /db_xref="GeneID:935521"
     CDS             154266..157145
                     /gene="UL105"
                     /locus_tag="CCMVgp094"
                     /note="involved in DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="NP_612736.1"
                     /db_xref="GeneID:935521"
                     /translation="MSITASSSPPRPARYDDALILNLSSAAKIERIVDKVKSLSRERF
                     AAEDFSFQWFRSISRVERGGTASGADAGRVGKSEPSTSSVPRPTSVASSVAAAANQEA
                     GTRVPRVDRWPFFPFRTLLVTGTAGAGKTSSIQVLAANLNCVITGTTVIAAQNLSAIL
                     NRTRSAQVKTIYRVFGFVSKHVPLAEAGSETLERYRVCDAREENTIQRLQINDLLAYW
                     PVIADIVEKYLNMWERKASLDDVSELCESNIIVIDECGLMLRYMLQVVVFFYYFYNAL
                     CDTRLYRERLVPCIICVGSPTQTEALESRYDHYTQNKSVRKGIDVLSALIQNEVLMNY
                     CDVASNWIMFINNKRCTDLDFGDLLKYMEFGIPLKDEHVAYVDRFVRPPSSIRNPSYA
                     SEMTRLFLSHAEVQLYFKRLHDQIRLSEKHRLFDLPVYCVVNERAYQELCELADPLGE
                     SQQPVEVWFRQNLARIINYSQFVDHNLSNEIVKERLRPAQEVVQQQREQQQEVATAVL
                     GGGGSRSAVLGGGGGLDDVIAAEGGYVPPAAAAADGGVSPYRETLLTLRITYIKGSSV
                     GVNSKVRACVIGYQGTVSRFVEILQKDTFIERTPCEQAGYAYSLVSGLLFSAMYFFYV
                     SPYTTEEALRELARIELPDVPSLCFGGANNVAAAAPEQDDDGSARVSFSPVRNPVVSD
                     DSDDGGEAEETHDIPCMAEDDLAVTDAELVDHTDLYVDPFFHKYSKPPSVSLLSFEET
                     VHIYTTFRDIFLKRYRLLQRLTEGRFATLPLVTYNRRNVVLKPNCQISSQTGSFVGML
                     SYVSPVQTYTLEGYTCDNVLSLPSDRHRIHPEVVQRGLSRLVLRDALGFLFVLDVNVS
                     RFVESAQGKSLHVCTTIDYGLTSRTAMTIAKSQGLSLEKVAVDFGDHPKSLKMSHIYV
                     AMSRVTDPEHLMMNVNPLRLPYEKNTAITPYICRALKDKRTTLIF"
     misc_feature    154278..157142
                     /gene="UL105"
                     /locus_tag="CCMVgp094"
                     /note="helicase-primase subunit BBLF4; Provisional;
                     Region: PHA03311"
                     /db_xref="CDD:223040"
     misc_feature    154302..157142
                     /gene="UL105"
                     /locus_tag="CCMVgp094"
                     /note="Helicase; Region: Herpes_Helicase; pfam02689"
                     /db_xref="CDD:280797"
     gene            162822..165230
                     /gene="UL112"
                     /locus_tag="CCMVgp095"
                     /note="beta gene"
                     /db_xref="GeneID:935468"
     CDS             join(162822..163563,163777..165230)
                     /gene="UL112"
                     /locus_tag="CCMVgp095"
                     /note="involved in gene regulation; involved in DNA
                     replication"
                     /codon_start=1
                     /product="protein UL112"
                     /protein_id="NP_612737.1"
                     /db_xref="GeneID:935468"
                     /translation="MDPQTTVVRKYWNFTNPNRILHQSVNHSFDVRQFIFDTARVVDC
                     VDGEGKVMHLTKGWLCATIVQNGEPAAGSKTQQGFMSIDITGDGDLKENLFVRGGIVS
                     NKSVSSVVGTGGPNESALLTMICENGSLQVTYVRHYVKSHAEAGPSSGASATTTAASS
                     GICLPSSLSGGGSNNSGSGHGGGGGSGSSSGGLGLADEHQRRARQEQRHEERRKKSSS
                     SGGNPDPANGMLRDPRLMNRQKERRPENDGCSPLRDAKRQKMMATQPSQHHHHHESKS
                     GANGGHEAESCVGMSGAGGNSGAHGGGNNGSGATTAGLNRMLPLDGGVTSEAVAFLNY
                     SANNATEAGADGALLGCGGSGNERGEEESRPRTPKMAVAGPSPRPLRAEPVPGGGAGE
                     LVVASATATVASEVVVMPASSNCRVPPPNSQESAVPQRPRSPRFDDIIQSLTKMLNDC
                     KEKRLCDLPLVSRIVPEARTAAPGQPPQQQPQQQQQQSQPPRVPATAPTATATSSDGN
                     PNDNGRQHHHTAAGASSATAAAAVTVAAAAAAAVTVASAAVAATSAAGPGLAAAAATL
                     PLATGAGETVTATPPAAATHTTTATASRPVCQIKPYVVNPVTTRPAADEEDDAVRPTT
                     SAGGGHRGRRANHSDAAGTGRRGRSRSARGGGGTGGRRQTSSSSTRRSRRRNARRDDD
                     DDEDDQPGPSSGGSRRRRGPSFMEDGLEIIDPSEEAAIAAASIAAFFDD"
     misc_feature    162846..163556
                     /gene="UL112"
                     /locus_tag="CCMVgp095"
                     /note="HSV U79 / HCMV P34; Region: U79_P34; pfam03064"
                     /db_xref="CDD:281109"
     gene            complement(165506..166258)
                     /gene="UL114"
                     /locus_tag="CCMVgp096"
                     /note="core gene"
                     /db_xref="GeneID:935508"
     CDS             complement(165506..166258)
                     /gene="UL114"
                     /locus_tag="CCMVgp096"
                     /EC_number="3.2.2.3"
                     /note="involved in DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="NP_612738.1"
                     /db_xref="GeneID:935508"
                     /translation="MALREWMLANIADNKGCMLNPDEQARVFCLSADWVRFLSLPEHD
                     TALLRETVAAVESARQRGVVYPPPEHVHRWSFLCSPERVRVVIVGQDPYCDGSASGLA
                     FGTMMGKPPPPSLNNVFREVARTVDGFRRPTWGCLDAWCQRGVLLLNTVFTVVHGQPG
                     SHRHLGWQTLSGRVIRRLSELREHLVFMLWGAEAQSCEYLIDRRRHLVLKACHPSPKN
                     TSKSFVGNDHFVLANAYLDTHYQETIDWRLDS"
     misc_feature    complement(165509..166258)
                     /gene="UL114"
                     /locus_tag="CCMVgp096"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03200"
                     /db_xref="CDD:165467"
     misc_feature    complement(order(165620..165622,165812..165814,
                     165917..165919,165950..165955,165980..165994))
                     /gene="UL114"
                     /locus_tag="CCMVgp096"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(165605..165616,165620..165625,
                     165683..165688,165917..165925,165980..165982,
                     165986..165991))
                     /gene="UL114"
                     /locus_tag="CCMVgp096"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(165608..165616,165620..165622,
                     165683..165688,165782..165787,165917..165925,
                     165977..165979,165980..165982,165989..165991))
                     /gene="UL114"
                     /locus_tag="CCMVgp096"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(165620..165622,165986..165988))
                     /gene="UL114"
                     /locus_tag="CCMVgp096"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            complement(166230..167054)
                     /gene="UL115"
                     /locus_tag="CCMVgp097"
                     /note="core gene"
                     /db_xref="GeneID:935510"
     CDS             complement(166230..167054)
                     /gene="UL115"
                     /locus_tag="CCMVgp097"
                     /note="contains signal peptide; complexed with envelope
                     glycoprotein H; involved in cell entry; involved in
                     cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="NP_612739.1"
                     /db_xref="GeneID:935510"
                     /translation="MYDLRPPRHRLRILTVVAWIVAAAAAAASSDPACPELTRRCLAG
                     EVFPAKDDSWLWPLVNATHRDGMLSQLIRYPSLRHQQQLLQGQQQQAVGAVTVDDGFL
                     ESLLMLYNNPSQLRALLTLINSDAAPRWMALLRGYGQCGDGSPSIYTCVDDLCRGYDL
                     TQLKYVRTVFSEHVLGFELVPPFYFNALLAVRNEATRTSRAVRVPVSTARSPGGITLF
                     YQLYNLVKEFCLRHGLNPPLLQRLDKYYADLPAALKQARVNLPARSRYGPAGVDAG"
     misc_feature    complement(166257..167036)
                     /gene="UL115"
                     /locus_tag="CCMVgp097"
                     /note="envelope glycoprotein L; Provisional; Region:
                     PHA03302"
                     /db_xref="CDD:223038"
     gene            complement(167054..168040)
                     /gene="UL116"
                     /locus_tag="CCMVgp098"
                     /db_xref="GeneID:935511"
     CDS             complement(167054..168040)
                     /gene="UL116"
                     /locus_tag="CCMVgp098"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL116"
                     /protein_id="NP_612740.1"
                     /db_xref="GeneID:935511"
                     /translation="MKKRPRGAWPLLLWLTCAVVLADGENSTGSNTSATTIVTTGTTR
                     STTTAATAASSTSVVTATASTSLLSSSTVSQKTPANGTTTTNATTSGNSSGVTTSAVI
                     TDTSALSPSVVTTADFENSSLSGPTTVRPSLSDLTTGWWSTEDGEDSSRSAPTSVPAS
                     LDICTQQLSIVFYEAELLLDPEDVVGDEDPSQTEVVFEDEDDEEDDDDKETQKEGKES
                     LLFPFYLQAQCNRSDAINISTCEYSKRSPQGGSSVPGWPDIDRVDFVPRNLTKCDHGL
                     AVIVAGNRTFYANSALTANLVAGIYNVLGLGDLTSSFLLHLRQFTYPARPRT"
     gene            complement(168037..169353)
                     /gene="UL117"
                     /locus_tag="CCMVgp099"
                     /note="beta gene"
                     /db_xref="GeneID:935514"
     CDS             complement(168037..169353)
                     /gene="UL117"
                     /locus_tag="CCMVgp099"
                     /codon_start=1
                     /product="protein UL117"
                     /protein_id="NP_612741.1"
                     /db_xref="GeneID:935514"
                     /translation="MYSNIKIVYGSPRISKSLAPANKRKTHRTIVVVPQKGLLRIPPD
                     DQDVTHVKIVPAPSPASRDRRASATAAGATATAAALPAPSSHHVYPYGTSLIRKSARD
                     VKLRSKLTVFNITQPALGYYHTLTMDHAEFLSGFRQEADHQAVLTADNIPAAVEIHLT
                     EDGLPPGTSGAVGMPSMTVAQQQQQMAHAQQPMSMPPLGQPPPYPQPASAAAALAASL
                     LASPSSASVSPPMIDLTSHQRPITLFTPAAAALPPALATNGGNATYILPADCRYAPLF
                     ASKYKHIFEEVARLMRVHDSTAVQIQISASCGNAFQALKSALLKLHNITVLAGQQLIT
                     QTMPHTPQAVATFKFFHQDPGRVLEGIRPVVPRSTSYHETGVYQMWVSGATKKDLFDA
                     VTLCASVVEKQPDVFNINVSLLTYPSIAAPHLPLYNEFTGFRLPTS"
     misc_feature    complement(168061..168534)
                     /gene="UL117"
                     /locus_tag="CCMVgp099"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            complement(169454..170691)
                     /gene="UL119"
                     /locus_tag="CCMVgp100"
                     /note="beta gene"
                     /db_xref="GeneID:935463"
     CDS             complement(join(169454..170064,170139..170691))
                     /gene="UL119"
                     /locus_tag="CCMVgp100"
                     /note="type 1 membrane protein; IgG Fc-binding; similar to
                     OX-2; involved in immune regulation; possibly related to
                     UL120 family"
                     /codon_start=1
                     /product="membrane glycoprotein UL119"
                     /protein_id="NP_612742.1"
                     /db_xref="GeneID:935463"
                     /translation="MSPLVTIFAIAALVGDMTGARGDKNTTASSTSVPVTTSVTTNST
                     VTTSVIPSTTAAATSSNNGSVNATSTPTGKPTSEATTAAISTSKATTVITTAKSTTPR
                     ATTSTGTTAPKSTTEYIFDKYSVSCESAYSYDYKLFNTTCKIKLENATGNANLMAITC
                     YQRPNCQGNFTEFGSLNAKEVKTSGGYQMDFNNTGQALSVVGPVPRTTVEYNCSFISL
                     WRTVHTSWNFFTYPIYAVYGTHLNATTMQIRVLLKNHTHCLLNGSLYDHNSTVHLHHG
                     GKTILPCSISNVTENGELLRQFLFHLNGSHSSVRLSVHISNKNFTTTYLFVHGDPLFE
                     DRLLAYGVLAFLVFMVVVLIYVTYMLARRRDWSYKKLEEVEEKKYPVPYFKQW"
     misc_feature    complement(<170341..170667)
                     /gene="UL119"
                     /locus_tag="CCMVgp100"
                     /note="BDLF3; Provisional; Region: PHA03255"
                     /db_xref="CDD:165513"
     gene            complement(170742..171344)
                     /gene="UL120"
                     /locus_tag="CCMVgp101"
                     /db_xref="GeneID:935459"
     CDS             complement(170742..171344)
                     /gene="UL120"
                     /locus_tag="CCMVgp101"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL120"
                     /protein_id="NP_612743.1"
                     /db_xref="GeneID:935459"
                     /translation="MQRVRVTVVLVSVAAALRYAVTAGGEAAVAQVHDRTGEPGVNIS
                     YLYKNDTNLTILCNTTALQSPFLASGIMVSTKRNTTIVAGKVNYTADNEKKDYHHYLN
                     VTLRAEYGTYLNAGVTCWGSNGTWGAKTFEVHSMANQTDNATEISFHRVTEQELIDNP
                     EYFRRSNKKLVMIVIVSQLVFVMLIINASFVWSWKFRRHR"
     gene            complement(171395..171931)
                     /gene="UL121"
                     /locus_tag="CCMVgp102"
                     /db_xref="GeneID:935513"
     CDS             complement(171395..171931)
                     /gene="UL121"
                     /locus_tag="CCMVgp102"
                     /note="type 1 membrane protein; UL120 family"
                     /codon_start=1
                     /product="membrane protein UL121"
                     /protein_id="NP_612744.1"
                     /db_xref="GeneID:935513"
                     /translation="MMVAWWYLVCTVLLWMTVGGSGAVYICSPNTGMVKISCYLPKLD
                     RRLWWSLRDGETRVPVFSPEDEEEGGEQKSGHEERGLHSVSVRHCKSCVRPHVVSLVT
                     PLLLNRTVSLLLVDREQNEEKLLCFTRLTTLEGIRTCRIDPDLGLLYAMCLILSLSIV
                     TAALWKLDCDRRARGYKS"
     misc_feature    complement(171398..171901)
                     /gene="UL121"
                     /locus_tag="CCMVgp102"
                     /note="Protein of unknown function (DUF2677); Region:
                     DUF2677; pfam10838"
                     /db_xref="CDD:256177"
     gene            complement(172158..175679)
                     /gene="UL122"
                     /locus_tag="CCMVgp103"
                     /note="beta gene; immediate early gene"
                     /db_xref="GeneID:935457"
     CDS             complement(join(172158..173695,175306..175490,
                     175606..175679))
                     /gene="UL122"
                     /locus_tag="CCMVgp103"
                     /note="interacts with basal transcriptional machinery and
                     cellular transcription factors; specific DNA-binding
                     protein; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE2"
                     /protein_id="NP_612745.1"
                     /db_xref="GeneID:935457"
                     /translation="MESSSGKRKMDSANPDEGPSSKIPRPETPVSKACAFLTSMIQKE
                     VNSQLNLGDPLFPDVSEDDLKSFEDVTKECDENPGKDILQELGIDILAQAVNQAGIDA
                     TTAGVTPTTNTCTTSSAPSTGGVCGAAPPSTPSPPVLLPERSVTPDLVSPRKKPRKTQ
                     RPFKVIIKPPVPPTPIMMPMIKREIKPDPDFTIQYRDTTIEPTSCIVISDSEEEEGEE
                     VPQKQSESQPRQVQSSAASSSSSSSGSSSSSSRGCSPQVSPATQKAARMNPLLHRQQV
                     QMEVHPPSSSQKDEDSSSSSSSSCSSASDSESESEETKSAPSCVSLTATGGVVRGAPG
                     GSQNAGPRKKKSKRISELDNERVRNIMKDRNTPFSTPSAQTKRGRVRTEDVDRMFRNT
                     TRSLEYKNLPFNIPSIHQVLEEAIKSCNSMQVNNKGIQLIYTRNHEVKSEVDAVRCRL
                     GSMYNLSLSTPFLMEHTVPVTHPPDVCHRTAEACASGVKAVWDMKETHTHQLCPRSSD
                     YRNMIIHGATPVDFLGALNMCLPLMQKFPKQVMLRIFSTNQSSFMLPIYESAAKAYAV
                     GQFEEPAETTEDLDTLSMAIEAAIEDLRNKSQ"
     misc_feature    complement(join(<175307..175490,175606..175679))
                     /gene="UL122"
                     /locus_tag="CCMVgp103"
                     /note="Cytomegalovirus IE1 protein; Region: Herpes_IE1;
                     pfam07340"
                     /db_xref="CDD:284701"
     misc_feature    complement(172269..172751)
                     /gene="UL122"
                     /locus_tag="CCMVgp103"
                     /note="Herpes virus intermediate/early protein 2/3;
                     Region: Herpes_IE2_3; pfam03361"
                     /db_xref="CDD:281370"
     gene            complement(173873..175679)
                     /gene="UL123"
                     /locus_tag="CCMVgp104"
                     /note="beta gene; immediate early gene"
                     /db_xref="GeneID:935486"
     CDS             complement(join(173873..175131,175306..175490,
                     175606..175679))
                     /gene="UL123"
                     /locus_tag="CCMVgp104"
                     /note="enhances activation by IE2; interacts with basal
                     transcriptional machinery and cellular transcription
                     factor; disrupts ND10; involved in gene regulation"
                     /codon_start=1
                     /product="regulatory protein IE1"
                     /protein_id="NP_612746.1"
                     /db_xref="GeneID:935486"
                     /translation="MESSSGKRKMDSANPDEGPSSKIPRPETPVSKACAFLTSMIQKE
                     VNSQLNLGDPLFPDVSEDDLKSFEDVTKECDENPGKDILQELVKQIKVRVDIVRQKVK
                     THMLTKYTQMDEKFTAAFNNMGGCLQTALDILDKVNEPFEDMKCIGVTMQNMYENYVV
                     TEESRDLWLQCLKDLHDVAKNAASKLGNALKAKAQAKKEELNRKMTYIALKHVEFFTK
                     NSAFPKTTNGTSAAIAALQSFHQCSPEEVKCHAQRIMKTLDEERDKVLLHIDNIFMDI
                     LTTCVETMGNEYKVTSDASMMTMYGAISLLTEFCRVLSCYILEESSVMIARQPQITKE
                     DLVSTMTRRIQEICMRVFAQYLLGCDPLRVCSPSVEDLRAIAEESDEDEAIAAHVRAT
                     AVSSPISPPDSPVPSESDIPLGTVTVAETSDEEADEGEESQAEVEEETQEEEGEADDS
                     VSVKSEPESEGEVHHAELVEVKDEDTDSGEEVEEEQQPASGKRTHPMVTRSKADQ"
     misc_feature    complement(join(174215..175131,175306..175490,
                     175606..175670))
                     /gene="UL123"
                     /locus_tag="CCMVgp104"
                     /note="Cytomegalovirus IE1 protein; Region: Herpes_IE1;
                     pfam07340"
                     /db_xref="CDD:284701"
     gene            175724..176185
                     /gene="UL124"
                     /locus_tag="CCMVgp105"
                     /note="beta gene"
                     /db_xref="GeneID:935501"
     CDS             175724..176185
                     /gene="UL124"
                     /locus_tag="CCMVgp105"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL124"
                     /protein_id="NP_612747.1"
                     /db_xref="GeneID:935501"
                     /translation="MKTVWLSLVYLCLPLLAAVTTERQLPSTAVNYHNTTGVTSSLTF
                     SSQLSGTSSSVSSSLALSLQTAESPWTHVGSPGSLLEAYPTASALGGMVIVVGIVICL
                     SLASTISSREVPSDDEEQEELLGTWPEEPEEDRLTTLPWPGVPEIAVEIPC"
     misc_feature    complement(177809..178393)
                     /note="similar to UL128; truncated by frameshift"
     gene            complement(178579..179307)
                     /gene="UL130"
                     /locus_tag="CCMVgp107"
                     /db_xref="GeneID:935526"
     CDS             complement(178579..179307)
                     /gene="UL130"
                     /locus_tag="CCMVgp107"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope glycoprotein UL130"
                     /protein_id="NP_612749.1"
                     /db_xref="GeneID:935526"
                     /translation="MHLRCCRRYCHRRRARDPLTLLLSCAFFLSFLPLTSAECDEDRS
                     PPKSTAASSWSQLTLQEASSPSSWSAFTAYLKTQQAASLYCPLTFPSPPRRLSEFTRY
                     HEVPGGPSCNNETLVLLYNRDGQTLIERPSPWVKKVTWYLSGRDHPVFQRFAKTASTA
                     NDGNVQIRTDDAKVFGSHMVPKQTKLLRFVINDGTRYEMCIMKLETWAHVFRDYSVAF
                     QTRLTFTQANNQTYSYCTHPNLLV"
     misc_feature    complement(178582..179058)
                     /gene="UL130"
                     /locus_tag="CCMVgp107"
                     /note="HCMV glycoprotein pUL130; Region: Gp_UL130;
                     pfam11668"
                     /db_xref="CDD:288512"
     gene            complement(179324..179811)
                     /gene="UL131A"
                     /locus_tag="CCMVgp108"
                     /db_xref="GeneID:935599"
     CDS             complement(join(179324..179477,179573..179811))
                     /gene="UL131A"
                     /locus_tag="CCMVgp108"
                     /note="contains signal peptide; complexed with envelope
                     glycoproteins H and L; essential in non-fibroblast cells;
                     involved in cell entry"
                     /codon_start=1
                     /product="envelope protein UL131A"
                     /protein_id="NP_612750.1"
                     /db_xref="GeneID:935599"
                     /translation="MWLYRVFLSVLCLSVAVWGQCRREEAERDDFARPWDYWDTCSPA
                     LPERTRQEYVKRLVDTLVEYHYDVSHGLDNFKTLKRINVTEVTLLAGEFRRQKARGGT
                     NKRTTFSASGFLGPHYRMLEFSVRLFPQ"
     gene            complement(179905..180717)
                     /gene="UL132"
                     /locus_tag="CCMVgp109"
                     /db_xref="GeneID:935598"
     CDS             complement(179905..180717)
                     /gene="UL132"
                     /locus_tag="CCMVgp109"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="envelope glycoprotein UL132"
                     /protein_id="NP_612751.1"
                     /db_xref="GeneID:935598"
                     /translation="MRRHPTGSLGNGTNTTLTVCLAFFTLYLTLNHGTTSIAAASTTS
                     STPAPSTTNTSSTVTTATSRNHNDSITTAYDNSTQKKVEWIMTIVVYCVIGSSILSFL
                     VVAFCVLYVSCRKPGRLYGFTDDEVALLLDLDDDDGSQTLLGKNGGGSRRGRIPAASS
                     SHFYQPLDNDFDEDATTAARESMNKDPQNVIYFKKDGTLDTSFVNPNYGKGSPMTIES
                     HSDDDDHIRYYMTVYDELTASEMEEPTHANWQIPKLIKATTTPVTLKEPEYD"
     misc_feature    complement(179911..180522)
                     /gene="UL132"
                     /locus_tag="CCMVgp109"
                     /note="Glycoprotein UL132; Region: gpUL132; pfam11359"
                     /db_xref="CDD:288251"
     gene            complement(180845..181846)
                     /gene="UL148"
                     /locus_tag="CCMVgp110"
                     /db_xref="GeneID:935494"
     CDS             complement(180845..181846)
                     /gene="UL148"
                     /locus_tag="CCMVgp110"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein UL148"
                     /protein_id="NP_612752.1"
                     /db_xref="GeneID:935494"
                     /translation="MPRFWLMCFLLTSLSEHVFRAHGSQLLNYVQVRLLSGRGGPLVF
                     AHTFSSVPWSFTELGWAVCADWDSMKCTPFWTSNLTSSWSPPSDTVWRYRLSDPGATI
                     TLQLQNQTAPWPAGGLSFSSRLQLDAVIENAGLYVAYVVNDGDRPSQFLEPRVDFVRF
                     ALYLETETQILENLDSGRLVAQFDTPDLAFGPDLVSSFVISGNGERDYHLNWTVRRSE
                     TYRYDNIQLQVEIQEPRGLRHRATIERPQYKVGSHLSLDFSVYRHNARLTRGYVQYTF
                     PKEAFERAKRLREDPKAAGWLATIDRFVVQYLNALLITVMGILWVRVLVTWWMSSPR"
     gene            complement(181908..182147)
                     /gene="UL147A"
                     /locus_tag="CCMVgp111"
                     /db_xref="GeneID:935505"
     CDS             complement(181908..182147)
                     /gene="UL147A"
                     /locus_tag="CCMVgp111"
                     /note="type 1 membrane protein; contains hydrophobic
                     domain"
                     /codon_start=1
                     /product="membrane protein UL147A"
                     /protein_id="NP_612753.1"
                     /db_xref="GeneID:935505"
                     /translation="MSLFYRIVALGALGALTWYTTNVIGELAEGSCVANQPLEEGDDE
                     GYGDDPALTHEDRDYRALWAFSLVICGTLLVTCVL"
     gene            complement(182181..182639)
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /db_xref="GeneID:935481"
     CDS             complement(182181..182639)
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; possibly involved in immune regulation; CXCL
                     family"
                     /codon_start=1
                     /product="chemokine vCXCL2"
                     /protein_id="NP_612754.1"
                     /db_xref="GeneID:935481"
                     /translation="MVFQNLSRQLYTRVRFPLCTIFIFLCCICPTHSLEFEDDRQCLC
                     ANHILLNTIPAGTQYLKPITASETCARRQVLAVLKDKSTKCLNPHAPAVRHEFNRLFF
                     RVVFDAEQEVYTVIDTGIQFLGWPVPHAYKTYLWKRVITLNRIKYGLRMF"
     misc_feature    complement(182334..182525)
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="Chemokine_CXC: 1 of 4 subgroup designations based
                     on the arrangement of the two N-terminal cysteine
                     residues; includes a number of secreted growth factors and
                     interferons involved in mitogenic, chemotactic, and
                     inflammatory activity; many members...; Region:
                     Chemokine_CXC; cd00273"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182355..182357,182370..182372,
                     182388..182396,182403..182408,182436..182444,
                     182469..182486,182499..182501,182517..182525))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="receptor binding site; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(182517..182525)
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="ELR motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182337..182342,182349..182351,
                     182361..182363,182382..182384,182391..182396,
                     182406..182408,182412..182423,182451..182459,
                     182466..182471,182511..182513,182520..182522))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182391..182396,182406..182408,
                     182415..182417,182421..182423,182451..182453,
                     182457..182459,182511..182513,182520..182522))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182508..182510,182514..182519))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="RCXC motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182469..182486,182493..182513))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="N-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182388..182390,182394..182396,
                     182406..182408,182415..182417,182472..182474,
                     182484..182486,182496..182498,182502..182507))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="receptor binding cleft; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182334..182336,182343..182345,
                     182349..182360,182364..182366,182373..182375,
                     182475..182477,182481..182483))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="glycosaminoglycan (GAG) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182391..182396,182403..182405,
                     182409..182411,182466..182468,182475..182477))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(order(182337..182342,182349..182351,
                     182361..182363,182382..182384,182412..182414,
                     182418..182420,182454..182456,182466..182471))
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="dimer interface (I form) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(182436..182444)
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(182436..182444)
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="GPH motif; other site"
                     /db_xref="CDD:238171"
     misc_feature    complement(182397..182405)
                     /gene="UL147"
                     /locus_tag="CCMVgp112"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238171"
     gene            complement(182670..183023)
                     /gene="UL146A"
                     /locus_tag="CCMVgp113"
                     /db_xref="GeneID:935544"
     CDS             complement(182670..183023)
                     /gene="UL146A"
                     /locus_tag="CCMVgp113"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; possibly involved in immune regulation; CXCL
                     family"
                     /codon_start=1
                     /product="chemokine vCXCL3"
                     /protein_id="NP_612755.1"
                     /db_xref="GeneID:935544"
                     /translation="MKFLLSIIIVHITISTCDAVTREQHCQCLDRRWPYPIPNSWIYV
                     YPPGVECGRTEAIAYLSERSRPVCIEYPNKFYKRFRLSTWHHFTYRNGNRVCIFHKHS
                     PDWRPYKKEHIVAIL"
     gene            complement(183146..183544)
                     /gene="UL146"
                     /locus_tag="CCMVgp114"
                     /db_xref="GeneID:935482"
     CDS             complement(183146..183544)
                     /gene="UL146"
                     /locus_tag="CCMVgp114"
                     /note="contains signal peptide; putative secreted
                     glycoprotein; involved in immune regulation; CXCL family"
                     /codon_start=1
                     /product="chemokine vCXCL1"
                     /protein_id="NP_612756.1"
                     /db_xref="GeneID:935482"
                     /translation="MRATWGFMIGLLATWICVNIATEMRCYCSGKNMSPEHWFPRKRH
                     QWVECISSSYRCPNMELIVHLPPNYNQKVCLGRHHEISKQFLTECEQGYRWFSVIVNA
                     TQKTPLILSKHTDKPTNFNQPNGYQLPVRT"
     gene            complement(183872..184342)
                     /gene="UL145"
                     /locus_tag="CCMVgp115"
                     /db_xref="GeneID:935543"
     CDS             complement(183872..184342)
                     /gene="UL145"
                     /locus_tag="CCMVgp115"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein UL145"
                     /protein_id="NP_612757.1"
                     /db_xref="GeneID:935543"
                     /translation="MHDQHAVSAAHYYSFISGPSAMVHYRHQNAVQLLCARARDGTSG
                     WERLTHHAAYQADYGAYAVLMATSQTKSLVLHRYSAVTAVALQLMPSNVLARLDQSDW
                     VKGAWIVSETFPTCDPDGFRDRRSSSSGDEGENDEGDKRHEGREGESAVGGGDA"
     gene            complement(184524..185084)
                     /gene="UL144"
                     /locus_tag="CCMVgp116"
                     /db_xref="GeneID:935495"
     CDS             complement(184524..185084)
                     /gene="UL144"
                     /locus_tag="CCMVgp116"
                     /note="type 1 membrane protein; similar to TNFR; interacts
                     with BTLA and inhibits T cell proliferation; does not bind
                     TNF superfamily ligands; activates NFkappaB via
                     TRAF6-dependent mechanism to upregulate CCL22; involved in
                     immune regulation"
                     /codon_start=1
                     /product="membrane glycoprotein UL144"
                     /protein_id="NP_612758.1"
                     /db_xref="GeneID:935495"
                     /translation="MRPLWTLLCLGSAVAAARVAGIRCKEDEVRMGGECCPKCSDGYQ
                     MKKPCTPLTGTVCESCPNGTFSVSGKNCTNCTKCTGHKPVTAQVCTRTHDTVCAPHYT
                     VTPREDKEEKGETGRQHHHRHRNESVVYVGKEEGNKSNRTTLAWLSVLIFLVGIVLLI
                     LYLVTAYRSDRCQNYCPLSALIYRSL"
     misc_feature    complement(184683..185015)
                     /gene="UL144"
                     /locus_tag="CCMVgp116"
                     /note="Tumor necrosis factor receptor superfamily
                     (TNFRSF); Region: TNFRSF; cl22855"
                     /db_xref="CDD:304602"
     misc_feature    complement(184740..184907)
                     /gene="UL144"
                     /locus_tag="CCMVgp116"
                     /note="CRD2 [structural motif]; Region: CRD2"
                     /db_xref="CDD:276900"
     misc_feature    complement(<184599..>184700)
                     /gene="UL144"
                     /locus_tag="CCMVgp116"
                     /note="Anion permease ArsB/NhaD. These permeases have been
                     shown to translocate sodium, arsenate, antimonite, sulfate
                     and organic anions across biological membranes in all
                     three kingdoms of life. A typical anion permease contains
                     8-13 transmembrane helices...; Region: ArsB_NhaD_permease;
                     cl21473"
                     /db_xref="CDD:304373"
     gene            complement(185253..186326)
                     /gene="UL142"
                     /locus_tag="CCMVgp117"
                     /db_xref="GeneID:935484"
     CDS             complement(185253..186326)
                     /gene="UL142"
                     /locus_tag="CCMVgp117"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; downregulates MICA; acts on activating
                     receptor NKG2D; involved in immune regulation; MHC family"
                     /codon_start=1
                     /product="membrane glycoprotein UL142"
                     /protein_id="NP_612759.2"
                     /db_xref="GeneID:935484"
                     /translation="MLILCLVGYFIPFTKEYSLTYTYYLKYDVHGYSYIGYVYGFLND
                     SLFVRYNGSYTSNLRQEAPHVITEGTQTWFETFVANRTYKDGEERKVSSFLRRDSINT
                     KILYKYFNLSEPEQWNPYPRLTLQKYHACSIMNNGTHSDYYAIGVNGTDFLSMNSSTW
                     WKTLNESASIAERKFDASTVDTTDIQNYLRTDCPWWLRHYSGKAQHTVLLPDDVIFRR
                     INTSHTICRVSVFRPCEVSITGSNGTHHMNAASFFIGPNMNYTCSAWGTFAFPKQTAA
                     QNYTCRVFHEGSNKMTEHRLEEKIIEGEDASSDMQVNEEAAVASIIYTVPVITTVAVA
                     GGLYYGRRYLPTSHGYRSGEELS"
     misc_feature    complement(185727..186209)
                     /gene="UL142"
                     /locus_tag="CCMVgp117"
                     /note="Class I Histocompatibility antigen, domains alpha 1
                     and 2; Region: MHC_I; cl08246"
                     /db_xref="CDD:298647"
     gene            complement(186507..187622)
                     /gene="UL141"
                     /locus_tag="CCMVgp118"
                     /db_xref="GeneID:935461"
     CDS             complement(186507..187622)
                     /gene="UL141"
                     /locus_tag="CCMVgp118"
                     /note="type 1 membrane protein; inhibits NK cell
                     cytotoxicity; sequesters CD155; acts on activating
                     receptor DNAM-1, CD96; involved in immune regulation; UL14
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein UL141"
                     /protein_id="NP_612760.1"
                     /db_xref="GeneID:935461"
                     /translation="MARRQVGKVRRLLPLLTVVGMLLLEPEKSSRAGALLSDAAAPTG
                     LPKETRAENYEIVSPAPMLVAEGERVTVPCTVMIHQWPLAVIRATFCLSPPTERSVEL
                     VFNLSRGGEVVVPLEEKLTESRLRGGVSYNFTDLHVAHLFSLTFRATASSAGVYECLL
                     RNDSHALVLQRFVVLTHLETLSWADEPCCTPPLGRHSQDRQIWSPTPWRLKHVDCGWS
                     SQMGFRRNRFYIEPASIGDGTEINIDAGEGEDEECWGPLCQPEEQPDRCWPVVRQYRL
                     PGGCYRSGDKQAKFVPALPPTEPPLATPPEIPTGLSPWATRGVASFLGFWGFFSVGFV
                     CYLIYLHCCRRCLGRRGDGYRRLPQYDEYPGHRRMKT"
     misc_feature    complement(186510..187622)
                     /gene="UL141"
                     /locus_tag="CCMVgp118"
                     /note="UL14 tegument protein; Provisional; Region:
                     PHA03189"
                     /db_xref="CDD:223008"
     gene            complement(187983..188633)
                     /gene="UL140"
                     /locus_tag="CCMVgp119"
                     /db_xref="GeneID:935449"
     CDS             complement(187983..188633)
                     /gene="UL140"
                     /locus_tag="CCMVgp119"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL140"
                     /protein_id="NP_612761.1"
                     /db_xref="GeneID:935449"
                     /translation="MTTASSTSSTTLSTATTASQSSSSNALTALVVFGFIASMLLLFF
                     ILYVWNNDAFRRFIIKCGWLNRCCDRFDEWQDRVILRRPSRHASESGSSGTGSVGGAS
                     RSTSVSSVGSHRHARGSGDERLYRGIDNPLHRLMSDACEETAVEIDSIDDWSSVFQPC
                     SPSYAERDQDSRELLIDLPPPPVPPEVVTAMQQAVRKAVRNALRNSHDFVQPYQTL"
     gene            complement(188805..190043)
                     /gene="UL139"
                     /locus_tag="CCMVgp120"
                     /db_xref="GeneID:935504"
     CDS             complement(188805..190043)
                     /gene="UL139"
                     /locus_tag="CCMVgp120"
                     /note="type 1 membrane protein; N-terminal portion similar
                     to OW primate CMV O20"
                     /codon_start=1
                     /product="membrane glycoprotein UL139"
                     /protein_id="NP_612762.1"
                     /db_xref="GeneID:935504"
                     /translation="MTELRLASSLLLAWEILDMSLANSYTQGPKIHANVTKCIWKVKN
                     ETLVIGKYIDIKCEFTEVTDNITMGLMYTSCSNRSLSETTMSYYNHTPQDRANYPFGK
                     VEHSRSDTTATMTLRRCGLNCTGIHDCFKFDGQKMNITLRTSIAPIGTIYVNTKANQS
                     HDVFCAVNDTFPATVLLHNTGNDHQLNITTNHTVKKCNRTLYYGYTVQGISPPTQCSL
                     FSSTCIGLRSHTLTYPGTPLTPPAGISNCENYTAPNMTVTVTLVALSSAVSAALASET
                     TTGTSSNSSQSTSSTATTGTGCSNANDTNNNGLNQQQIIAGLLGGCGFLSLFFIFTCI
                     LCVWYCFRKLFPDCCGGDPDEQQRQMTRGRYTYDNPVFPPPTLPMGATGPAYPPPVSD
                     GTAGPPAIPLTQDKVTYPRS"
     misc_feature    complement(188844..189152)
                     /gene="UL139"
                     /locus_tag="CCMVgp120"
                     /note="Human Cytomegalovirus UL139 protein; Region:
                     HCMV_UL139; pfam12507"
                     /db_xref="CDD:193058"
     gene            complement(190381..190929)
                     /gene="UL138"
                     /locus_tag="CCMVgp121"
                     /db_xref="GeneID:935537"
     CDS             complement(190381..190929)
                     /gene="UL138"
                     /locus_tag="CCMVgp121"
                     /note="contains potential transmembrane domain; possibly
                     involved in latency"
                     /codon_start=1
                     /product="protein UL138"
                     /protein_id="NP_612763.1"
                     /db_xref="GeneID:935537"
                     /translation="MGDIPTSVWLPVVCLLVLLISGLLVYILYHWRDTLTLLRLVWSY
                     RWLVNCCQMYGEYERRFTDMPLGFGPVRRESDAKYRFPGRNDEIYVNWEPLNCGYYSP
                     STRSADSRFSSWAVSTSEETEMLPGACHSVSAAVEMVPMGRGVRGSIAGGDVDMFYDG
                     DLLQPVMGSTTQFITVATVHQT"
     gene            complement(191122..191772)
                     /gene="UL136"
                     /locus_tag="CCMVgp122"
                     /db_xref="GeneID:935500"
     CDS             complement(191122..191772)
                     /gene="UL136"
                     /locus_tag="CCMVgp122"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL136"
                     /protein_id="NP_612764.1"
                     /db_xref="GeneID:935500"
                     /translation="MTWALDVGKHKCQRVERPGRIRRLWECRLRVWWPGEEADEKRKG
                     EGERQEEDKGHYPMSLVLHAVCALLLTLMVLAVGALIAYLRYYHENDWRDMLHNLFCG
                     CRFPDECRGRRHRRWGRGGHGDEDEGDEEQDLERGRASAALSPSACQMDTIELVDETQ
                     PAAATTVAAGTELSVGQQTLPPEWLGAVQCAVQTAVQVAVQVSAHHPSSPLPSPAT"
     gene            complement(192004..193167)
                     /gene="UL135"
                     /locus_tag="CCMVgp123"
                     /db_xref="GeneID:935605"
     CDS             complement(192004..193167)
                     /gene="UL135"
                     /locus_tag="CCMVgp123"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL135"
                     /protein_id="NP_612765.1"
                     /db_xref="GeneID:935605"
                     /translation="MLEGSLFLVGFAVLMALTAFALLIVNRRRARKHKSRRRFSSTDA
                     PPGFCGCCQRSDKGKPVPVEIELMDGPRTPQKKKKPPLSRDERDDLCTSVYIGEPKTP
                     KPEFPPSRYEIPDVVVTVPSTPSSLRSAGEGREGEDGREDDDTSSTSSDSSSTSVDTV
                     ISRPPSWKPAPPPCPSPSSPSSLGEALEQHRQLLKSRPPTPPVRAPSTHLTVPTVPPT
                     PLPRTVPTNGVETPLVKVTANGHPPAAPGRKKQGPPTKPKPVWPRPALTPQTYVDPRT
                     PTEPTRPGEVETPATLQHKPTPHKPPRTPRLPRTPAVQNLTTMNGCSTLTRGRKASLS
                     SSSCSSTLPRAPGTMCQPVSVKDVAPPPSWTDIDNILDEALRNVLRDAESMQT"
     misc_feature    complement(192232..>192582)
                     /gene="UL135"
                     /locus_tag="CCMVgp123"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            complement(193346..194134)
                     /gene="UL133"
                     /locus_tag="CCMVgp124"
                     /db_xref="GeneID:935539"
     CDS             complement(193346..194134)
                     /gene="UL133"
                     /locus_tag="CCMVgp124"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL133"
                     /protein_id="NP_612766.1"
                     /db_xref="GeneID:935539"
                     /translation="MGRCETICTPACECIWGNIITFSVLTVAGSLAIWSIAASNGTTP
                     GIVSLVLTGLLFIYLIIYVIRFPQLAREVYVDFFTCKWVFWCSSKCTSGSLYDVVRFQ
                     RGQHTDQEGENRDRVICEVVAKPPEDPGEGPSDPSSQPLCEVKVEIPNPNTKPETKPE
                     KPEKPKKPKAGGRSKSKSTEKPASKSTSEKEKTSGDMGTKATTPTVPTTPAPTPTPVP
                     APAPQPTVSGVPQALPPDLAAIVQAAVTAALAAAAQQQQQTPPP"
     gene            complement(194264..194560)
                     /gene="UL148A"
                     /locus_tag="CCMVgp125"
                     /db_xref="GeneID:935597"
     CDS             complement(194264..194560)
                     /gene="UL148A"
                     /locus_tag="CCMVgp125"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148A"
                     /protein_id="NP_612767.1"
                     /db_xref="GeneID:935597"
                     /translation="MSDDYSDIMEHWIPISIVVVLTSLIITIVVNAYLWYFRRDLAAF
                     CRESVCGCCLRGETEPLTRAMEPPAEVEMRTLSSSVEELTTLDVGTLGVLELQV"
     gene            complement(194654..194899)
                     /gene="UL148B"
                     /locus_tag="CCMVgp126"
                     /db_xref="GeneID:935596"
     CDS             complement(194654..194899)
                     /gene="UL148B"
                     /locus_tag="CCMVgp126"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148B"
                     /protein_id="NP_612768.1"
                     /db_xref="GeneID:935596"
                     /translation="MMETLTILAICVGVVMGCTVLVSCALISFYYYDEITDGQRPKLF
                     RRGARRGRQFDRSESMTAILCEEGASSDEGECYTTRL"
     gene            194996..195235
                     /gene="UL148C"
                     /locus_tag="CCMVgp127"
                     /db_xref="GeneID:935595"
     CDS             194996..195235
                     /gene="UL148C"
                     /locus_tag="CCMVgp127"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148C"
                     /protein_id="NP_612769.1"
                     /db_xref="GeneID:935595"
                     /translation="MWPFTVLLAVTYLLGLTFWLELFCLFSTALFDREIAWAIFVRML
                     VLGVVLDAGASVSHTFIRCLAYERAFAVPVAFASP"
     gene            195595..195783
                     /gene="UL148D"
                     /locus_tag="CCMVgp128"
                     /db_xref="GeneID:935464"
     CDS             195595..195783
                     /gene="UL148D"
                     /locus_tag="CCMVgp128"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein UL148D"
                     /protein_id="NP_612770.1"
                     /db_xref="GeneID:935464"
                     /translation="MTAPTAGTGYLVKTQERKEWWPDNSLKRWWIGILVIIIIGVSLV
                     AFMMFMQKHGASGSTSSG"
     gene            complement(195790..197967)
                     /gene="UL150"
                     /locus_tag="CCMVgp129"
                     /db_xref="GeneID:935493"
     CDS             complement(195790..197967)
                     /gene="UL150"
                     /locus_tag="CCMVgp129"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein UL150"
                     /protein_id="NP_612771.1"
                     /db_xref="GeneID:935493"
                     /translation="MARRPPELAGMLWWWWALTAFFPTSNEISPLWQETGTCRNTFAA
                     YYYCHALPGSGEGRVAAPAPELRSSPPLSSADSSTTVPRNEHCSAPSGPPRVNIRQSM
                     RWRRLAMASSLSASWPDTQSRAASQSLSKTMYATKEPMTSPRAWPTRSEKETAEPRDA
                     ATEAAADWGDGGKTEGARKETGKEEVPRWDRHRLQPCQAQRGTSSRATSQMASLKAVH
                     QRFLGLSRSSCSTTLQPVVVSPPFSLTRGGALTTASLATPAGGETIKTEVMGRRGGEE
                     GEDDVVTNDDPPSAPASPAVPLLEVDVQRRWVKPSSASPATSMTATVPFTAPAVAPAG
                     AADGAGAAATTVAAGEVGRRCSSSDAVVEQQLAPSVLRESAEKVRFNVFRLRTPLLAS
                     RSGVGEVMLWVGFLPRELGGLLWPLRDERHEPEEAERAECQRRFARQPADPGDSDCLC
                     RCPPIVTAARRCEYNATHYLHALEIELQPPSSGGAGESEHGGRNETHRGYPEPQKPRQ
                     APSQPENETSRVGDSQKTTHERRQEPHENGSASSGRNGPADLYRAPHFVLLDAETDRG
                     RRPVLALGRQTLSGWPEGDTPQLLGLVTGKDNRCQSLWPTQDGYVRVPASSVSPKKAD
                     AGDGQSRERGDSADARGGEGGKRSRAKGKEERGREPRRSCQATRVLREVAHTLETVEA
                     FYDTLRALLRTYWDRTRKWWCDSLASELQQRDQLAGRLRNLEL"
     gene            196769..197824
                     /gene="UL150A"
                     /locus_tag="CCMVgr004"
                     /db_xref="GeneID:11468240"
     CDS             join(196769..197087,197196..197824)
                     /gene="UL150A"
                     /locus_tag="CCMVgr004"
                     /codon_start=1
                     /product="protein UL150A"
                     /protein_id="YP_004940336.1"
                     /db_xref="GeneID:11468240"
                     /translation="MTSPTPDLLANSGVRRRNTLKRTFSALSRSTDGASCCSTTASEE
                     EQRRPTSPAATVVAAAPAPSAAPAGATAGAVNGTVAVIDVAGDAEDGLTQRLCTSTSS
                     NGTAGVASEAVVSAPPLVSEKGGETTTGCKVVEQEERESPKNLWCTAFREAIWDVALL
                     EVPRWAWQGWRRWRSQRGTSSFPVSFLAPSVLPPSPQSAAASVAASLGSAVSFSDLVG
                     QALGEVIGSFVAYIVLERLWLAARDWVSGHDAESEEAMARRRQRMLWRMFTRGGPDGA
                     EQCSFRGTVVEESADESGGELLSSGAGAATRPSPLPGNA"
     gene            complement(198164..198643)
                     /gene="UL155"
                     /locus_tag="CCMVgp130"
                     /db_xref="GeneID:935465"
     CDS             complement(198164..198643)
                     /gene="UL155"
                     /locus_tag="CCMVgp130"
                     /note="RL1 family"
                     /codon_start=1
                     /product="protein UL155"
                     /protein_id="NP_612772.1"
                     /db_xref="GeneID:935465"
                     /translation="MAATVTTTEATVSVTVGVSRELSTSPNPDSRPVTGLAAHPPPPG
                     NSSHPDDCWCRWDGYRCGVSQLLIARQRDGTGRWEHVSSRGVGVRLLHGWDEDEEDEE
                     GGGSSLGGGSTVRRPPQRIRPSQPWRRYLVLTLGSGHGPRTQLWRMLPRELPASDTD"
     gene            complement(198963..199436)
                     /gene="UL156"
                     /locus_tag="CCMVgp131"
                     /db_xref="GeneID:935466"
     CDS             complement(198963..199436)
                     /gene="UL156"
                     /locus_tag="CCMVgp131"
                     /codon_start=1
                     /product="protein UL156"
                     /protein_id="NP_612773.1"
                     /db_xref="GeneID:935466"
                     /translation="MGIGLAIIFTGNVRFPNRTAIKTLMEMETLVYSCLCVHPTYATS
                     PFNTPFSRNIPKPYNTPLLFRTRCNIHRLRQGDTVCSSTPSHYFSTLSSYLHTQSPTS
                     TNVFVTHVTKYTKKPLQTVHGCVNSTTKTVVPHPLFFYTTRRRTLSPQKSHTCYK"
     gene            complement(199415..200101)
                     /gene="UL157"
                     /locus_tag="CCMVgp132"
                     /db_xref="GeneID:935467"
     CDS             complement(199415..200101)
                     /gene="UL157"
                     /locus_tag="CCMVgp132"
                     /note="contains potential transmembrane domain; possibly
                     involved in immune regulation; CXCL family"
                     /codon_start=1
                     /product="chemokine vCXCL4"
                     /protein_id="NP_612774.1"
                     /db_xref="GeneID:935467"
                     /translation="MNALQGGERTGPGGTRRRGAILSQSQHHYNTPPHIKALTNTLRT
                     PPQHLQRHTTDLHATTTTTTTSTNATPRLLAYATLLLLCLLQLRLKTSFATRTATTSE
                     CLCPHKNSTRRTQPSNTWLCIIPPHTTCNVKEALLYNDTGIGICLNASTKLAKIHRRA
                     CFKLKHRNDNTILLGPREDIPYYWQPGPRFHPKALIQRTILDWFRQIPEEYGHYIYHG
                     LDGVWELGWP"
     repeat_region   200039..200725
                     /rpt_family="IRL"
                     /rpt_type=inverted
     repeat_region   200429..202881
                     /rpt_family="IRS"
                     /rpt_type=inverted
     repeat_region   200429..200725
                     /note="'a' sequence"
                     /rpt_type=inverted
     gene            201112..203922
                     /gene="IRS1"
                     /locus_tag="CCMVgp133"
                     /note="immediate early gene"
                     /db_xref="GeneID:935559"
     CDS             201112..203922
                     /gene="IRS1"
                     /locus_tag="CCMVgp133"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein IRS1"
                     /protein_id="NP_612775.1"
                     /db_xref="GeneID:935559"
                     /translation="MSQRFPRPPGRPHAHPNVHNPTTCKPHAGGQAGAIGGGPPGAPP
                     SLNFWNSPERFLLAQIPVERRTLTELEYQAMGTIWRTAFMANTTSRAMRKWAQREAGG
                     LLPLGRPYGFYARITPRSQMAGVGATDLRQLSPRDPWIVLVATIVHEAATGHEPLPSP
                     GATAPPTGLDGLCQQDQLYLALGVNFRVFIYDLQRNTLTLAARDADEWFRYGAGDVAR
                     LYRSNRLGLNAPRATAVPEPALLRTLTKSDDVNELGRELRRRWQHTGIPLQTPGRLRQ
                     PWVILGSWQELENYEPFASAPHPPSLLTAVQRHIHQRLCCGWLFLGVVLPSRWLTIYC
                     RHDTEAGTPQENPSVSADTGNDASSSARLSSSEHGAATRSGGPANAATTSPQHGGRQT
                     GTGPGASNTAAGAGTGTGLSSGMAPSQTAGRGNGPAGHPAGAPLITHTANTQGHGVAP
                     HNSSAATCAVSPPLSSSAGPTSAAGTAAGATSSGQRPTAADLLQQQQLQQLQQPPVRG
                     TDGRPYAQALLVLDELGAVFGYCPQDGHLYPLADELSHLLRAGLLGLLTLGRVSAPPA
                     EAALRLLPDLDREHWERPRWDALHLHPKASPWTQDPEKVFNFLTRQGRGDPVWNRWDF
                     LMRDSEAVEIFIDELVVQRQAQLPEKYIGFYQIRKLPQELKRPKKNKHAHPLPMYDEL
                     TEPLSPQASLCNALRTDDESWCPQSTVHDELAWMDLDESRWEPGTSRTDDIKQRRLAK
                     GTLRAGAEIDRPMPVVPAECHHQMFTAGGHQVIPLCGSEPEDDDEEHIYEEIPPRPPL
                     PTPRTSLMSAGPKTPGGRPRPHTPPQKPPRSPQVPATPPRPSHKARAPPPPRTPQSPT
                     SPGGYVRPPRPPPPRGDVQTEAQLCHKMGAMNLDHQYPQTPLRSPPPRPPNRGPPAPP
                     PRNKKKQQQHPSHTHVPRHVRQ"
     misc_feature    201364..201771
                     /gene="IRS1"
                     /locus_tag="CCMVgp133"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    <202648..202749
                     /gene="IRS1"
                     /locus_tag="CCMVgp133"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    202882..238634
                     /note="US"
     gene            complement(203984..204541)
                     /gene="US1"
                     /locus_tag="CCMVgp134"
                     /db_xref="GeneID:935549"
     CDS             complement(203984..204541)
                     /gene="US1"
                     /locus_tag="CCMVgp134"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US1"
                     /protein_id="NP_612776.1"
                     /db_xref="GeneID:935549"
                     /translation="MASDCGHPPVVGMPVMSSAVSSLPMRELAWRRVADDSHDLWCAC
                     MDWKAHVEYVGVSAELRPGSGAWPEQVEAQWRHQVHVAHDVWCDCGDWQGHALRSRSR
                     TADSGMSSSSMSSYASAVSCPDLSEGVRQPWWKRLRVRRLKLPSWARRWSSQRSGCSA
                     ATSATRASRRSQDRQESSSAADSYS"
     gene            complement(204883..205494)
                     /gene="US2"
                     /locus_tag="CCMVgp135"
                     /db_xref="GeneID:935458"
     CDS             complement(204883..205494)
                     /gene="US2"
                     /locus_tag="CCMVgp135"
                     /note="type 1 membrane protein; causes selective
                     degradation of MHC-I and MHC-II; involved in immune
                     regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US2"
                     /protein_id="NP_612777.1"
                     /db_xref="GeneID:935458"
                     /translation="MNGMWMSLVKLWASMGPLIRLPALDGPPDPHTEITSYKPWKSTA
                     TRPWFTIDENRCHIENGQMFGRGSVSGNLTTFVFDPKADYGGVGENLAVRAEDVEFIA
                     GENLIWRVQYANVLPLIQRLVVRLVLNGDVVWLTCVPEIRVDYTSNAYMWNMQYGMVH
                     RSYRHVALAVLFYALSVTALVIFIVYVTVNLEMSLKWMRFFMC"
     misc_feature    complement(204892..205443)
                     /gene="US2"
                     /locus_tag="CCMVgp135"
                     /note="Cytomegalovirus US3 protein; Region: Cytomega_US3;
                     pfam05963"
                     /db_xref="CDD:283588"
     gene            complement(205863..206426)
                     /gene="US3"
                     /locus_tag="CCMVgp136"
                     /note="immediate early gene"
                     /db_xref="GeneID:935476"
     CDS             complement(205863..206426)
                     /gene="US3"
                     /locus_tag="CCMVgp136"
                     /note="type 1 membrane protein; inhibits processing and
                     transport of MHC-I and MHC-II; involved in immune
                     regulation; US2 family"
                     /codon_start=1
                     /product="membrane glycoprotein US3"
                     /protein_id="NP_612778.1"
                     /db_xref="GeneID:935476"
                     /translation="MKLVIVLAALAALLLGFSEAFPRPVLSIAQQLTGLPTHFLVEEN
                     ECRLHMGKVYFRGKISGNFTKRHFVQFGIQSRSYRDNLEVTESQWSQKAETYFEWNVE
                     GIAVPFDVDTVDVLLSSGWGEPKKWASCDPQVQMDYSSWTVGWYFQRAMRDDNWGLFM
                     RTVCVYVLSMFMLAYLTVGMSLHMRFF"
     misc_feature    complement(205872..206315)
                     /gene="US3"
                     /locus_tag="CCMVgp136"
                     /note="Cytomegalovirus US3 protein; Region: Cytomega_US3;
                     pfam05963"
                     /db_xref="CDD:283588"
     gene            complement(207055..207633)
                     /gene="US6"
                     /locus_tag="CCMVgp137"
                     /db_xref="GeneID:935456"
     CDS             complement(207055..207633)
                     /gene="US6"
                     /locus_tag="CCMVgp137"
                     /note="type 1 membrane protein; inhibits TAP-mediated
                     peptide transport; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US6"
                     /protein_id="NP_612779.1"
                     /db_xref="GeneID:935456"
                     /translation="MRYLGLLKLLGLALFSVSAGRADPRDAPPEDLLSLFHRRQTCVP
                     KKRIGVSECRNGTEDCDRTGGEEPEDDAAERLTSRWIQTALESYGNKAREGEEEEYRH
                     PEGLINCRQVSRLLPCNASGLRPSHRLLLLMSNCVCEGPAWGVIRFVERHGLIAVSIY
                     LFCMVNAVIFTMVLLCGVRGEQLERSSRRCGS"
     gene            complement(208185..208883)
                     /gene="US7"
                     /locus_tag="CCMVgp138"
                     /db_xref="GeneID:935445"
     CDS             complement(208185..208883)
                     /gene="US7"
                     /locus_tag="CCMVgp138"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US7"
                     /protein_id="NP_612780.1"
                     /db_xref="GeneID:935445"
                     /translation="MWTQLHVFLLCLTAVTGYGRRKLSRREIALDFMNSEAWESDLIA
                     GRLEFKKFMRPYPKNNMILSHTVSCTIYGGNMTGIWHLEGQFYPSILSEIILTDSDGS
                     YEFIPHKATVTEQSLSVEIKHPVSLTVSHVSLRVFPVKFSQEYYSCTPTVELPWIPQF
                     SFYEYDSYRLSHEGRFISLCFYVMIWAYLITLALCATPLFWVKVFEMLRRGIKARYAG
                     SVRRNSLFYAAKCQ"
     misc_feature    complement(208230..>208718)
                     /gene="US7"
                     /locus_tag="CCMVgp138"
                     /note="CMV US; Region: CMV_US; pfam08001"
                     /db_xref="CDD:285273"
     gene            complement(209038..209685)
                     /gene="US8"
                     /locus_tag="CCMVgp139"
                     /db_xref="GeneID:935447"
     CDS             complement(209038..209685)
                     /gene="US8"
                     /locus_tag="CCMVgp139"
                     /note="type 1 membrane protein; binds to MHC-I; involved
                     in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US8"
                     /protein_id="NP_612781.1"
                     /db_xref="GeneID:935447"
                     /translation="MGVPCLVWCFAVLLCVWGALCAAEDDYGEDDYEGFSSQRHAFLY
                     RNKVDTYEADCVVRDGVLEAEWRVRGSFFPEDGLLGRVSWQGHRGRRWGHLEAPRREV
                     SRDSATFRLTQRVPPELDYLILNIIPCMRCKPLWCEPRYHIRYLNYGTSMDNLQRLHY
                     EYRHWELGFVLGLQLLAVLMLGYVFAKMVYELSRYHYMRYHACVPQKCHPVKPLY"
     misc_feature    complement(209050..209667)
                     /gene="US8"
                     /locus_tag="CCMVgp139"
                     /note="CMV US; Region: CMV_US; pfam08001"
                     /db_xref="CDD:285273"
     gene            complement(209696..210469)
                     /gene="US9"
                     /locus_tag="CCMVgp140"
                     /db_xref="GeneID:935527"
     CDS             complement(209696..210469)
                     /gene="US9"
                     /locus_tag="CCMVgp140"
                     /note="type 1 membrane protein; possibly involved in
                     immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US9"
                     /protein_id="NP_612782.1"
                     /db_xref="GeneID:935527"
                     /translation="MQLKESQSLIWHCCVIAVSVLSGRSRETSFRVSGDESASDRTCP
                     TSSPYSSQSVRLPPYPHPVGDNVSRYRVQSSVSECYVQHGTLVAVWAVRGNFSEPFPR
                     VYGTWGNERSASHFQVDEPRIETDGTRRYEVELPQVDARISYVMLNVYPCSTCNRSSL
                     HCQPVLRLPWLPLRTTSSDLERLFVEQRYVLLAYVVLVQFLKHVALFTFGIQLACCVY
                     LRYVRPRTRRHRRRHPAGRITAAAATVTVTPHEETEKNR"
     misc_feature    complement(209807..210430)
                     /gene="US9"
                     /locus_tag="CCMVgp140"
                     /note="CMV US; Region: CMV_US; pfam08001"
                     /db_xref="CDD:285273"
     gene            complement(210797..211378)
                     /gene="US10"
                     /locus_tag="CCMVgp141"
                     /db_xref="GeneID:935550"
     CDS             complement(210797..211378)
                     /gene="US10"
                     /locus_tag="CCMVgp141"
                     /note="type 1 membrane protein; delays trafficking of
                     MHC-I; involved in immune regulation; US6 family"
                     /codon_start=1
                     /product="membrane glycoprotein US10"
                     /protein_id="NP_612783.2"
                     /db_xref="GeneID:935550"
                     /translation="MGDWRMIRCVLGAWLLSLGATDRQEGSSSPRATNEVSHFTCSCV
                     IKNHVLSGTLQMHGLFTPGTQKAVALLHLGDDDRRPVAVKGLATATEATYTLGPTPVV
                     WTEGGDERHGPLSEQNCSVSLEMSPNPRGELFMCPATAYDSGTVMGLVMDLVHMWYQG
                     DYWAMLRVYVGIFCGSYVITRSLLLLTGVDTGR"
     gene            complement(211467..212144)
                     /gene="US11"
                     /locus_tag="CCMVgp142"
                     /db_xref="GeneID:935483"
     CDS             complement(211467..212144)
                     /gene="US11"
                     /locus_tag="CCMVgp142"
                     /note="type 1 membrane protein; causes selective
                     degradation of MHC-I; involved in immune regulation; US6
                     family"
                     /codon_start=1
                     /product="membrane glycoprotein US11"
                     /protein_id="NP_612784.1"
                     /db_xref="GeneID:935483"
                     /translation="MRLGLLWITLCSAVRGEDVCPRSWSLPYANETVPRTAKKTTTDT
                     VPGFPPWPDISGYAVEHSGVQCVIRHGGKLEALWILRGNFSAKGPVPKAYYRYDGGVS
                     EDIPLQDVSGDTAASVRRYWLYGYPVRVDLRRVFFYFQPCYRCHAHWTECEPAAAVPW
                     LPLWSSFHDVRRLLHESRRLTAYYVMFVKSFQYTLMCVMAIQVFWGTCVQTWPYHDRP
                     WLIWDHM"
     misc_feature    complement(211557..>212003)
                     /gene="US11"
                     /locus_tag="CCMVgp142"
                     /note="CMV US; Region: CMV_US; pfam08001"
                     /db_xref="CDD:285273"
     gene            complement(212315..213235)
                     /gene="US12"
                     /locus_tag="CCMVgp143"
                     /db_xref="GeneID:935551"
     CDS             complement(212315..213235)
                     /gene="US12"
                     /locus_tag="CCMVgp143"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US12"
                     /protein_id="NP_612785.1"
                     /db_xref="GeneID:935551"
                     /translation="MVQIQFHQGEPLGKDKSSEPRKKEEREEGEKTAPSSSPPTPPSP
                     ASTTTTIPLPPRIFNPSDEQTWKGIQHFLWIVRLYGIVTFMSSATLVATILCMLVPWR
                     IEKVYLRDTLPVWGMLIPCMLRQYGQWMQNNRKPGSLLMIMVYTALTTLPLAVVGLCF
                     DKSLIIQAYVVSSAMCVWATGLAWLMAWHVSRRLAIMGLLSLAVPLLWLFVAIQPWAV
                     HQRVVMGVTVGLVYALQVLMIRDTLMILYLPPATDYADGGLLRTATILYMDQVIMFLL
                     TLVPLTSHLWFPTYAESLNRTAQRLLFRQP"
     misc_feature    complement(212402..213013)
                     /gene="US12"
                     /locus_tag="CCMVgp143"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:294323"
     gene            complement(213304..214092)
                     /gene="US13"
                     /locus_tag="CCMVgp144"
                     /db_xref="GeneID:935454"
     CDS             complement(213304..214092)
                     /gene="US13"
                     /locus_tag="CCMVgp144"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US13"
                     /protein_id="NP_612786.1"
                     /db_xref="GeneID:935454"
                     /translation="MDALQRDWAELLRLHRTVMWLRRFGVHMRVYALAIFYVAATTAF
                     CGAVWLGIPEAHNLCQKESSPMLLVFVPTLLWCFILLRGDRHPNSLVIAGCYVALLSV
                     STLIYTWCSELPAILTDYVLVITLWMACTGAVMTCDAFKARRWETICSRVLTSVFFIT
                     LWVIGDQTVFRHQRVILYGYGAILFIMMSVTFYGTRYIRDELPASDVVRGSLLIYVGL
                     ITMFKITLIVLSPNLWHLPWTNVFSSLRPHHATPSASSRVSSSI"
     gene            complement(214199..215059)
                     /gene="US14"
                     /locus_tag="CCMVgp145"
                     /db_xref="GeneID:935499"
     CDS             complement(214199..215059)
                     /gene="US14"
                     /locus_tag="CCMVgp145"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US14"
                     /protein_id="NP_612787.1"
                     /db_xref="GeneID:935499"
                     /translation="MEPPSPRPAPDGGEEDGGEREGGEEEEETAALTEAQTDDAVFWL
                     QRNVVVFRVYGLLLLETAITVLFSTLVWLGYPQLSYRCQEDPSPLLLSCTPVLVLGIL
                     EGTDYKHPSNALVLGLYVAFLSFSAAVINFCSTVTHAVSSAILTWALFVACNGVAWEH
                     RLRALWRDALFTTTLLTVVMGILASSYQLMHKMLLCLYTVFVGCILAVLFQDVRHVAT
                     ELPVDQAIRGSLLLYSTEMLIYHTTLLVLTPVMWSARWDLMFSYLSGHRSNATLSAVV
                     SPSVSATPGR"
     gene            complement(215097..215870)
                     /gene="US15"
                     /locus_tag="CCMVgp146"
                     /db_xref="GeneID:935530"
     CDS             complement(215097..215870)
                     /gene="US15"
                     /locus_tag="CCMVgp146"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US15"
                     /protein_id="NP_612788.1"
                     /db_xref="GeneID:935530"
                     /translation="MRSPVLTDKTAVYLPPRLRARLTARSLAWVYQFRVTVYTYGAVV
                     FQVAGTLSLLLAFAFVAPSAWRQHPRLCFTEGSPSLTFLVPFLAVLCLYCAEKSHPPK
                     VSVLLFYTLINLPPLAVACLCISPFQLLAASLFTLTGFATFTGLALLARDHDIRRQIV
                     LVHVLVTLAFVAALIVISLREGSWYLKVISGISVLIACLALSHFHETALAVRYETPLA
                     RTPLAAAKVFLNLVFSLLMVLRILTLRTFLQTYFPVSES"
     misc_feature    complement(215145..215732)
                     /gene="US15"
                     /locus_tag="CCMVgp146"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:320991"
     gene            complement(215938..216888)
                     /gene="US16"
                     /locus_tag="CCMVgp147"
                     /db_xref="GeneID:935531"
     CDS             complement(215938..216888)
                     /gene="US16"
                     /locus_tag="CCMVgp147"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US16"
                     /protein_id="NP_612789.1"
                     /db_xref="GeneID:935531"
                     /translation="MRSLRFPGVGAPAYRRLLLSPSSESDEEQERYEASLAAALCWLE
                     RFEVLSRVVGLLLFQIAFAVSALGGFALVFPAKVLRAYPGFPCGVPWTPEAALLLCLA
                     SACWIYWRYERPLSRHHPRQRRPLHELALLLGGLLVHLPLVGLVCVCQEDPAPVLSAF
                     VLALVVTFLCAQVAFLCRGLRAALNQFMLINTVWFAVFLVDLLIVFTRDWPWALRLLV
                     GFYTTMGIIFAGHLSQQVLMVRYLTMPRDAGWTSVQMFSSVVFIFFILLRVRTCTDLI
                     QSLLSLPSFSSGSSLPVMVTFAPFSGNASSGSLLPLSISL"
     gene            complement(217013..217876)
                     /gene="US17"
                     /locus_tag="CCMVgp148"
                     /db_xref="GeneID:935533"
     CDS             complement(217013..217876)
                     /gene="US17"
                     /locus_tag="CCMVgp148"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US17"
                     /protein_id="NP_612790.1"
                     /db_xref="GeneID:935533"
                     /translation="MPPDHAEEMAAETPLLVRGGPGVLMISAMTASDVHRFLVCTRVY
                     STVAMQATCTFLLCLGMVLAFPHLESTVFLCCTGFMPPLSLAVPTVCLAVLHSKYEDR
                     PPSATVLTIYSVVTTLSVVVASACSSSVMVVGAGVLACILFAICTAVACLGGMDRRRW
                     QVIVSLYLLSVAVLLMGIYVQPMSLGGRLFLGYYVTALGFMLAVTAFDTSRLFDVSWR
                     EADLLALCLYENFAYLYLLLLILFTTQDSHDKLVAWMAWMSRSTGLEQSSAAGCDLLR
                     AIRRNLTRLLA"
     gene            complement(218098..218979)
                     /gene="US18"
                     /locus_tag="CCMVgp149"
                     /db_xref="GeneID:935534"
     CDS             complement(218098..218979)
                     /gene="US18"
                     /locus_tag="CCMVgp149"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US18"
                     /protein_id="NP_612791.1"
                     /db_xref="GeneID:935534"
                     /translation="MGDRPDAASRPPPPPSPPPSPPPSYRETVERDEAPPAVAAYRRA
                     LAAEPYLFHWLTRFRMLVGVYHGLAWQLSCTFTVCLLAWFAFPDVRGHCAHGVVPAMS
                     SVVPPLSLAMLRGVAEYRPRFTRHAWLTVACLVMNTGTTVATGFCGERSVIGLAFALT
                     VLFFVLCTGLSYLGGLNNTRWKLIGTCYAWVVVTYYLLLYFSPVIWVSKIYSGLYALI
                     VTGAAASLCFETVDLIYLRTPPPPKNGVFISVIMYAIAMCMLNMSVAIFSGHLWLQQY
                     AKDHHGQITWLDVLRLH"
     gene            complement(219108..219836)
                     /gene="US19"
                     /locus_tag="CCMVgp150"
                     /db_xref="GeneID:935497"
     CDS             complement(219108..219836)
                     /gene="US19"
                     /locus_tag="CCMVgp150"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US19"
                     /protein_id="NP_612792.2"
                     /db_xref="GeneID:935497"
                     /translation="MLHNLPLEWTLEELAPYLERFAVWLRVAVIVNFQLTVTVLLSAL
                     LWSLVPQLTELCERWDTALWQLLGLVVPVACLFALHGVQLAAYKDKLILMLGYCLPNT
                     LAFMGPLMCQPLRALLYPALLTWVLQLCCLATAIMGLGLSRHWNTLRRLLVPCLSLLC
                     ATALLMWLVTMPEQVSLLMHLGAVACLSVAVIHDLSLTIFRSSFPESFPTAIRLYVEN
                     VALFMSIYSLLTQSRPWRAASGWS"
     gene            complement(219994..220758)
                     /gene="US20"
                     /locus_tag="CCMVgp151"
                     /db_xref="GeneID:935503"
     CDS             complement(219994..220758)
                     /gene="US20"
                     /locus_tag="CCMVgp151"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US20"
                     /protein_id="NP_612793.1"
                     /db_xref="GeneID:935503"
                     /translation="MQHQEATTLLLSRVEALEWFKRFTVWLRVYAVLVFQLAFTFGLG
                     SVFWLGFPQNRNFCVENYSFFLTVLVPIVCMFVAYTLGNEHPSNVTVMFIYLLANSLT
                     AAIFQMCSESRALVGAYVMTVALFITFTGLAFLGGRDPYRWRCISCVYALLVLSFLAL
                     ALSGHENWMQKLIMTLSAFSISFFLGILAYDTLSVIFYCQPHRCIRYAICLYLDVMAL
                     FLMLILMLSGPHWIRVSEGLEAGNATARSTAVAKAT"
     misc_feature    complement(220078..220677)
                     /gene="US20"
                     /locus_tag="CCMVgp151"
                     /note="BAX inhibitor (BI)-1/YccA-like protein family;
                     Region: BI-1-like; cl00473"
                     /db_xref="CDD:294323"
     gene            complement(220912..221598)
                     /gene="US21"
                     /locus_tag="CCMVgp152"
                     /db_xref="GeneID:935506"
     CDS             complement(220912..221598)
                     /gene="US21"
                     /locus_tag="CCMVgp152"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     possibly involved in virion morphogenesis; US12 family"
                     /codon_start=1
                     /product="membrane protein US21"
                     /protein_id="NP_612794.1"
                     /db_xref="GeneID:935506"
                     /translation="MSLRGQVQVARSVFLLRIYILMWVQSLILMSVCGFCWLVFPHKL
                     EHLFPSVRLTLSCLMISIVCLGLLRWAEPNFPKNVWLLLTYTLLTSVAVTASGFHFSH
                     RSVIYAMIATVVLFCFLTLATYTFARDVELQRSLLTAASALILLLFLVFSLFPEEVGE
                     IVVMVAGLAVIVTSVVCDTQDILHDIEYESYIQGALYLYMDLMYLFVSVLYFMPVNRP
                     TTGATQNFVS"
     misc_feature    complement(220969..221559)
                     /gene="US21"
                     /locus_tag="CCMVgp152"
                     /note="Inhibitor of apoptosis-promoting Bax1; Region:
                     Bax1-I; pfam01027"
                     /db_xref="CDD:279379"
     gene            complement(221781..223610)
                     /gene="US22"
                     /locus_tag="CCMVgp153"
                     /note="putative beta gene"
                     /db_xref="GeneID:935507"
     CDS             complement(221781..223610)
                     /gene="US22"
                     /locus_tag="CCMVgp153"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US22"
                     /protein_id="NP_612795.1"
                     /db_xref="GeneID:935507"
                     /translation="MSLLTKAAAEAWGTYLRQRDERCEDAIRCDYGVFQFRNTIYQRT
                     LSLLQGLYLRQYDPDALRSYVRQHRGTTVALRNPANWLLVLRETAAIPQIYARSLASE
                     YLCCDDDLEAVGVLAVRPADDDPHRHTKWAQEVPCVLMMGKHGTVYVYDWETDGLYEV
                     ASDLKVFAKNGLLWCEYVYRHPQTPFSTTEPRYHVQKFLCADPTDAVAVAQTAREMSG
                     LNLVIRTPGRTEVEPLLMLGSVEALRACRPFDHMSAAEFRELRVFIRQRLCCEWYVVG
                     MMGYYLAYGPFVPSGVVLLDQFGVVYFLKIEDSDLYRLADNFHMFLKCGLLKTRGLCR
                     FDRGLRGECRLEELPVCHHTLKKNMLRWHGALGTITRAQLESALDWFLRPSRGQDKVP
                     NNNVAWGRTDLLATGALQDHHQSSFFPAQRLETLPALQGGLWEDNDETTQAVEGQRCF
                     RVAKCFPPTPHMPYNECGVELSCQLSSDEDEAPRQPRRVAPRAGNPPHTPYPSDNEEG
                     VEDAPRDEGDTPAPPTEPMPAEEDDETEIPSSQLGREEEGDGEGDDAGGGPPVYQSEC
                     LPTTEREAWLHRGRRAKAMHDCGHTLKQVVIPEPDQMSNEMDD"
     misc_feature    complement(223074..223451)
                     /gene="US22"
                     /locus_tag="CCMVgp153"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(222621..223004)
                     /gene="US22"
                     /locus_tag="CCMVgp153"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(223742..225538)
                     /gene="US23"
                     /locus_tag="CCMVgp154"
                     /db_xref="GeneID:935601"
     CDS             complement(223742..225538)
                     /gene="US23"
                     /locus_tag="CCMVgp154"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US23"
                     /protein_id="NP_612796.1"
                     /db_xref="GeneID:935601"
                     /translation="MWRTRWEEGAPTFTRHDEFLYCHTRYETFLRVMGDFKAIFERQH
                     SAEVVRDWVRNHVDQVLSLGIPHNWFLQVRPGSSMPELRDQLLDDVICCAERLIVLGK
                     CVVLVGDRYEETELVLCMGGSTRLYIYEPSQEILLLCAKHLDELARYGLLYTESIYRQ
                     PQTPYATRVPHDVVRALLHNCRSPDALAACVGEHHGRDVNFHTPGRHAKTLKLLTNFG
                     CLSECWPFEVAAPCRLAECEMYLSLRLRCRWFLLGAVGAYRPGGFFDVSSLLIFDRFC
                     RFYTVIVKTHLDRSPTTQRLAGEVYRLADDLHELFRAGLMKVYVRRRYEHGLRRSARL
                     ERNGPCVHLGEGARLHFTMFDSGVDRDYGRQYRWLCRGDRFRAEMLNTWDGWDAFTMW
                     QTRVMRGEFGDRRRARPPEDEEGDEESQGRRRPPRPPGPPLPQEEDNHVVPDNDRYIE
                     VYGHLEEVEDEEADDEDEEEPMEPDNVVPEGQPQQQPQGQQAPAVAAAQARRLAAHGG
                     NGADSEDDEWEDLGFDLEEDTVFDLKDVDEWFQQRREAEAQRWQLGRRIVDAYQTEAE
                     VSEAEVEARRIHLNTDLSPEWVKSFDFREHFV"
     misc_feature    complement(223745..225538)
                     /gene="US23"
                     /locus_tag="CCMVgp154"
                     /note="US22 family homolog; Provisional; Region: PHA03346"
                     /db_xref="CDD:223052"
     misc_feature    complement(225065..225415)
                     /gene="US23"
                     /locus_tag="CCMVgp154"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(224573..224998)
                     /gene="US23"
                     /locus_tag="CCMVgp154"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(225644..227188)
                     /gene="US24"
                     /locus_tag="CCMVgp155"
                     /db_xref="GeneID:935592"
     CDS             complement(225644..227188)
                     /gene="US24"
                     /locus_tag="CCMVgp155"
                     /note="US22 family"
                     /codon_start=1
                     /product="tegument protein US24"
                     /protein_id="NP_612797.1"
                     /db_xref="GeneID:935592"
                     /translation="MDFAGGPGAEGAAEAALAAVVPPQLPSLDALMGLPGAAAGEDPM
                     ALYRQVLRDFKDLFMCLDPLEITRFVQRNEGRCLCLGPPKGWHVTLRLEDEIIVSAKK
                     AASKLVCCGEPLTPLGYAVILLPDPRRDRDDSVISTPYVVFQGRYSRIYAYDTRDQYL
                     VLVAHNLDELARYGVSRSEIAYRDVVHTALRRRQPPLPRRYPRGARTMHILFLNDTTP
                     EGSYATAERILNCDVKLHTPGYGTVIMRLMKTVQQLQCVWPFCALNDAECRRWWWGIR
                     ANLCTPWYLLGVTGRPRPGRAFVAEVLVLLDWFGAVYAIQMDDPNHYVRRVANSVTEF
                     FRMGLLKMVFRHRRFERERQRQTRMEHRHLCPHHHERAVDHKRDILFNEDAWHPDERR
                     ERERRVLQQHYEWLCLTERFDPHEGAWERLDPNALVLHRYDTNSQTYVVDPDIVGLQA
                     AEREAAERQDDTGPRLHCLVTTRSSTRDGAERVISALVQQSRLVTYSDPFPLKSLTGV
                     REYIQI"
     misc_feature    complement(226643..227011)
                     /gene="US24"
                     /locus_tag="CCMVgp155"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(226160..226546)
                     /gene="US24"
                     /locus_tag="CCMVgp155"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            complement(227792..229540)
                     /gene="US26"
                     /locus_tag="CCMVgp156"
                     /note="putative beta gene"
                     /db_xref="GeneID:935602"
     CDS             complement(227792..229540)
                     /gene="US26"
                     /locus_tag="CCMVgp156"
                     /note="US22 family"
                     /codon_start=1
                     /product="protein US26"
                     /protein_id="NP_612798.1"
                     /db_xref="GeneID:935602"
                     /translation="MRQSYRYASGAVVRRTLRGLRKIFTCQDSRQEVRQLVRSYADMN
                     ISLPIPAPNGWRLDFVEFQDIFGESAVIDGPDSPWGRLICCEESLEPLGVLQYSSSVL
                     PVLRRPRTSSDEEDSEDEDFFLYVEEIESPSRARLVLLLGRYETMWCLDREQQTLYYL
                     AHSLDDFARHGLLHLEVIYADKMRTPLLTTQPDNMICDLRLHDHNINELQRVACRYRG
                     ECIPLRTPGEMTRPLMLCGHADNLKGVWPFICMETPQFHNLLKFFVDCLCCEAMVLGV
                     VGESLPSGLFHAEFVLLADRGCVIFYFDVFRREMWRLANDIDMLFTVGLMKIYQAGRR
                     FHFAVEDAERLEMPGRCPHENFPFWDRFGAVERVRSFQRHHEQRYKWLVRRDRFYSRT
                     DGCYARNSLDEVSGASDVSWDPRVRPDYPQISDLECAKQYWQQLNDHVREQTQRYGPS
                     RRYTMWYGMTSRLERAVKRLQQRIPRRDLMNPSLVSQGLCVYYSDEDEKPEAENGGDS
                     SDEEENQKQRTKSEGGSGTEAEKTTGKNKKVEEDISPAYRRVLTRRAARAAVLEGRPA
                     PKPAMPHPSSYLPFWI"
     misc_feature    complement(229004..229465)
                     /gene="US26"
                     /locus_tag="CCMVgp156"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(228545..228937)
                     /gene="US26"
                     /locus_tag="CCMVgp156"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     gene            229954..231021
                     /gene="US27"
                     /locus_tag="CCMVgp157"
                     /db_xref="GeneID:935604"
     CDS             229954..231021
                     /gene="US27"
                     /locus_tag="CCMVgp157"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     putative chemokine receptor; possibly involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope glycoprotein US27"
                     /protein_id="NP_612799.1"
                     /db_xref="GeneID:935604"
                     /translation="MSNNTTSRIPPKIYNTTLYQLYDYTRTWVWVIGFMGILLNLCVI
                     LTIVIKRRKKKSPSDVYLCNIALADLALVFILPTILEYVHNHKDTAHHVACYAMNACF
                     YICLFANVCFWTNLFMDRYSAIVWGVQLNSIRNRRRSMWWSLMFWLFALIMASPHYAL
                     KQRSDSECVGDYSHDLTKVVFPVFINFKVNILGFLVPIIVMSLAYHNMVRFVINYVGR
                     WNLQTLDVLLVIVVSFGCFWFPFNLALFLESIELMWSSTSRFLGGAIELCLHLGHFFV
                     YFRACFNPLIYIIVGKQMSKDMCDTFRSMCLCCYPRTVPYQDIDLEVKKDFQRRLKDS
                     KKASYHGKNDKVPVEDTEFLL"
     misc_feature    230071..230814
                     /gene="US27"
                     /locus_tag="CCMVgp157"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            231222..232277
                     /gene="US28"
                     /locus_tag="CCMVgp158"
                     /db_xref="GeneID:935498"
     CDS             231222..232277
                     /gene="US28"
                     /locus_tag="CCMVgp158"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     broad spectrum CC chemokine receptor; constitutive
                     signalling; mediates cellular migration; involved in
                     intracellular signalling; GPCR family"
                     /codon_start=1
                     /product="envelope protein US28"
                     /protein_id="NP_612800.1"
                     /db_xref="GeneID:935498"
                     /translation="MTPAGALTTEFEYDTAAEACNLTDVLHQSRPVTLLFYGLIFIFG
                     CVGNLLVIFTITWRRQIRCSGDVYFVNLALADLMFVCTLPLWMQYLLNHDSLASVPCT
                     VLTACFYVAMFASLCFITEIALDRYYAIVYMKYRPVKQAVFASVFWWLFAFIIAIPHF
                     MVVTKKQNQCMNDYEQLERSYPIILKTEIILGAFVIPLSVISYCHYQISKVVAGSQSR
                     HKTHVMRVLLAVVCVFILFWMPYHLALFVDVLRLLHWIPDSCEFTKSLQKTLILTESV
                     AFCHCCFNPLLYVFVGTKFRQELYLLLGNLRQRLFSRAVASYQTMTFSRRSSRTDDGT
                     TQDTISETFSTVSELPY"
     misc_feature    231336..>231707
                     /gene="US28"
                     /locus_tag="CCMVgp158"
                     /note="Olfactory receptor; Region: 7tm_4; cl21561"
                     /db_xref="CDD:304433"
     misc_feature    231360..232085
                     /gene="US28"
                     /locus_tag="CCMVgp158"
                     /note="7 transmembrane receptor (rhodopsin family);
                     Region: 7tm_1; pfam00001"
                     /db_xref="CDD:278431"
     gene            232436..233776
                     /gene="US29"
                     /locus_tag="CCMVgp159"
                     /db_xref="GeneID:935489"
     CDS             232436..233776
                     /gene="US29"
                     /locus_tag="CCMVgp159"
                     /note="contains potential transmembrane domain; US29
                     family"
                     /codon_start=1
                     /product="membrane protein US29"
                     /protein_id="NP_612801.1"
                     /db_xref="GeneID:935489"
                     /translation="MGPRGWWWLCGVCCWWWVTFGCARTVTVDVVAPTVRAQSTVVYS
                     EPPRSSSSSRGGTAKRRSTVSRWLRLRHGNASACVSEVDWTTQFFFSGCERYPSFVKL
                     NGVKRWTSERQFLGEVAYYGGCCVVSGGRHAYVVLINGYGTATYGNALRLDFSRRNCT
                     VPLQTYPRRLEIYDGQTTPSRCDPYRVYFYGLRCPQQLVLNASGGLELRRCPGTSPAA
                     ADPSRPRHRGDLEDELRGLCVDLLVCVFLLALLLLELIPMEAVRHPLVFWRRMALTPS
                     SCRFERWCKARLRRLLGLPPPPPLAPPSPPKKSPSVFATDNSAWAPLSAPPWRPPLPS
                     VVPDSPPPPYSLRHATSLVTVPTLLLYTSSEASFAMPQTACALYATYGEPGEPAGSAD
                     ASPGSGAAAAVSAPGPGGSDGLDAVPSGQEHGAAFQPGLDLVPEPVPSAPEEPC"
     gene            233577..234674
                     /gene="US30"
                     /locus_tag="CCMVgp160"
                     /db_xref="GeneID:935502"
     CDS             233577..234674
                     /gene="US30"
                     /locus_tag="CCMVgp160"
                     /note="type 1 membrane protein"
                     /codon_start=1
                     /product="membrane protein US30"
                     /protein_id="NP_612802.1"
                     /db_xref="GeneID:935502"
                     /translation="MGNPASLLDPRMRRRDPELPLPSRLLAPVAPTASTRSLLAKNME
                     LRFSLAWIWFPSLCLLLLRNPADACLVDVGSQVTIREQCRLQNGAMISGGVLEGNFSG
                     GAVLELDYEGLDYLGEGQRMQLHLSGLEKEDAAAASASSHRGHHHGRLRWSFYVQQRQ
                     PKYGIHRRVVRLRVLSSEEQGRFDLPTSCAHQKRYHPLRDGEDNHDDDGSATHASHYN
                     LLGALLVWIGSGLNIVWWTGMVLLAMDALGLGERWLRQALHHGETQQRSRAQALQHER
                     DMFWQRRKRAKRSRAASEDGSVSPVIKISQEEKVRHLVALPWGGTQTALVTGEPLPSP
                     PPLPDLPPVPSSAPPVLLSQRPPEYSELPPV"
     gene            234781..235242
                     /gene="US31"
                     /locus_tag="CCMVgp161"
                     /db_xref="GeneID:935509"
     CDS             234781..235242
                     /gene="US31"
                     /locus_tag="CCMVgp161"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US31"
                     /protein_id="NP_612803.1"
                     /db_xref="GeneID:935509"
                     /translation="MSLLEREERWRRVIDYSHELWCDCGNWQTHVEIQDDGPNSQEPE
                     PAHWLQYVECQWQLRVRDSHDRWCLCNGWRDHALRGRWGTAYSSGSSASSSGFVAESK
                     FTWWKRLRHATRRWMFRRNRHRSPSRYSSSSSEDDDGSSLRTNEAYVRSQR"
     gene            235376..235957
                     /gene="US32"
                     /locus_tag="CCMVgp162"
                     /db_xref="GeneID:935545"
     CDS             235376..235957
                     /gene="US32"
                     /locus_tag="CCMVgp162"
                     /note="contains duplicated TT virus ORF2 motif; US1
                     family"
                     /codon_start=1
                     /product="protein US32"
                     /protein_id="NP_612804.1"
                     /db_xref="GeneID:935545"
                     /translation="MVIATTDSERDWRRVMVESHALWCDCDEWQSHLYRVFDSDFHRR
                     ARNREERRAANWRRQMRRLHRLWCFCRDWKSHALFTIWDGMESDADSSASSSGEAPEQ
                     PVCKWKNARALSRAYHYRRSRGRRGTPPPRNMPGFEHVRPLWYNNPRDVREDERRTRA
                     EPDRVVFQLGGVHPRRPFRIYEPPDPEEEEQGA"
     gene            236175..236360
                     /gene="US33A"
                     /locus_tag="CCMVgr005"
                     /db_xref="GeneID:11468241"
     CDS             236175..236360
                     /gene="US33A"
                     /locus_tag="CCMVgr005"
                     /codon_start=1
                     /product="protein US33A"
                     /protein_id="YP_004940337.1"
                     /db_xref="GeneID:11468241"
                     /translation="MSFGFPERIEAAIRRRRPHCKRVRTGHPTNMMHFVVRQLMMYPR
                     LIPFPLPFYTPRLEVRR"
     gene            236551..237060
                     /gene="US34"
                     /locus_tag="CCMVgp163"
                     /db_xref="GeneID:935607"
     CDS             236551..237060
                     /gene="US34"
                     /locus_tag="CCMVgp163"
                     /note="contains signal peptide"
                     /codon_start=1
                     /product="protein US34"
                     /protein_id="NP_612805.1"
                     /db_xref="GeneID:935607"
                     /translation="MNIEKLVNLLGLLCWIAAQTVSRIAPHARGLSPDQLHGLYRGLH
                     LELLEPARPQAANRSVRDRGGPATCQEEKDRGGSFPRFSGFRARRVPSHGSQPRGSDT
                     LPALRFQLPERVLLCLNRGCHGLYAVVERPRLVGVPVSNSTVLPVLWLKPGATWENGT
                     APIRGPEER"
     gene            237057..237245
                     /gene="US34A"
                     /locus_tag="CCMVgp164"
                     /db_xref="GeneID:935594"
     CDS             237057..237245
                     /gene="US34A"
                     /locus_tag="CCMVgp164"
                     /note="contains potential transmembrane domain"
                     /codon_start=1
                     /product="protein US34A"
                     /protein_id="NP_612806.1"
                     /db_xref="GeneID:935594"
                     /translation="MKFFKSRARPPRLTVPRVLRFFGYAVLLAVAWQRLKKERAASLR
                     RYEEKMRRQQVRRRQSFP"
     misc_feature    237063..237242
                     /gene="US34A"
                     /locus_tag="CCMVgp164"
                     /note="Herpesvirus US34A protein family; Region:
                     HHV-5_US34A; pfam17087"
                     /db_xref="CDD:293692"
     gene            complement(237846..240404)
                     /gene="TRS1"
                     /locus_tag="CCMVgp165"
                     /note="putative beta gene; immediate early gene"
                     /db_xref="GeneID:935608"
     CDS             complement(237846..240404)
                     /gene="TRS1"
                     /locus_tag="CCMVgp165"
                     /note="transcriptional activator; blocks phosphorylation
                     of eIF2alpha and host shutoff of protein synthesis; binds
                     dsRNA; involved in gene regulation; involved in
                     translational regulation; US22 family"
                     /codon_start=1
                     /product="tegument protein TRS1"
                     /protein_id="NP_612807.1"
                     /db_xref="GeneID:935608"
                     /translation="MSQRFPRPPGRPHAHPNVHNPTTCKPHAGGQAGAIGGGPPGAPP
                     SLNFWNSPERFLLAQIPVERRTLTELEYQAMGTIWRTAFMANTTSRAMRKWAQREAGG
                     LLPLGRPYGFYARITPRSQMAGVGATDLRQLSPRDPWIVLVATIVHEAATGHEPLPSP
                     GATAPPTGLDGLCQQDQLYLALGVNFRVFIYDLQRNTLTLAARDADEWFRYGAGDVAR
                     LYRSNRLGLNAPRATAVPEPALLRTLTKSDDVNELGRELRRRWQHTGIPLQTPGRLRQ
                     PWVILGSWQELENYEPFASAPHPPSLLTAVQRHIHQRLCCGWLFLGVVLPSRWLTIYC
                     RHDTEAGTPQENPSVSADTGNDASSSARLSSSEHGAATRSGGPANAATTSPQHGGRQT
                     GTGPGASNTAAGAGTGTGLSSGMAPSQTAGRGNGPAGHPAGAPLITHTANTQGHGVAP
                     HNSSAATCAVSPPLSSSAGPTSAAGTAAGATSSGQRPTAADLLQQQQLQQLQQPPVRG
                     TDGRPYAQALLVLDELGAVFGYCPQDGHLYPLADELSHLLRAGLLGLLTLGRVSAPPA
                     EAALRLLPDLDREHWERPRWDALHVHPRAPLWVRDGAGQLNFLLRPGRGESEVLALAA
                     KNQGLSDSIAVEDHLNDARRRADAQALGLDLAMILLEAGGHLHKDKKGKKGRGKEDEP
                     SAKGKSSKYNRPSEPPLSHQASIGRALRRDDEDWRPSRPIADDAWFDLDESIWVLGTS
                     RKNDVVQRRWKKATIRCGLDIERPLPVPPKGCRPQSFIHEATTSPPQTSLNYTAPEFS
                     DPGNYVVPHMAPGFIQPVCMPAPVPYYDTTARLCRDMRRVTFSNVATHYHYNVQ"
     misc_feature    complement(239745..240152)
                     /gene="TRS1"
                     /locus_tag="CCMVgp165"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     misc_feature    complement(238767..>238868)
                     /gene="TRS1"
                     /locus_tag="CCMVgp165"
                     /note="US22 like; Region: US22; pfam02393"
                     /db_xref="CDD:280541"
     repeat_region   238635..241087
                     /rpt_family="TRS"
                     /rpt_type=inverted
     repeat_region   240791..241087
                     /note="'a' sequence"
                     /rpt_type=direct
                     /rpt_type=terminal
     misc_feature    241087
                     /note="unpaired T residue at 3'-end of upper strand;
                     complementary to unpaired A residue at 3'-end of lower
                     strand"
ORIGIN      
        1 ccgatccggc ctccgctgcg ggtcccgggg ggtggggggg tgtttttggc gggggggcac
       61 taaattggcg caaggttgcg cgtgtcgctt gccgcgggcg tgcagggagg ccgaagcggc
      121 ggccggagcc gtgcagaaac acgtacgtac gcacgccaaa ccagtccccg cgacgacccg
      181 ccggcccgaa acacgtccga ccggccggcc cgccgcacgc cgccgcggaa accggttccg
      241 tgactcaccg atcccggcca cggcaaacac gcgccacact cgctgcgcgg atagactagg
      301 gtggtagggc aagtttccgg atgagactgt ggtggtgaca gcgggtaagg agggcaaacg
      361 atgtgggcgg cgtgctgtgg aacgaaggtg agtgtgtgct ggcgcgcggc tgtgactgca
      421 gctgtgtgct ggcgaggcca agccggcggt aagccagccg gtgaggcagc gttgcgtcac
      481 aggctctgcc agcgttgagt cacaccgtat gccagctgtg agtccgagaa cgaactggaa
      541 ggagactgaa ggtgagggga atgaactggg gggaaggagc tgaggggaat gcactgcgga
      601 gaatgaacgg acaatgaacg gacaatgaac gcactgcaag gaggagaaag gacgggcccc
      661 ggggggacgc ggaggagggg ggctatataa cgccgcgctc ttcgcgctcg catatgcgaa
      721 actccactat gctgaatgaa ccctcgattt caacaacaca cattcccagt gagggcggac
      781 ccctgggata tcctgtctcc cgagaagaca tgaaacgtgg cggcaccgaa tggatcgaag
      841 gcaccgacta ccccgaagac tgctggtgta tgtggggacg cttcggtaca ctaaaccgcc
      901 gtccggtagt ccgcctacta ctccaaagac aactagaagg ccgctgcgac tggaacgtgg
      961 tccgctgcag aggaatgggc ttccgcgcca ccgacaacga gcacggcatg gccatctggc
     1021 gtcaacacct cgtcttcctg ctaggcggac acggacaacg cgtacagctc gaccgaccat
     1081 cggcgggcga ggccgaagcc agaggactcc taccacgatt tcacctcaag ccacgcacag
     1141 acactaacca cattcctccc ctatgtgaac ccacccccgg ggggttttac gaggcccgga
     1201 tcacctcaga tctacctcat acgaacacaa cacacacttc aaacacgcac gaacaacaca
     1261 cacaacccga acacagcccc taccaagaca tgcgaccaga ctcggaaaca gaggaagata
     1321 gcgacacaga cggctcccat gcatacatgg aactgataga agaccaagac gaagacgtgc
     1381 tgctggaccc cgacacgttc tacgacgaaa cgccgacaga agaacacgag acaaacaaca
     1441 ccagggaacg ccgcctagca accagcggac aaggggacgg actatgggga acgccgctac
     1501 accgccatga gacacacagc aacgaccacg aacgcctcag gggatggcgg tgggcgagaa
     1561 gaggagaacg cggagcgtgg atgcccgcgg aaaccttcac ttgcccacaa ggtcgcagac
     1621 cctggtaacc caaacgtcaa taaagatact ttttttcctg ctacacgatg actcatgtcg
     1681 tctttcagtc cctgctttgt tgacttagct aacgcgactc catccggtcc cctcccctcg
     1741 cgttcctccc gcgaccgcat gactcacgcg ataactaaac acacacagac caaaaaaaac
     1801 cacacacacg caggtattat tcagttcaat gatactgcat gcaaacttct attttattgc
     1861 taacagctac ctactaataa agaaagagaa agcgtatatc ggagatatta agcagaacga
     1921 ataatccgtg cgaccgagct tgtgcttctt tatctgcgag gaggcaaata tgaaaaaaca
     1981 ggaacgagag gaaccgaggt ctgggaagga cggatagaat aatagcgcat tttccataca
     2041 gaggttgtta tttttgtgga tcctaagagg tttcaagtgc aattctcaat gttctcacgc
     2101 gagaagagag agaaatggtt ctatgcgagg tacatcaaag tttacttttt caaatagcga
     2161 gatgtcatga cgggagagtg tcttcagtgc agagctgtct tgattcctat atccgagtat
     2221 ctattttctt ttgtacggac agtcgccgtc gtccgcgatg acgatggtac ggacgggata
     2281 gagtaaaaga gagtattctt ctttcatgcg agtacatctc cacggtgtat tattcttttc
     2341 cgggctgtct ctaaggtgta ctttgatgct ggagttttcg ctgtgttgat gtgaataaat
     2401 actatgcaaa aaaagtgatt atgcgattat gccgagacaa gattgcattg gctgaactgt
     2461 ttcaaacgct tgaacttatc aataaaccta tatgtccaat ttctatctga gtcttttcat
     2521 gtaaatggtg atacgtgcga tcgaaaatgt attccatgtt tccatccttt catttcaact
     2581 tttaggttgc ttcgagagcg aagaagtgcg aggattgaag gtttcagtgt tttttttccc
     2641 tatccttttt gtagtcttca gcgtcttcat ccttatttag gatatttcca ttgtcattat
     2701 catctccccg gaacgccact cgtgcgggag cgccgtcacc gcctcgctgg ctggctgctg
     2761 ctactgcaaa gggacgacgg aggtgaagga tgcgtggggt tccacgttat acgtcataca
     2821 caaaaatcag gcgggagtaa ccagaaaaat tgaaaaaaca acaaaaaagc cgacggcaga
     2881 agcaatatca tctgtatttt accttctttt ttctataacc atatatacac atactatcat
     2941 gaaaagccgg ggtcggcagt ccaacgttgc tgtaatgggt gccacggaga tgagcaaaaa
     3001 gaatgataat tgaacaagag gaaaaaatga ttcttcatcg tcgttgttgg gatcaccata
     3061 agctctatga tgatgctgaa tgcgtgatgg ttccgagttt tgttttgtgt ttttttcttt
     3121 ccttctgatg ctggacggta gagagagaat aaaaataaat tcatcataaa aataacagga
     3181 tggcacgctg cgtggcgaca agggcaacag caacccgagc ggtgtgtgcg tgttcggtga
     3241 ttgttgtagt ttgtcggaac cgtttcatct tctcttttct tgagttcgat gatgtttctc
     3301 gatattcttg tttggtgtct gtttctctta taactgtcag ttttattctt ccctttttct
     3361 ttctttcgtc aacttgattt ctgcttttct ttgggtttct cgcccgacgc cggcatccgg
     3421 ggatggggcc actcagaccc ccgccatgcc gacgccgagg gcacaggctg cttcttcttg
     3481 tagtcgtgtg gttgtcctcg atcttgaatg cggatcaagt taaaaagact aaggaataat
     3541 aatagtgcta gttgtctttt aatattaagt agtagtagtt ttgataataa attcattatt
     3601 tacgtgagat tcttgcatgt ttatcgaagg atgttgttgt tctctagcgt gccacggccg
     3661 ccgccgtctg cctcggcggc cgggaccctc gtcggatgct gacgcgggat ataaaagggc
     3721 ggaggaagga aaagaaaaat atgtacaagg cgacatcgcg ccgggatgga gcgagccctg
     3781 atgttgctgc tttagttatg agtggagcac ccgtgactcc taattccaag atgatttaaa
     3841 aacctggatg aggaagatgg tgttcagatt tgtttttgga aaaaaagaat atttttgctg
     3901 cgggcttgag tgcacccgga acgatgtttg ttcgatcgtt atttatgtct ctgtatagct
     3961 tgtttcattc ttctgactct tcttttatta cacgcggagg ggaaggatca gcaaaaaaat
     4021 aaagaggtgg gtcaaaaaag aaccgataaa atgaaatcca aaaacgggaa tatgaaatct
     4081 tacccgaggg cgaaccaaat tcaaagaaaa aagtgaaagg ggaaggaata gggtgggata
     4141 cgggagcggg ccggcggctc tccccttccc caggaccagc ctacgaggaa ggggacatgg
     4201 gagccaggtg aaaggaaagg gggtttgaag ccggccccgg gaggaggacc gagacgggga
     4261 ggaggacgag aaggacggcg gagccgacga gcgacgccga acgacgacaa ggcagaggga
     4321 cggccggggg ctcgaccgtc catgcctggc gccaccgccg ccggcggttc gctcatcgcg
     4381 gcccgcgtcc cgctcgctca ctcacccgct cgtggacctc ctcctcccgg ctttcgcgac
     4441 tcccggagaa cgcccgaggc gatctgaagg caccgcctgc ggcccccgat cttttatcgt
     4501 cctcccccgt ccgggccccg atgagtaagc ggaaaaacgg cgatcacgcg cagggtcccc
     4561 ggggagtcac tacggccggg gcacacgccg gcctccggtt tgctaacggg ccgcgcgggg
     4621 gaacatgacc tcacccgctc cgtcggcttt cctgccaccc cacccatcgt ccgctaggtc
     4681 ccgccggcga cgtcgcgcgg tcccccccgt cccgtcccga aacagtcaag agacacacac
     4741 aaaacacacg ggccgacacc gggttgaact gtgattaaag ctttcatcag gtttattttg
     4801 gctgctgcta gtcttttgct tcaaaaatct gagactggat aaatacgtat catcaacaaa
     4861 cgggataata ggaagaagtt ctgagccccc cagggagaga caaaagaatc gaaaaattta
     4921 caaaaatatc ataacaggag aaagaggata tctggtgtat actgaaatgc tgctggttca
     4981 taaaggtact taatgatgct attacatcaa gatggtctta ttcgctggtt cctaagatca
     5041 tgatgtttct gttacgatgg ttgactggtt catgagattc tgctgttaag tatgatggtt
     5101 tcgctggttc attctaagat tgtactgtgt ttgcgatggt cgtcgtctct tgctggcatc
     5161 tctcggctgc ttagtgtttt cttggtacaa aaaatagtga tttctaaagc atgattcttt
     5221 ttaaatgtcc gataccgcgg tgtcgaacag gaagagaagt ttctcggggt cggttctctg
     5281 tctgctgtcg acgggtcaga ggtaacggcg acagtggtcg taacggtcgt ggtagtgtaa
     5341 tgtagtagta gtccatgatc atcttcaaaa ctcttttgtg tcttgtgaca tccgaagaaa
     5401 acgtatcaaa aaggtatcta ggtgtagcag gtatcaaaag aatcgtgata taaaaaagct
     5461 gtcgagaagt acaaacaata ataaattacc ccgttccccc cttagatctg gccgtctcgg
     5521 caggagtagc agcagcgacg gtgacggcag ccggcgcggc cgccgccatc gttgttccgt
     5581 ccgtcgctgt catcaccggc cgtgtattcc ttcaccaccc agagccacat gaggatcccg
     5641 tcgcgggaac ggacccacat ggcggcggag ggtggggggt cgagacacgg gcgcccgtcc
     5701 gcggggaacg ggcgccgtca ccggggttat gtgtacggcc cgggcacggc gcgtgtcatg
     5761 gtcatgacga gaaagatgac gggatgacgg acggcctcat gagaggagta cggcctccga
     5821 gacctagggg tggtgccggg tcccggcgac cggggccctt ttatgcgatc cgggcgcggg
     5881 cacaggaaac gatgagtcag cggggagaga aggttcggga ggtccgcgtg acctgacgga
     5941 cccgagacac ttacgttttg ctaagcgcat ctcatccgaa cacgacgccg atgcccacgc
     6001 tatcgccgtc cccgtcgtcg tcttcgtcat cgctgtcgtc gtcgtaccac tcgctctcgg
     6061 gcggtagcgg gtcgacgaag ggaatgcgac ggccggtgcg gcggcgttcc gccacggcta
     6121 tctggttgtg atagttcagg aacagcacca gaagccccag gaagagcagc aacccctggc
     6181 ggggccaggc gcagaacgag acgatctgcg gcaagtgact gtgcggcatg acggcggtcc
     6241 gaatggagac cggcgctccc gcggacgccg agactataga aagatgacgt aggtgaagat
     6301 ccacagagcg acggccagtc cggtgataat gatcatgaga ctgaggataa cgcgcgccag
     6361 atccggatcc cagaggggcc ggtcggggtc gcggaggggc gccgcagcta ccgcggcggc
     6421 gacgggtctt gccgcctcgg gacgctcatt gacggtcatg acggccgaga aacaccggca
     6481 cgaccagggc atggcgtggg atcgtgagag tgtgacggtg ttttgagtta gagctagcgg
     6541 gtaccggaag cttttcacgg actactacac cgagttccag ggtaacgtag ggtaaaggga
     6601 tcagagtgat ggggcgcggg gccaagtaac gtgtacggtg cttgtgtgac acggtgtttt
     6661 aatatgaggt acgtgactct gtgttccact ttgcttctac tagcaatagg cgctacggcg
     6721 atccacaacg atgtttgcac ttctctggac gggcaaacac ggctactgtg taaatgtaac
     6781 aggtggaata acaatagcaa tcctaaaccc acagctacaa gtggcactca catcacatgt
     6841 ctcgctaact gcacctgcaa aagatacaca gagcccctgc cgctcatttc cgtgttaggc
     6901 atctactcgg cctggggcgc gggttccttc atcgccacac tgatcatcct gctggtcatc
     6961 ttcttcgtca tctactcgcg ggaaagaccg gcagacgacg ataatggaac ggtagaagat
     7021 cctttcctgg cttaccgcga cctaacgcga aagaaactgg acagccacgc cagtaaaaag
     7081 caaaacatct acgagcggat tccataccgc ccatgtcgac aactcaggga cgacgagccg
     7141 ccgctaatca caaacgcgga ggacgacgac gaggaagagg acaacttttg atccggacat
     7201 catgaagcgg gacgccctca cgctgaagta cgtcgtctcc acggcgttct gcatactatc
     7261 atccgcgaaa cctaccccaa ccacggacgc actaggcccc ctacgattac gcgacaccta
     7321 caccacctgc gaaacgagga acaggaccct ggcctcgcgg ctcaacacca caggtcactc
     7381 cgtctcctgg gtacgttacg ccctgcccgg ccacaaaccc acgcaaacga tgcccctgtg
     7441 ttccatcacg gacgcggcgc acagcaccac gcgggacgtg cgaaaagccc gtttcatctg
     7501 cacgcgacat tcgatgacgc tgtataatgt gacggtggaa gacatgggta tgtacgtgct
     7561 aacggacgaa tacaccggtg acgcggaatc cttctacttc ttcatatttt ccagagccgt
     7621 gtgcgaagcc tatgctacgc gctgcgcctt ctggaaatac ctggacaata gatgccagac
     7681 gctgaagccg gcgggcacga acccgccccc caacgattta agggactggt ggttaaacat
     7741 ctcgatccat tgcgcctgga tcgccggact gctgatcatt gtggcttcgc tagtgggatt
     7801 tttgctgaga ttacggcgtg tcggggtgca gaacgcctac cgaagactat cgaatcgcga
     7861 tacagagcct ctgttgcagt tcgacgcata ttcggagtga gtacaaaggg acttaaactg
     7921 atacacagtg tgaagatcat gtctgaaacc tgctctgttg caactacgtt attgttagtg
     7981 ctagctctat cacaactaac tgaagaagat aataccacca attcttctgt taacacatcc
     8041 acaaatgata gtaatatatc attcactacc acatctagtc ctaaagcaac atctacatct
     8101 ccaacaccat cattcactcc taatctgaca accagcaccg aatatctaaa ttctacggta
     8161 aacagtacac acactccaac attaactacc acgttaccca caagcaccac atcaacacat
     8221 tctttccaaa atactaccat aactgagtat agcacaactt acaatctatg taacaccacg
     8281 gaaaccgtca gcagcaactc tacagaaagt attaccgcaa catcatcgtg caatacagca
     8341 aatacaacat ttgacaatac tacaatatca acggccattc aaacaactac taccgaaatt
     8401 gttattaaag ctgtatggac cactgtacac ggcaaagaaa gtgaaaatgt aactttgcac
     8461 gtcaactcaa ccttccaaaa ctgcactcgc acagtttgga accatcctta caatatcaca
     8521 atccacaaaa tgaggaaaga aaataagcca catacactct gcgaagccag ctctggacac
     8581 tccgtgaagc ataatcacca taaactatgt ctgcaatgta caccaaaaaa cctaactttg
     8641 tttgacttga tggtaaatca ttctggaaaa tacatagcag aatgcgatga cggtcaaaat
     8701 catgctcaac aaggctttat actaacggta aatgccaccc acataaccaa ttacactaga
     8761 gtttgtcaac cggataaaga tacagttacc accagaccca ttagtacgca cttgtttaac
     8821 caaaattact cgtatcaagg acactatcca ggagcttctg ccaattcaca ccgcggtgct
     8881 atggctgtcg gactattcct tatggcatgc gtgctcttat tcttcgctag acgtgtatac
     8941 aagaaaaaat accgtccatt gagagacgac gttagtgaat ccgaattcgt ggtaaggtat
     9001 acgccagaac acgaagacta acgtttccgg acagaggatg ataaggagca agagaaatct
     9061 atctaacatg ggagtccaaa cacgtctgtg gctgcacgaa tgcccgtaca cgggagtaca
     9121 gcatggtcga tcacttcgcg attacttgga cgttggtgtt cttaacactg gcatcaggaa
     9181 cagtgacttc ttcatgtcat acgagtcact ccgtaagcag tactaccgtc gctactacta
     9241 gttcgactcc ctcagttaat acgacgaact ctgccgatac gagtaacacg tccaccacag
     9301 aaagcagtac tacttctata acatctacat cgaatacaac ttctacgagt ctcactactg
     9361 ggacatctgc cgtttcttcc gcctcaacca catcaaaacc aacaacgcca tctaccacta
     9421 ttcagagcac taccactact aagaccacca ccgtcatcac tagcacctct acagtacctg
     9481 cgagtcccac taacactaca aaatttgaat gtgataccgc aacaactaag acgtggatta
     9541 atatcacagc gaaagttggt gacaatgtaa cgtttccagc ctgtaatacg agcggcaaat
     9601 accataccgc cagatggact aaggtggtaa atacaaaaga aacagaccta tgcctctttg
     9661 ggccggatta ttactccacg tcaccacaag ccggtatatg tttcaaatgt cattggcaga
     9721 gtatgactat ttatgatgtg acgaccgaga atgctggaaa ttatatcgtc agagttcatg
     9781 gtgatggcaa tcaccattat gataaaggtt accgtttaca agtgacgtcc aaccacacca
     9841 cgggaacgaa ccgaaaaaaa tgtcccaatg acttcacttc gtacactcca gatcatgaca
     9901 aaaacaaaga gacgaaaacc attgaaaatg aatttggaat gaactatgat caacctactt
     9961 ttcctatggg tatgcatgcc atctgggcgg cagtggtagt gatcgtagca ttactggcat
    10021 tgtacatggg cagccgcagc agcgtgacca ttgtcaaggg cggcaaaccg cgctacaaga
    10081 agctatctaa caaggatccg gacgagtatt gggcctctcc ctagcgcgcg tcagtgtcta
    10141 tgtataataa agatatattt tgtcccagaa aaagtctccc gatgtgattt tattgtcctg
    10201 tacatacacc gttttaatga cacggggagg ggggaaggac agacacgaaa agtcctcaga
    10261 agaagttgtc acgcaggagt ttgatccaca tcagaaccca gacgaccacc gtcacgtaga
    10321 atattccccg caacacccgg aaactataat aagcgtgcga ggcgttgaag ctaccgaacg
    10381 acggtagatc gagatcctca actataagga tggataccgc gtcgccccgc atctcaaaaa
    10441 ccgcgtgtcg gcggttgtcc gcggcacgtg cgttttcgaa ctcggggacg gggataacgg
    10501 agcatgcgcc ggcggggatg gcgtggcccc ccaggcggcg cgacattcaa gtatggactg
    10561 ctagtggtgc tgacgtcgtg ggtgtcagta atcggcggca tccactacgg ggcttacgat
    10621 caccacgtag acaggagggt gattaagtcc ggggataacg taacgttgac gtccccgttc
    10681 taccacctgg ggtccaactt ctggtacaaa cgcaacgcca ccggcacgta ccccgtgtgt
    10741 tactccgtca agacaatata cacgtttccg gtggacgtac gggtggagtg taagcaccac
    10801 atgaacatca cgatcttcaa tttcaccgaa gacggctggg gcatctactc tctggtgacc
    10861 gagagcccgt tcctgaacga taataagcac tataccgcgg agttctacgt aacgatcgac
    10921 acgcgtaaca acggcacgga ggaagaactg gactacgact atgatgacta tgggtcaggt
    10981 ttcggatcag gtttgggatt ggagtcgtct ggattaggat tggagtctgg atcaggaaac
    11041 gaggaaacgt cagggtccgg agatgaaata caaaacgggt tcctaattac ttactaagta
    11101 gggtgtcaca tgggacacat gcgggtataa ataaaacccg agccaccaaa atagtaccac
    11161 acacctcagc tacaacagca gccgaggatg atcccggtga ggcagcacct gtcttcagag
    11221 ccgtcgcgcc tcacgtccac gtacatacca ccgtgaacga tgacggcgaa cgtcgagccc
    11281 gcgttggggc atatcacgct actgtacagc tctgcactaa gcactttata ctctcaccgg
    11341 cacgttcgac gtcgcttcca caccgtctaa tcacgtaacc cgcccacgcc atgtgtctac
    11401 tacaaccccg tcaccatgag cctatatagt ttcttctgaa tgttgagcgt catcgtaccg
    11461 acgccgacat gtttctaggc tactcgtacg actttatgcg attcggcttc gctctatgtc
    11521 gcgcacccgg gcattaccag acgtctgtga ctactcttgt tctcctcaca tgtgctgttt
    11581 cgtcttccct caccgcaagc acctccgcgg cccgcgggtc cactggcggg tatcgcaatc
    11641 tcacccaacg cgccaaccta tcgtcgcccg ataccccgac tacaagtacc ctgcccagac
    11701 agatagctgc accaccggct cattcctcgt ccggcctctt cgagcagttc taccacggtt
    11761 tggccatcca cgccgcctgg gtgactgcct tcgtcctcgt ggggttcctg attttcttcg
    11821 ccaacgtctt ccatgtgcca cagaccatcc acggctggta tcgggacctg cgagatcacc
    11881 gcacgctctt cggccgcaga tatcaacgcc ttgtcaacag ttagctagtg ttttgtgtta
    11941 gcgccgcttt gacgccgtgt tttgtgtgta tcccaagtca gagagcctga aactcggggg
    12001 gagggagctg tatctgtgta ccgcatgctt cgaagggagg ggaacgctcg ggactctttg
    12061 cggtaactgt ttgaagacac gctcacacac ctctattaat cggacactcg ggtatttttg
    12121 tgtataatca tgccgccgcc gcgctccttc gggtgcggcg gccttaataa agtgtggatt
    12181 tgtagctgcc tactgatcct ggtcttggtg gtttgcgcgc cgcggggttc tcctcactgg
    12241 agtcgggttc gacggcagac ctcactctcg ctgccgagct gcagtccggt gaactgcacg
    12301 gtcggtggag acgtctccct gaactccacc atacccgtcg cgtgcaactc cacggagtgg
    12361 ggccgctact ataacagcag cttctgggtg ccgttgtgcc aactatgggg cggtcatatg
    12421 aggctgtcgg ggcagaatct gcgtctatcg ctgacctgct cgcggcaaca cctgacgctg
    12481 catagtacct ctgacgggta tacgggtacg tactatcagg tgggaaataa ctgtcctcat
    12541 caccacgaga tcatgaagac gtgtttcaac ctcaccgtgc tggccaaacc gaccaccacg
    12601 gcggcaccca ccacgaccag cgtacctacc ccgacgctga ttttgactac ccgaaacacc
    12661 gtgatagtgg gcgtgtcttt cccggctaac accgtactga gcagtacgtg gaccacgacc
    12721 gcgggtaacg cgagcgttgc caacggtatg ttctatcggc agtaccaacc attgtcgttg
    12781 gcccagacgc accgaaccgc tccgcttaac gccaccgaca atgccgaaga cgtggccaac
    12841 ctggtggcca cctacgccag ttgggggctc gtgttgttat tactcgccac cgtgttggtg
    12901 cttttcgacc tgggactacc acagacagcc tggcgctggt ggcgggacca gggccgggag
    12961 gagcaacatc tgctgctgta agggggaggg aaaatggtcg ggggagactg tttgaacgtg
    13021 acttttttat aaccgcaacg tcgcaaatac gatggccgcc gaccctcata cgacgctgtc
    13081 gatgttgtct ggtttatgca ataaagcact ctggctctcc atctgcctgc ttatcgtcgc
    13141 gtttcttctc gcgtcatcat caacaacgac tatggtgtac gtctcaggac ctcccggacg
    13201 gccgctgtca ctgcacgcca acttcaccca ggacgacgac gtacactggt accgcctgaa
    13261 agggaacgag acggtatcgc tgtgtagctg tatggtgggt gacggcgtct tcatagccag
    13321 atccaacatg agcctgggct gcctgccgtg gcaactaatc ctgttcaaca tgacggtgaa
    13381 cgacgggggc ctgtactacg tgaacgggac taatggaact acgcgaacgt ctaccaccgt
    13441 gtggttcaac gtgacaatag gactacagtt cgctccgaaa acgacgaaac cgccgaagaa
    13501 aacgacaaat aagagagcta aactctccga gagaacgggc atgagcctgt tccgctacgc
    13561 gcgcgacttg gattcggtgc gcagaaagga cgacgacaac aatatccacc tgggtctggt
    13621 gggtgccggg ctcttcgtag ccctggtgat cgtgtgcctc atggggtggt tgaagatctt
    13681 gtgcacgcac tgaacagttt acggggaact agacaataaa acacagaaag ccccggtctg
    13741 tgtatatacg tggtattttg ataagaatac cgtatgaatt tcacagggag ggattgtgat
    13801 gaatgtgacc ggtcaacccc cctcttcccc tccgtttccg gggccgtcgg aaagcacctg
    13861 gaatgtgacg accggagggg aggatggggg tgaacgttct gtcacgacca cgaccgtagc
    13921 ggtctcgacg agaccgacga ccttgagcgg taagacaaat gccagtacga gcacggcgac
    13981 aagtaccgcg cccgtgacta cgacgaggac gactacgaga gtacggacaa cgcgtacaaa
    14041 tagcacgagc ggtgtaacca cgaggacgac gacgactacg gtccgtccgc agccggattg
    14101 cttgctcaga acacagctat cgtaccacca caccgtacaa gcgcaacctc agaagatcgc
    14161 cgttcactac acttggctga tactgctgat cttatttatc gttctagtga tactgttttg
    14221 cctacgtatc ccacagaaac tgtacgataa gtggcggaac aggcgtcggt acgggcaagt
    14281 atacgtggta gacacggaac tgtgaccagt ccggttaatc atagtaatgt tttatacctt
    14341 ttctgtatta acttatgtgt gtaataaatt gcacgaagta ccacgagagg tagaatgtaa
    14401 taaggttacg ggatacatcg gtcaaaatgt tagtctaaag tccattaccc atgtctggag
    14461 caactccacg tggtctgtac atacggtatc tagcctgtat atgatgtgtg aacgggaatc
    14521 taatgatgcc ccttttaatt tttacaatgt caccgatatt caatttaact gtacagaaga
    14581 agagttactg cttctggagc ttacgacgca atataccgcg gtgtactact atagaggata
    14641 cgatacagta ccacggcctt gtatgctata tagcacatgc tacaatgtca ctgtgaaaaa
    14701 ccgtacctat gaagcggaaa aacatacatt tgcttctagc atctggattc caccggtagc
    14761 tgtagtgacg ttgatcattt tgttatcagt tatcaaaatt cctcaaagaa tatgggaaga
    14821 atggatgcag tacaggtaca gggatacagt ttatacctag agcggtaaca ggtgtctacg
    14881 gtgatttttt tttcactgtt tgactaacct aaacgaaaac atggctcggt gtacggtttc
    14941 gataccgata cctagattat gccgttcggc agttacatag tcaattgtgg ctttttgacc
    15001 tggttcgtct tgagtgctgt gttcaagtat gaattttccg aagcctgtga agaacataca
    15061 acgtacgaaa cacatcctct attgcttggt ggtaaaccat tactcggcgc gcatcaaaca
    15121 gcctactggt ataaacataa atgtgattcg atgacgtcta gtaacgacaa attgactcca
    15181 ctttgttact atccgccacg aaattccaag ggaaagttag acgaatcggc ggaaaatacc
    15241 ttcattaatt acttatgttc taacagcaca cttataatcg ctaggctgaa tctcacggat
    15301 gctggagaat attgcagaaa aaagaattcc acgagacacg attcatggcc cacgatgtcg
    15361 tgttatcgtg tgattgtgag accgatcacc aagaccacga gtaaaaaacc agagagcgga
    15421 ccaacacggg taaaaaggac tacgtacgat aactatagtg tgacactgtt ggaagaacca
    15481 ttactcttcc agacgcatcg aagcactcag aatgcacata tcgcctggct cttcattgct
    15541 gtcgttatta tcgtggtcat tatcttgttt ttctttaaga tacctcagaa actctttgat
    15601 aaatggaagt tgcataaatc gtacgcgaaa accggccact tcagcgcgtt tcattgaata
    15661 ctacaacgga cgcttagttt cgttttcaaa gtcactgttt gaagaccgaa gatgtattgg
    15721 caacacctga tagcatgtcg caatcacacc gtgtacgatg tgccatcggc gcctggaatg
    15781 gttctgcaaa acgtcgttct acgcggcgat gatatgcgtc ttcgtaacaa gcacggatct
    15841 ccagaacgcg tgtgtagaag aaaaagcccg acaaggcagt aatgtgactt ttgatgcgat
    15901 acgatattcc ggtaagaacc agtccacgta ctggtttaga ggctcgcggt acaatgctga
    15961 tatgatgtgt aacttcacgg gtaacttgac agtacattct acagaaatac gcctaaacta
    16021 tacctgtcag agaaatttta gtctcacgct cattaacgtt acgagcgagt atagtaacaa
    16081 gtactatacc agaacgacag tacgttccac tagtactaat tcgtggagtt ttgacacatg
    16141 ttttaaactt acggttacca tcgttaaacc gccaaagcct aagaggacga ctactctaaa
    16201 gaggccacaa gagccggtaa ctaagcctaa aacgacgtac gtcgacaggt actacgacgg
    16261 tttcggagcc acaatagcgg tcagtccggg aatagtcagt tcgcaacgac aaagcgctac
    16321 gaccatctcc atctggatct gtctgatttc gatcgtggtt atcgtcgtca ttctcttcta
    16381 ctttcgaatt ccacagaagc tgctgctccc cttcatgtgt ccgcgtccta aggacgagac
    16441 tctgatgata ccgcagaccg aattgtaacc gcgggtccta ggaaatgacc gcaggaaatc
    16501 cccggcgaca gtcgactcag cgcgagtcac cgtgacgggg gcgtctggcc accatatttg
    16561 aagctccacg ggctttttaa gcgagaaagc tgcgcctgcg aggcgaccgg ggaggacgga
    16621 ggatggtggt ggtgtccaga ggcctgactt cttactatct catcccgctg ctgctctgca
    16681 aagtcccacc gctcctcctg acctggcccg actcggccca cggcctggac atcgtcgacg
    16741 aggaactctc gcacgactac gaggagatct ccgtggtgcg cttcgccatg cagcaggtcg
    16801 gttttcagat gctgccggcg cccattatgg ggcgcagatc cgagatcgat gaggaccgac
    16861 cgtcctcgcc ggcgcaggcg gacgtctacg acgtgcgttc cccgcggccg cctcgacccc
    16921 ctcggccgcg cctccaatca ccgtatcatc accaggaacg accgccgtta ccgtcgggga
    16981 ttcgctggca gcacgaagag ctgcagtttc tgctgcagta tcgacagcag gagctgctgc
    17041 aacagcggga agaggagcga cgacaacggc agcaccagca gcgccgacga taccgctggc
    17101 ggcgacccac gttcccgcca ccggacccgc cgtcgtaccc ggcgaggtcg tcgatcctgc
    17161 cggcgcgctt cgcccgaccc tccctggcca acggggccga acaattaaac gcacgtcggg
    17221 gctatggcga gagaagagcg tcgccgtcgc gcggtatggc aagcgagccg gcgtcttcgg
    17281 tggaagagga gcagtatcgg cgtgtcgtgg gtaacgtgac gcgacggaga catcatcccc
    17341 agcaccgttc ttacagacgg cgcaacgcgc tggtggccaa cggccgagac tcgttgctac
    17401 tggcgcgact taggatcaat caccaacgcc agacccgttt cacaggttat cgctgccgtt
    17461 acttcggcag aaaccgcggc agcgctcgga ggagagacga cggcaccggt agcggcgccg
    17521 ccggtcacgg cggttcccgg cccggcggcg cgggattcag ccagttgcgc gaacgcatcg
    17581 tcaccgatct gcagctgttc cgccttcgtt gccacggctg gacgcgccag gcgtcgcggc
    17641 gtatacgaac ccgctgggag gaagagaaca ccgtgatgag cgatgcggcc tccagactgc
    17701 gggcgtggtt ctcgcggagg accacatact ggcaacgcac gtgggtgccg ggggagaacc
    17761 cgtcggccga ggccggggaa ctggccgtac cgccggcggc ggacggtcag gtgaaggaaa
    17821 catcgcaaca gtctatgaca gtcacgacag aaggagaaag ggaacagaaa actgagcagc
    17881 gtgtggagaa ggcagccaag gggggagagg aaacgataga gaaggtggag acagacgaga
    17941 cgagagtggc agaggagacg aaggtagtag aggaggtgca agtggtggag gaagaagaga
    18001 acgtggtagt agaggagaca ggaagagaag agagagatcg ggacgaggac gctatgatta
    18061 tcccgtgggg ggaatggtgg gacgaggacc tgttatcgga cctggagacg acggccgcgg
    18121 ggacggagga ggtagcggtg gaaaaagagg aagagacaac aaaaggagca gatgctgaca
    18181 cgacgacggt gaccgcttcg gaaaccacag acgatgtgat tcaaacaaat gaactaccgt
    18241 gtgaactcaa taacgccgag gagatctcct cgggacgagc ggtggtgggg acctgcccgc
    18301 gacgggaggg cccgcaccgc agtttctttc gcctgtgctt gggactgtgg gcctcgagcc
    18361 atctggctcg tagggcgatt tcggtttcct aacgaatcaa tgatgaactg gtatgtgggg
    18421 ggagagattc gggtggtttg ttattagcct cggtgatggg gaacacagaa gaagttctat
    18481 atctaggcac actctaaaaa aaaaaaagca cacgcttgct ggcatgtccc tcgtaataaa
    18541 gaacaaaact actgtattcc acccgggttt ctggatcttt ctctgcggtc ggggcggtca
    18601 atagggcctt tgtgtaccca aggggccacg tgtcgacgcg actcaagcat atatacacgg
    18661 ctcggggagc aaggtgtgac tgtggtcgtg tgtggtgtct ctggtctggg gtttcgccat
    18721 ggccggcgcg atccggctgt ggctgccgct ggcggcggcg atcgtggcgg cggtggcgcc
    18781 gacgggtcgc tgctgcgacg gctggtgccc cccgccgata ctgcgttcgc cctgcctgca
    18841 gatgctgagc gaccgcaacc gcgagaggcg gctgtcgtca cctaaaatgc tgccgtacgg
    18901 cgaccgcctg gacgtgtcgt gcatcttccc ctcgcacgcc tggcccgagg tttcgattca
    18961 cgtccgcctg tgctactggc ccgagatcgt tcgttccctg gtggtggacg cccacagcgg
    19021 ccagctgttg cacaacgatg tgacgtgcca gatatcgagc ggacgctgga gcttcgagga
    19081 cggcggcgcg gcgcagacgc tgacgctgtc gttccgcttg atcacccaga cggccggcac
    19141 gtaccactgc gtgctcggca acgagaccca cggcgtggtg accgagagca cggcgctggt
    19201 ggccgacgtg cacgagctgc agaagacgga tcgctcgtgc gacctggctt tcggctcgcg
    19261 cacgcaaacc aagtacctgt ggacgcccga tcccagcaag ttacgtagcc gagattgcgg
    19321 ttgggagggt gaacgtcatc gcttggttca ctatatcccg gggagctccg gcgaggagcc
    19381 ctcgtgcgag gagaacgagc accaattgtg cgtgcccttc atctggaaga gcctcgccga
    19441 caacaactgc agccggcagg accgggaaga cgaagaggag gacgacgagg acccctcctc
    19501 taccgccgca aagcggcagc cttcttcctc tcagctgtcg cgggactact ggccctcgga
    19561 cccgaggatc ggggtcttgg ccgcgtgctc ggtggtcttc accaccacgg tccacctgct
    19621 gtgctactgg tgttccaagt cgtatcgacg cctgacggac gagggagaag aggcgttata
    19681 tagacggcag gtggcgccag agaccgagga atctgacagg ccaggccggg acaagggcga
    19741 tgagaagagt gatccgtcgt cacaccttaa agacgagtga tcaacaacta cctcatgctg
    19801 catacccagg ttcaccacaa gatggcgagc gccgtcgcag ttctggcctc ctatcgtctc
    19861 ctcccttctc cggcagcggc gggtactcga ttctagataa gaaaacaatc atcatcacga
    19921 caacggcgtg cgggagcggc tggtggtcct ggacgccgca gcagaaggcg gaagcctacc
    19981 tgtggctcat gttactggtt ttgggactgt gttcgtggct ggcggcgtgg attcacgcat
    20041 attaaaaaga gatttacctg ctgaaaccct tttgtgtgta tggtgtggtt ttttatttcg
    20101 ggggtctaga ccgcgttgac gtaggacgtg atctcaagga gacgctaagt acttaggaag
    20161 agaccgcaca gcgcatcgcg gctcagcatg gcgaaggaca gagggagcgt tcccatgatg
    20221 ggaatcgcgt ggatcctttt cgtcggggga tgtttcgggt tgatagacct ggaaaagtac
    20281 tccaactgca cgtacaacgc cacggtcatg ggcgagagga acgtgacgga gacctggacc
    20341 tccacgggca tctgtctgtc catctgctac tactccaacg tgtccgacga cgaggtcctc
    20401 ggcgtggcct tcgtctcgca gtacaacgag tcgtataccg acgcatggct gtacaaaaac
    20461 ggcacggaga ttcgtaattt tacagtgatg cagtacaaca tcctacagaa cggcctccag
    20521 atgcgccacg taccctggac gaagctctac acacacagga taatcaacaa ccatacggcg
    20581 gggcgctacg actgcttcag atgcaagaac ggcacgctgg agatcgtgga gcgcacctac
    20641 gtgaagctgg gttcgctgta caagagcctg gaagagtacc gcatgatgag gcacccctcg
    20701 atgagcggcg aagaagacag cgaaccgccc gccaacctgg cgcgtgacgt gatgatcgtc
    20761 agcggactga ccctcctgtt ctttctgttg ggcatgcgga ttccgcagag actcttccag
    20821 cgcttgaagt tgcgcttcat gttccagcga caacgactgc gggacggcga agagaaatga
    20881 agaagttccg tcgtgggaaa accacgtgta acgtgtacgc tataagaagg agcaggtccc
    20941 cggggaccgg tctcaatcgc acgcgggtcg gagcgaaagg aaaccacgcc gtcgtcgata
    21001 ccgtccggac atggagtacg cgctgttcga ccactttatc ggtaggtctc gggagaccca
    21061 actgacgctg ttgtttcccg atgaaaccgt cggtactacc actcactata ccccgctgcg
    21121 ccaatggaga gatagaccgt tgcctccgct gccgacgacc cgccagagat cccagagtac
    21181 cggcagtcgc cgatacttct ctttctggcg gggcctgtgc ctgttgctgc gaagactgtt
    21241 ctctcggcga aagagcgaca cagaacccct gctggcgagc cccacacagc aggacggaga
    21301 accgatgacg gaatgaacgg gagataagag aagtcgacga agactcgggg ccgccatgat
    21361 ggatcgcctc actatatatc ggacgctgtt tctgtacgat atactgttaa taaaacgtta
    21421 agatgtttgt aacgtgtgtg gtaacggtgt ctgtgtgtat ctggtgggaa gtgcttaccg
    21481 aggggatgca caccctaaat taccggtata cagggatact tcataacgaa agtatggtgc
    21541 tgagtatcat gggctacttc gacgagcaga acttcatgtc gtactacgcg aacctaacca
    21601 acaacgtcac ggtcactcgt ataaacagca ccgtggactg gatgagaaat atcactgact
    21661 cctatcccac ctactgggac ggggagaaac acaaagccga tctcattttt aattatactc
    21721 agatgaacct gatagaactg ttcttccatc tgggtaatga aaatgaaaac gtactgacat
    21781 ggttccacga atgcaacacc accacgaacg gttcgttcag agagggttac gaagtcttcg
    21841 ggtgggacgg ttacaccatg atggaactga aaggtaacct atctcgatgg tcgaagccgg
    21901 ataacactca acgcaactgg gtgtataaaa aaaactccac ttacatggag ggtaagatca
    21961 agggcgtaac agagaatgac acaatgatac aaagaaatta cctcacgggt aattgtaccg
    22021 agtgggcaaa catctacggg gggcatcata cacccgtcac ccacccagaa gtcagagccg
    22081 gacgcagaca ccccaacgga gatatgatag gaatgttctg cacggcttac gggttctacc
    22141 caggggagat taatatcact tttgtgcgcc aggacgatgc gacactttct tttcataact
    22201 acgatgattt ggaacctgac aacggtccgg ttcttcctca ttcggatggg actttccaca
    22261 agggatcttc cctgactacg tttgacaact tcgtctacac ctgtgtcgta caccacggca
    22321 attggtcggt ggagctaccc atccgtgacg ttgaggaaga acatggcgtc caggctccta
    22381 ccttacctta caaggctacg gctatcagtg gggtcttgtt cgtggtcctg tgcgttttat
    22441 tggtcgtggc gttacactac ttgaccacgt tgaaacaata cctgcgtcgc ttggcgagcg
    22501 ggtggcgcta tcgcaaggtt tcagcgtcat gaccagcaac gctctatacg agttgtttcg
    22561 acgccggctc ccacgggctc ccgtcaacac ggtcatgttc ctgacgcgtc gcacccgtga
    22621 cggcccctgc ggtcgcctga cctccgttgc ccgggacacc caccgcacca tgtacgtctt
    22681 agaccacggg ttcgtacgca tcgagcgctc tcgtgacggg gatcaggatt gcaccagttt
    22741 cgtggacagc ctgaaacgtt gtcgcctacg caattctcac ctgacgttag acaaggaacc
    22801 tgacgtaact cctcgtgacg tagctatccg cgcgtgaagt gaccgcaata tgcgtcaata
    22861 gcaagtacaa tgcacctacg tgtattcacc gtcaccatgg acgtcaatta tacgcatata
    22921 cgacgtgtca tgacggtcct tataatcaga aacatcgttc cgtgtagtag accgctgaga
    22981 tggctcgggt gcacgtcgtg ctgctggggc tctgcgcctg gttgacggtg atagcggcat
    23041 ccgaggaggc caatgggacg catatcttcg tgtctcttct aactggggat ggtggattca
    23101 ctcgcactgc cataggaggc ctgaatctca ccatgaacta cactaacctg ctacaagcat
    23161 ggaacttcac gaaccataat caaaccaaca ataattccat ggtcaccacc agcaatctaa
    23221 cgagaacctg cgtgaaatac gatacaacct acgtgagtac catctggatc gttgattgca
    23281 ataacaattc cagcttctgg tacaagggaa atgcttataa tcactctgat gatactaaca
    23341 actgtagcag gtctgtgtcc gcgtacctgc aaaccatgtg ccagacgtgg cagaacttct
    23401 cccacggtaa cgtatccaat gttactcaga tggaatacga gacgcgttgt atgctcccaa
    23461 agaaatacag tgtgaacgcg accgccatct ggtacgggga ctactacggt gataatggtg
    23521 tacctaatga atttatggaa tacggcgaaa cgagcagcct catcacggtg acatgcagct
    23581 tcagcgaggc cgtgatgatc gacgaagttc gttactttgc ctttatcgca gaaatgtcct
    23641 tcatcggcat cacgggtttc acctgcctca tcaccacgat cgcggtattc ctcattctca
    23701 tctgctattg tcactgcaac cgactgttgg tgtgtccgcg cggcttccag atgctaaaag
    23761 agtacaccga ggaagaggaa cagagcgatc acagcgacaa cagttcccct actgaagagg
    23821 tgagcatctc catcccgggg aaaaccctga ccagcgagga cattcaggtg caggtaccca
    23881 tcaacccgcg ccgattgctg attccttggg tccggggcaa cagcgtatgg ggtcgaccgc
    23941 ctccgctgcc accgcgccct cctcacctgc gacgaccctc atcggtctcg cccgcagagg
    24001 tggtgtgcgt caccatctga tggacataga ctctcattca gagacataac actacggctt
    24061 tccatgaaag cacagagact gtacaaaatt ccactttttt tattgatgta tacatcatgt
    24121 aataaaatac aagcttgtat tttcttattt aaaaatgttc ccagttctct tcgcgtatca
    24181 cggggtactc gcggggcact cggaaaggag cgaagccggg cggcatgggc ggaacgtcgt
    24241 ccaacagcag caccagcggg ttgggcagcg ggcggtcggg cggtatatcg gcggcgacct
    24301 ggatctccct cggcaggtcc atcggtatcg cttcctcgtc ccctccgggc acagcgacga
    24361 tccgatgaat cggcggcggg acctgaaggt gctggtgatg ctgatggtag ttctcaaaaa
    24421 gccggcgccg ggcccgcgga gcatagaaag ccagacggcg caggggccgg cgggctcgga
    24481 acaggtccgc gcggaccacg ggcctcacac cctcggtggc caccgagaga tcggggtcgg
    24541 gactgcctcc catattgcgc actcatgatg attccaggca cggtacatta ctaaataccg
    24601 taaggcccct gacgtcgttc cacgtctaga acgcgtcacc tcaggggcga ggtgaaaacc
    24661 gcaggtgtct aaaccgctac gccgaaaacc tccatagaaa agcacgccgc cgtttcctaa
    24721 caccgggata cccatgactc agggtatgtc gtcaccccag gtatttaacg gcacaccccg
    24781 taacgcgaca tcaatcgacc cgcatccgtc gtcacgatga gccgaagagt gttgctttta
    24841 ggccttttgg ccgtcagtct ctgcgtggcg ctggccgcac ctcagaaaag gaagcgcagg
    24901 taagagaaaa tccgtttaga aacaggtaag agctatatta gacgtcgatg ctaacgggaa
    24961 tctcgtgtgt ttgcagcgtg gagaacgaag aacctgccgt cactaagaac ggtgatggca
    25021 taaccctcca aggtgagctc aaagaaacta gcgatggaga atatcctgac gacaacgaag
    25081 aagattatga tgtgctgatt gaaggcacga tgcccccaga gcccgtagag gagacaaata
    25141 atgagagccc acaagactcc gaaaaggaag acagcagcga gaagttcgag gaggtcaaga
    25201 cagaataaga acatgataac ccttcctgta atttacgaat aaactttagc tttctatata
    25261 aaccctatgc atctgtgtcc tttatcggcg agcgtcggac gcactgttgt tttcccatgg
    25321 cctgtgtaac tagccttcta gtgaaagtta ccgaaaacgc atttcactag aacgctggtt
    25381 cagaggctat gtgtgacttg gttcctcggc gccggacacc ctgctcccag acccgcgaaa
    25441 caaaaacaac acaccattca tttttgatat caaaaataaa aaggctttta ttctgtacac
    25501 aggtaaaaaa aatagaaaat atcttcgttg agattctcgg ttccgtatca tcaccgcctc
    25561 tcttcaggga gagcgacggc ggacgctgtt gtgcaggcgg ccgcggggac aggtgggctt
    25621 gttcatcctg cgcatcccct tggtaccgta aaacatgccg ttgtagtgat agcggagcat
    25681 accgtgtgtg gcgaactcca gcaggttgtc ggccacgatg caagccccct cgtggctggt
    25741 accgaacacg cgcatgtact cgtccacgaa aatgttcacg atgtgtccgg gcaccaccag
    25801 gcagcccagg ggctccacgc ggctgcagcc caccatcagc tgccagccgt acagttcgct
    25861 ccaggcgtac agttgggaca cggagacgcg aaccacgctg tgatcgccca ggacgatggt
    25921 ctgcccgctg tacatgttcc gccaggtggc aaaatccaag atgtgcttgc aggcggccag
    25981 ggtcttgagt ttggcgttct tgggcacctc gtcgggcacg gtgatgaagc cgcagcgccg
    26041 cagacccatg tgcagaaact cggtgaagca ctcggccacc caggtcagag aatcggagta
    26101 gatgtgatcg gtgtagagat agacggctcc ggagtcggcc aggtagagtt cggcgggccg
    26161 gctgcttccg cccttctttc ggagaaaacg gtaggtacag atgctgccaa cgaagcgcag
    26221 ccgctcgctg cagcacaggt atccggccag acgttcggct tccagcccct cgtcgcgcac
    26281 ggaacgccag cgctgctgca ccaccaggca ccggtctcga ggccaggcca gggccacgcg
    26341 ctgtccgcgc ttccagggcc ggctctccag gggaggcttc cagcggtcca gcacgctgta
    26401 gaagcagtct ctgatgtgat ccctcacgat gtgagccatc gtgaacgacg aagacggcca
    26461 ggtaaaacga cggatgaaga aaacgaggag aggagcgaac ggaggagaga aacgacgtcc
    26521 acggcggatc gagagagact gcttggcaca agaggcacgg agccaaggag cgtcgacgct
    26581 ttatgccagc gacggcgtca gggcgattgt gacattcaat ggtgctgacg tcctttgggg
    26641 caatcgggca cgcggtcgtg tacgccattg tgaccgctga agcgtcgatt ctcgaaaagc
    26701 aggttgagtc ccaggcacat gaacatgcag aggttatccc ccaggcggat gtactgctca
    26761 ctgcggatgt cgcaagcgta aactcccccg gtgtaagaga tgacgatggg gacgcgctcg
    26821 gggggccacc gcaggtatgg gaacggcgtc tgttcccctt tcaggttgac cgttcccaga
    26881 ccgatgacgc gcgaaccgaa gctctccttg atggcgcgga gcaggtgacc gccgtccacg
    26941 cagctttcga aacacttgag gttgcacaag cggagctccg cgcccggcgg gtacgtcagt
    27001 ggtaggagtt ccccgtgatt gcgaatgatg aagcgggcca cggcatcgaa accgaggctc
    27061 caggcgcggc gcaggggccg aaagtagcgt ttcaccagcg acgagcccag gtagcgcagg
    27121 cagtgcaggc tctcgacggc gcgcaggccg gtgcgggcga actccatgag gttgcgggct
    27181 atgaagtaga cggcgtcatc ttcgcgcacg tagcagaaca cgtagccgtc ttcggagacc
    27241 aggaaggcga tggtcttctt ctgctggtcg ggcgagagca cgggctcgcc gatgatgcgg
    27301 cccacgaagg ccaggcgggt ctcgcagcag aggtagtagc tccaggcctt gacgtcctcg
    27361 ggcttgaact cctcgtccac ctcgggctcc tggagcacca ggctccagcc ggggggccag
    27421 gccacgggga tctcgtggtt gttgttgatg cgcacgtagg cctccaggca gcccaggccg
    27481 aattcggccg tgagcgccag gctggccagg tccgtcatgt ggcggtcgga gaactccacg
    27541 gggggcgtgc ggcccgaggc gcccacggtg gcgtagacgg tctccaccgt cgtccgggcg
    27601 gtcgacgcgt cggactccga tgcggtctgc tctccgtcct cgactctcac tatataacgt
    27661 ccccgacccc cttccatcct tacccgcgca cgtgggacag acacacgagc gagcgcgcgg
    27721 agatcacgag gagagaaacc acaggagagt ggagaggcag aaagacagag gagaacgagc
    27781 gccgcgatgt cgtcccgacg gcgcagctcc tcgcgtcgaa atggggagca ctgcacggtg
    27841 atttatatcc cttccagcga cgaggacgtg ttcgtccagc cgcggtctcg taacggcacg
    27901 gaggacctcg accgcatgga ggcgggcttg tcctcttaca gcgcctcctc ggacaccaga
    27961 tcatccttcg agttcgtcaa ggaaaccgcg gtagaaacgc caggcggcgc tcacggccac
    28021 ggcggcagcg tgagcggcac ctcgctgtcc tcctccagca cgccgcgggg agcgggaccc
    28081 aacagaggcg ggggagagac aggagggggg aggacgacgg cggggaagcc gagcaggcgc
    28141 tcgcccaaga tcgaggcccg acccaccagc cttgccctgg cgacggcggc gaccatgccc
    28201 gcgacgccct cttcgggtcg catggccaag tcgcccaagg tatcgcaacc gcccagcttc
    28261 ccctcgctga cggaggaaga agacggcgcc gagaggaaca gcggcggcga tgacagcagc
    28321 cacaccgaca acgagagcag cggcagcgac cccggcgcgg cctgcggacc gccggtggcc
    28381 gatagcgagt tctccttctg cgacagcgac atcgaggact tcgagcacga gtgtcgccag
    28441 atcaacgcct ccgacaacct gggcttccac acctccgtgg tctcgcctca cgaggtggac
    28501 ttcataaagt tcgtgctgac cgagtcgagc ctgcagcacg tggcgagtat caacgcctgc
    28561 gtgcccatgc cggccttcgc cctggccagc ctggtggacc ccgtgttcag gaacgtgtcc
    28621 cccggcgagc gcgacctcac ccgctacgtg gtgctgcacg ccgtcttcat caactactat
    28681 taccaggccc tgggcaaggc gcggcacatg gacacggccc tagagaacac cctgcagagt
    28741 ccgaccgtgc gccagatggt ggcgcacgcc gacaaccaga cgcgcgcggg ccgcgccacc
    28801 gccctagcgc tgcactttct gcgctccgac aagcccgtca ccgacggcca gtacctggcg
    28861 tgtctgcggc gcctggacga cgagctgcgg cggcgcggca cggtcgagtc gcccaagctc
    28921 acggaggtct acgagacgct gcgcgactac aacgtgctct tctctatggc gcactatacc
    28981 acgcgcggcg ccctctacct ctaccgtcag aacctgcaga agctcaacga cgaccaccag
    29041 ggcgcgctca agctgctctc cggagagcag ttctccacgg accacacgct caacgacctg
    29101 gccttcctgg tgggcatcga gctcatggtg gcgcactttc gccgcaccat ccgcgcgctg
    29161 cgctgctaca tccagcacca gctgcagacc gtgtccgagc tggcctactt catctacctg
    29221 cagctgccct cgctgcgcaa cgagtacctg gagctcatgg agatcctcta ctgggcctcc
    29281 agccgcggcg acgaccagcc gctcttcatg agtacggggg cgctcttcga cttcctacgc
    29341 tacgtgcgca accaggacgc tttcatttgc accgactacg tgcgctgcgc cctgcgcctc
    29401 atggcctgcc ccgaccgcga ggccgaggag gacgacgacg aggacagtcc gggccccggt
    29461 gacagctaca accagcgcgt gggccagttc atgatccgcg accggctgct gcgggacccc
    29521 aaccactcgc gcccgcggga ccgcctgttg acccgcgatc tctgtctacc ccgcatgcag
    29581 gcgcgaccca cccaccgaca caccccggtg gagcacgtgt gtattcccaa cagcctgctg
    29641 accaagacct tcaccaaccc gcccccggag gaacgcgaag aagacacgct ccgggcgctg
    29701 gctctcaaag cctttatgga ccgagccgcc aatcactcgg aaccacagtc gcagcaccaa
    29761 caacatccct ccagtccccc gccgggcaac ggcgacagag cgagagcagg aggctcggga
    29821 cccagttcgc cttagacgac gagaacaagg acgactcgga agaagaggga gcgggattag
    29881 caggtagttt tatgatcatg aggctcaggc agaatcatat gatagtgtac agacgtgatg
    29941 atatacaaca actactacaa caaacgagca tagacaatga tgagaacgtg tgtctctctt
    30001 tgtttcgctc tctataccct gtggtgtgtc ttttttttct cggggttgtc gtcctcgcgg
    30061 tgggaaaaaa ggcattatta tctctgtggt acgtctcagt ctgtgccgtc cccgccggcc
    30121 gctcacggta gcagcgccga gggctggttg ccagcctcaa acatggcgtc ggtcagttcc
    30181 tgttgcctgt gtctgggcgt cacgcgttgt cgcatgagcg cgcggttgac gtagaaggcc
    30241 gactccgaga tcggccggcc gttggcgtcg cgctgcaggt ccgcgcggtt gccgtggcgc
    30301 agctgaccct ggcgggcgcg ctccacgtcg tcgaagtagc tcttcagcag accgcgctcc
    30361 agcaactgcg ccagcgagtc ggcggcgcgc accacaaagt tctccttgcc gatctcgtag
    30421 cacagtacgc tgccgtcgcc gcccacgccg accacgctgc ggtcccagct gaacatgtcc
    30481 aggcggccga gggtgccgat gacgcgcacc tgcccctccg tcaccaccag cagtttccag
    30541 taagccatgt cgcgcttggt gaggatggtg tcctccacct cgcagacgaa cagggtgtag
    30601 ccctcggggt agggcaggtc caagtgccgt ccgcgctgac ggtgcatgaa ctcgtctata
    30661 ttcaaaccgc caccggcggc gcgcctgctc gtcatggcgc ctattttccg cgcgatgacc
    30721 tcatgaggct tataacaacg cggcgccgcg ggctcatgtc gcgtgacctc cgacctcgtg
    30781 gggtcgaaaa cgtcgcacat agaggcgatc aaagcgctgg atgtgggcgc ggtagcgcac
    30841 cgagggcccg ccggcgaaac ccgcgaactc cacgggcgcc ttgcgacggc agcggttggc
    30901 gttgttgctc agttccgcgt ccgagagggc cgagctgaac tgcggcaggc gagagcggtc
    30961 ctggggcacg tcgccgtgcc gtaggtagtg ccaagccagg cgctcggcac gcagcagcag
    31021 ctgcggatcg ggatggggcg acgacggcgc cggcgaggac gcgttcgtgg tggtgggggg
    31081 tgggaggacc acgctgttgt tatggtgaga accggccaac agcgacgacg gcggcggccg
    31141 gtacacgcgg cgcaacttga acgtgtgcag gcagagcaac tcgcgcttga tgcgcagcga
    31201 gatgcaacgg tagtcgggga tgcggtggat cacgtcgaga aagtcgcaga aactctccac
    31261 gaagccgtcc accgtaaagc gaacgcgctt cagatcgtgg acgtgcttgc ggaaccgcga
    31321 cagttcccgg cgttgcacgg ggttctgcgc gagtcccttg cgcagcatcg cggcctcgcc
    31381 tttaaacagc ctgatgagcc gctgcacgtc gccggacagc atgcgtacac acgccgtttg
    31441 ttcgtgacgt atgctggcgt gcagcaggcg gatgatgcgc agcgccagca cggcgttaga
    31501 agccaggtac atcacgtaac cgcgtcgcgg gttggcacag gcccagcccg tgggcaagag
    31561 gaagtaatcg tccaccagcg tctgcgacca ctcggcgaag cccaggtcgc gggacacgct
    31621 ggcacggata cgggagatgt cgtccaccgt caggtggcgg atggccggta ggtggaaagc
    31681 gcccaggtgt cggttgttct ccaggcgcag ctcggcgttc tccaggtgaa agtggggcgg
    31741 cggcagcatg tgcgcgtgct gggacgccgc ggccaccgcc tccgccgcct cgaccggcac
    31801 atcggggtcg cgccagtcgc cgcactcgca gaaggccgag tagaggcgtt tgagcgccgt
    31861 ctcggcccgg gcgccgaagg tggcgttgaa gaagacggcg gcgcggtgcg agcggtaccg
    31921 caccgccagg ccgcggcaca ggaactgcgg caggcagcgc gcgatgacct cgcgctcctc
    31981 ggggtccagg aacaggcaca tggtgccgtc cagccgcatg tacagctcct cggtcaacgt
    32041 gcacagctgc cgcaggtaat tggtgcgcgt gccgaaggac ttgtagtcca agagactaca
    32101 gaccacgtac tggcccgtgg ccacggccag cgccatgcgt ttggcggcgc ggctgatctc
    32161 gggcaggtag cgggcgcggt gcaccaagcg gcggaaggcg cccgcgttgt tccatcgaaa
    32221 gtgctgcggg tcgggcatgg tggggatggc tcgcaacgcg gcccagacgg ccaggtccca
    32281 ctcgagcgtc aggccccgga tgtcatactt gccgtgagcc gtgacctcgg ccgaatgggc
    32341 cagacagctg cggcgcacgt agaccatggc gtgcttggaa cgtttgccgg agccggcggg
    32401 acggggcttt tggtggcgcg tggccaggtc ctcgggcgtg cgacacagca gcccgtggcg
    32461 cacggcctcc tgacggttac ggatgggcgt cagataagcc cgaatgaagt tgcgacagaa
    32521 ctcgtcgtcg tcgccgcgac agtcgtccag gtactcgtag gtggtgagcg gatcgcgata
    32581 gacccgctcg tcgtcatcga gctctccatg ctcgtcctta gcatgctcct gctgtggctc
    32641 tggtgtctgt acctgcgact gctgcagttc cgtcatcgcg gcggcgcaga cgacggcgga
    32701 aagtcgagca aggagctgcc ggatcgaggc gccacggggc taatatagct agggtggggg
    32761 gttggcgacg ccaccagcgg gcgcggagga acctccttct cttccctccc gcttcctcac
    32821 ggcgagagac ccgcgccctc cagcatacgg cggtccgaaa agacgtactc gctgacgtcg
    32881 caaaccggca gggtctggag gccgatcggt ttggcgcccg cgccgccggt gctgccgccg
    32941 tgcccgccgc ccccggcgta ggtggcggcc ggagagccca agggcgagaa acagaaacgg
    33001 cgcggacaac ggaaccagaa ggagccctgg cggatgaagc cccgcaggct ctcggccagc
    33061 ttgaccagcg ccgtgccata gagcagcacg tggatgccgc ccagcgggtc catgaagatg
    33121 gccttctgca cgggctccag ccagccgatg acggcgtagc gggccttctc cagcacgccg
    33181 atgacgaagc cgttggcctc gtcggcctcg gccacgttcc acgaaccgaa ggtgaaggtg
    33241 caggccggcg agccgcccag acggatcttg cagccggcgt tgagctggca cacgcgcagc
    33301 aggccggcgc gatcgtgcag cagctgcgag agctcgtaca tgccggcgaa ggtgtgcttg
    33361 aaccaggtgc tctccaccac ctcgtccacg tagtcgcgct cgaagaagct gtagacggcg
    33421 aagaggccgt tctcgtaaaa ctcgctgaac gagaggccca gcacgtagac cttgtcctcg
    33481 cccggcaggt aggcgaaggc gtggccctga ctggagaccc agatctcggg cgccacgcga
    33541 gcgtccggca cgcactcata gacactgatg aggccgatga agtaaaggcg gccggcctga
    33601 cgcaggcacg agaagcgccg gtagatcttc tggtcgcgca ccaccccgaa atagttgctg
    33661 tcgcccagca acaggccgtg gaggggcggc cagcagagcg ggatccagcg accggccgtg
    33721 gcccgcacgt aacgctgcag ctggactccg cccaagcgct cccgcaactt ctgacgcttg
    33781 tggatccagg cgtcgcgtag tccccgccag aggctgctga acttgggctg cccgcgcagg
    33841 tagagtgacg agagcggctc gaagtaaccg acgatcagcc tgcggtcgac gatagaggga
    33901 gatagagagg gaaggcgcca agttcaaacc gcgacagagg acggtgaaat cacaaaggaa
    33961 agcagcgtga cttggcacgc aattttcggt tgtgaaaact ccgtagaccc caggggatgc
    34021 cgggaagtaa aaataaaatc gcgcgcgatt tttcaaaata ataaagacgg gtactacctg
    34081 cgtttcttga agggcagctt gagctcgggg ttgacctcgt gcagggaggt gtggtcgatg
    34141 ggcccgatgt tctcgtaacg aaagtcgtcg atgagcaggg ccaggcccac gcgcacgaag
    34201 gccttgaggt cgcgggccaa cttgaccagc ttatcgtggc ccaccagggc ggcgtagacg
    34261 gcgcccgtgt cgccgcagag gatcttgacg tggttgaaga aggtcttgcc ctcgggtccc
    34321 tcgatttcgc ccagggccgt gaggggctcg cgcgtgtaca gggagcgttg gaagcggcgc
    34381 agggcggagg ccgtgaggcc caggtcctgg gcgttgcgca ccagcaggtg gtggcgctcg
    34441 ggccaggtga ggatcagctg ggcgtcgcgg tgcgactcca cgtaggcgct gcgggcctgg
    34501 gggtcgtcgc cgcaggccag cagctcgcgg aagcagagca gcgagcgcag gtagcggccg
    34561 cgggccgaga cgcgcgagcg gcgacagagt tcggccttgt ggtcggggtg caccaggctg
    34621 acgccgggct gcaggcgcgc gcagatggac tcgtgcacgg ggtcgcagcg gatcatgccc
    34681 ttggcgaaaa agccccccag gtcggaggcc agctcgtaga ggcagtcctc ctgcgcgtcg
    34741 taggcgaaga cggcgccgtg cgcgtccacg aacaccgggt accgacaggc ggcgtacgag
    34801 accacgccga tgaggtgcat gtcgcggaac tcgccaaaga agtcattctg gcagtgttcc
    34861 agatcgatct cggtcagcag gtagggcgag tgagagccgc ccaccacgta gaagcactgc
    34921 gagggccagc ccagcgagac gcaggcgccc tcgaagcgca gcaggtagcg gcgcagaccc
    34981 tcgtagtcgc ggcgcacgca gaggtcggcc agatcgcggg cgcagaaggt ctccggggcc
    35041 agcgagcgct tgcgtcgtgc ccggcggacg cggttgggca cgctcatgcc gtgcggcgcc
    35101 accacacagg tcttcctccg ggcgctcgac atgccggatt cgaggcggcc cgagccccgt
    35161 aaacacttcg ccgcgactga gcgcgggtgc gccacgcgcc cgggcctttt atatgggttt
    35221 tacccccctt tcggacccag ggacaggggg cgcgcgggtc ggatcgagcg tcctcggggc
    35281 gcgagacggc acagaggtcg ggagacagac aggatcacac aaacaagaac gggaggggag
    35341 acctcgacat ctttattatt atggttggtg ttattctcat cgcgaggagg agtgccgtcg
    35401 tcgaggaacg acgccgagtc cccctcggcg aggacgcggg ccgcgcgaca gaaggccttc
    35461 tgctgtctgc gggtgagtgc gtcgtgatag tccatcatgc cgcgcaggtc gtgcacggcg
    35521 cagctgccgc cgccgaggag gcgccgtagg gtgtcgaggt gtcgaaactg gtccgccatg
    35581 ccgtcgtcgc tctttttctt ctgcctggtc tctgcgatct cctaaccgcc ctggcacagc
    35641 gaatccatct ttttcaacag gcgagcgttt cgcaggtccc gcacgcgctg cgagcggcag
    35701 gcgagctcga cttcttcttc gaactcctgc tgttggctct ctgagaggcc gcgataaaag
    35761 gcgctgaagt cctgcagatc agccacatgc ggttgcggct ggacgctcca cagcgtgcgc
    35821 agacggacga aacggatcca tcgggcgtcg cggcacgccg tcgttagcgg gtctcccgca
    35881 tcgggatcga ggtcgctctc gggtgcttct gtcttttttc gtctcgcgct ggccggtgcc
    35941 acggcacgca ctttatatac atcggcggcc accgtcccgc cgcgcggcca atcgcgaaag
    36001 cggaggatgg gcgacgagga cgacgaaccg ggcttggtca gcgacggcga cggaggtggc
    36061 ggccccacga ccgtcttggc cctcttcgcc gtaagcccgc cgccgacaca acagggcggc
    36121 ggcggcgcct ccatcaccac cctcgccacc ctccccgccg tggtggtcac ctcgctgccc
    36181 tcgtcgaccc tgcccgagga ggaggacacc ccggacggcg tgcccacgca cctggccgag
    36241 cggctcaaac gctgtcgcca catggacccc gagcaggact accgactgcc ggcgcgcgac
    36301 gtggtggatt cgtggatcga ggcgctgcgc acctcggacc gcgacaacta cgggcgctgc
    36361 gtgcgctacg ccaagatcca ccgctcgtcc tatcacctga cggcctacga gcactacctg
    36421 atgagcatca ccgagcagta caacagcgcc tcgagcgtga cggagaaggc ctcgtacgtg
    36481 cagggctgca tcttcctctc gttccccgtc atctacaaca acagccaggg cacgggctac
    36541 aagtacgact ggagcaacat cgtgacgccc aaatcgtcca gcgccgagct cttcttcctg
    36601 ctgtgctcca ccagcgagag tcccgtgatc ctccagcccc tgatcaccaa gggcgggctg
    36661 tgctcgtcca tggtggtcta cgacgaggag accaccaaga actgccagaa cgtgcacatc
    36721 ggctttctgc acacgcagct ggtgatggtg cccttcgtgc cgcacgccta ccccaactac
    36781 gcggtgccct tcctctcgct gtccaaggac gcgcgtggcc tggcgggcgt ggaggacgcg
    36841 cctttcgggc aggccgtgat cacgcgccac gggccggcgc tgctgtgccg ggtagagcac
    36901 ctgacgtggg ccggcaagcg ggtgaccacg tacgggcaca agcgcatcac gcgctacatc
    36961 tcgcagtttc ggggcacgat ggaggacgag gaagccgagc tgcccggcga acatgacgtg
    37021 tgggtctcgt ccaagaacgt gcagtacgag ttcatgggcc tggtgttcac cgtcaacgtg
    37081 gatacggtgt gcgtggacgc cgaaaaccgg cagctgctgg gcaccatctc cacctcgtac
    37141 tgccaccgcg tgtcggacaa gatcacggcg cgcaacatgc cgcgcggctt ctgcttctac
    37201 ctgctgacgg acgaccacaa gtctcgcgac ctgcagttca gccgtaaccc gggactgttc
    37261 ttcagcggcg acgcgctcaa ctgcacgttg ctgaacgagc ctaacctctt ctcgctgacg
    37321 gtgcacgcgc cctacgacat ccacttcaac caccagccgc ggcagacggt agagatcgac
    37381 gtacgctatg tgcagacgac ggagcgctgc ttcttggtgg ccaaccttcc gcacgaggac
    37441 gccttctaca cgggcctgac cgtgtggcgc ggcgccgagc ctctgaaggt gacgctgtgg
    37501 gctcgcgcgc gggccaccgt ggtgccgcag ggcaccccca tcgccacgct gtaccagatc
    37561 agcgacagca acggcaacct gtactcatac aaccacaata cggtgtttcg gcaggtccgc
    37621 agcaccagca gcacggtgtt ctttctgggc gacttcaagc tgcccacgga taatttcctc
    37681 accacccccc gtacctgaat aataacgttt atttttttac acaaatctgt gtccgtggtc
    37741 cttatttcgc gcgtcactcc tcattctttc tttccttctc ttgttctcct ttgatcttgc
    37801 taatgatgct ttcaacggcc tctttacctg ttttggcacc ggctatcacc gccgaacccg
    37861 tcttggcggg cgagccgccc ggagactgta gatcgaaagt cactaatcga ctggttgtcg
    37921 tggtcttgct gggggacata gtgatcacgg tagcacccgg cggtgtcaca taaggcggag
    37981 gtagtgattt cgtgccgctt aataacgacg cggtttgtgg cttcagaatt gacggtagag
    38041 tagtcgccgg cgctgaggcg ggtttgttcg acggcggttc gacggtaacg gtagctttac
    38101 gcgcctgtac aggggttgtg gtggccgtcg ctggcaagac ccgtttcgac gcggtcatct
    38161 ttggtgccgt acccactgca gctttaccgg cgtgggtggg tttcagagac ggttgcggtc
    38221 taatcgtcaa cttgacaggc gacgatgtag cggacgatgg cgccgatgta ggggccgagg
    38281 agagcattga cgccggtgat ctcagcggag acgacgtagc ggatgccggt gttttcacgg
    38341 cagttgttgc aggccgaggc acggccaagg gcgatggcgt tttaggaacg ttcgccggcg
    38401 tcaagaagga cgctggcatg gtaggtgccg tacttattcg agaccccatg ggttgcgcct
    38461 ggcttttcac cgggggcgcg ggtgacacgg gtgacgatga aaccgtctgg gctctggcgg
    38521 tgggcgccgg cgttcttact cgagccccga agactggcgt ctgcgtaccg gttgaaggaa
    38581 taacgggtgg agtgaacgtt ctcgtcgatt tctgaggacc cgtcatggtc ggcgttttga
    38641 aggtaaaggg tcgtttagga ggcacagttc tctggctctt gacggagctc gcatccgaag
    38701 aagtggcctc ctcgctgtcc gagtcttcgc tatccgtatt gatgatactc gcgggcgtcc
    38761 tggtggcgct acttaagcgc gtgctgccga tggaggattt attcggggaa ggctgccaga
    38821 cactggtcgg taccagcggt tgagtggaca acgcagcagg tgtcaaggta ggtttagttg
    38881 actgtgcgta aggagcgaag tcgttgaccg ctagccaagg taccttgaca gcccaagctc
    38941 tattgggatt gtttcggatg gccgccgcct gctgttcggt catcggcggt gtggtacctg
    39001 agtcaataga aatgagtggc gattcgctat taccacccaa ggtaggtgtc gaggccggag
    39061 cgggcgccgc cgaaggattg ctgggcgtct gggtgcccag acgaataggc atcaaaatgg
    39121 acgagggttg cggagttacc agtggcaccg tctcgaactt gtacgaggtt tgctgaggct
    39181 gggcagcatt gccaccgggc gtcgtcaggt ctactagcgt gttgctgacg cgcgacgacg
    39241 acggtcgggg acccgtagga gcatagccgc gcagctggta atcgtcggag cccgagtctt
    39301 cctccgttaa ccagtccgaa ctccgggtca ccgtcagcgg cgtcacactc tcccaggcag
    39361 catcgcgacg caatcgatta tcgctggccc tggtgggtat aggcgagaga atgtcgaagg
    39421 ctgtctgacg gtaaggcggg gcgatgttgg agccgagttt gggcgccgag aaaatgccgc
    39481 tgccggccga gcccggcgcc gagggccgcg tcgaaggatt gcggatcggc gcaaaggtac
    39541 ggccatcaat atcatcgtcg tcatcatcgt cagaagactc acggaagagc gatggagatc
    39601 ccctccgagt tcgcatcgga gtcctgccgg cgtcggcggt cctgccctgg gtggcggcgt
    39661 ctcgcaatgc tttttgtttt ctctcccatt ccctgtcacg tttcttttct ctttctatct
    39721 cctcgcgggt ctttttatcc aagaaagggt tattattcac atcgaagtgg aaaggcgtct
    39781 gatgacctcc tttcgcccct ccgtctctgt tccaggggct cgtagtccag gtccagtcgc
    39841 tgctagcttt cgtgggaccc gtcttggaca gtctcgcgcg cgcaaacagg ttctcgtcat
    39901 cgtactccag agacggcgat cgggcgccgt acagggtgtt ggccgactgc gggaaggcgt
    39961 cgatgtagat gtggatgtcc tccgccagca gctccagcag cgtatcggag gaatcgccgt
    40021 ccgtcacggc atgcttgagg atgttacggc agtagttaga ctcgaagccc aggcacgtgc
    40081 gcagctcctt gaccagctgt ttgcacagac tctggatgcg cgtcaggcac ttcttctcca
    40141 gctcctccca ggctcgacgc acgttgatga tcacgcggcc ggtgtagacc aacttattga
    40201 cctcgttgat tagcggcgcg ttggcgtgcc ggtccaggtt aagcttgagc ggcttcacct
    40261 ggaacatgtt gtggcgcacc ttctccagat tctcctccat catctgcatc tcgcgctccg
    40321 cgaggttgac gaagacgatg ggttcgatgg cgttgagccc cttggccagc tcggtgcgcg
    40381 ccgccagttt ggccaggatc acggcgctgc gcagggcctt ctccacgatg tcggcgtcgt
    40441 ggcgcacctc gctgtcgaac tcggtgctgt ccaccacggc caggtgctcg cgcgctctag
    40501 cccggtcgcg gaacggatag atgtgtccgc ggcgcgccac ggcgccgcag cgcatctcga
    40561 actcctccag cagcggcgac aggtcggggt tgtggaagcg cagctcgcgg tagtagccca
    40621 gccacagcat gagcgtgttg aacatggtag tgcgccggtg cagccgcttc tcgccgcatc
    40681 gtcggaggac cttgggatgc ttctccaaat ccacgtcggc cttgttaatg aggtgcttga
    40741 gaaagccggt gagatgcacc acatcgcggc gctcgagacc gataaactgt agactcatgc
    40801 cgtctgtctc tccagaagcc ggaagctcgg cgactccgga ctcccggcgc ggtcagctat
    40861 tcgcctcggg gcggggcccg cgccatggac accttgctgc acaacgtcac ggtgagccgc
    40921 ggagggaagg gaccggggcg ggggtcagtt taatagcgga ggcgggggcg gcccggggga
    40981 gcgccatctt atctgaacac gatgtcgtct tgcctcgacc ccgacagaat cgcagcgggg
    41041 gcatccccca cgtcagggat gcctgcaacc agacggagac gctgcaggcc atccgtacca
    41101 ccgaagcctt cctcaacctg ctcatcatcc tggtgggcgg accgctcaac gcggtggtgc
    41161 tggtcaccca gttgctgtcc aaccacgtgc acggctactc gacgcccacc atctacatga
    41221 ccaacctcta ctccaccaac ttcctcacgc tctcgatcct gcccttcatc gtgctcagca
    41281 accagcacct gctggggacg aacgtggcct cgtgcaaatt cctctcggtc atctactact
    41341 ccagctgtac ggtgggcttc gccacagtcg cgctcatcgc cgccgatcgc tatcgcgtca
    41401 tccaccgtcg cacctacgcg cgccagtcgt accgctccac ctatgtgatt ctgctgatca
    41461 cctggctgat ggggctcatc ttctcgaccc ccgccgccgt ctacaccacg gtggtggccc
    41521 acgacgataa aaacgatacc atgaacgcca gcgacaccag taacggcagc gacaccaata
    41581 acaccaacgc ttcctatcac acctgcgtca tgtacttcgt agccgacgag gtatacacgg
    41641 tgctcatgtc ctggaaagtg ttgctgaccg tggtctgggg cgtggcgccc gtggtcatga
    41701 tgacctggtt ctacaccttc ttctactaca cggtacgacg tacggcccag aagaaaaaga
    41761 gccgcaccct gaccttcgtc agcgtcctgc tgctctcctt cgtcatcctg cagacgccct
    41821 acgtgtccat catgatcttc aatagctacg ccaccgggaa gtggtctctg gagtgccaac
    41881 atcagacgct gaggctgacg gtcagcacgc tctcgcgcct ggtgcccaac ctccactgcc
    41941 tcatcaaccc catcctctac gccctgctgg gcaacgactt tctcacgcgg ctgcgacagt
    42001 gcatccgggg gcagctgttc gaccgccgcg ccttcttaag gtcgcagcag caacacggcg
    42061 gcacgacaga cgccgccggc accacgcagc tgctacccac ctcgcccacg agcggcgcga
    42121 ccagcgagca cggcaagacc tcgtctggca ccaagcccgc gcgcgtcaaa cgcggtcaga
    42181 ctttcaacgt gccgggagac acgccgaaat cgcgtccgaa aaccacgtgc agacagcacg
    42241 gcgtttccct gggccagcgg ctgtcgcaat cgcaccacaa cctcagcctc ggcgtctagc
    42301 ccgccgaaag cggtagaaag agccagaagc ggccctcgca gacggtacgc atccccctgt
    42361 ttttggcccc gctcccccgc ttttgacatc acggtacagc aaaaagcctg tcgacaccgc
    42421 cagccgacgg ccaatcgcgt ggcgtaggag tggcgaaccg gcgtcattat aatcaaacgc
    42481 cggagtcgcc gcccgccaca acgccgtccg gcgctacttc ttctcgagta cggtacgata
    42541 tccgacgttc agcgtcgacg cggtttatcc caacccggag ccccccagcg gtcctccgcg
    42601 acgcccggct ggctgtccgg cggccgagtc tccttttctc ctagtctatt accacggccg
    42661 ccggcggcgc cgtcgccgcc atggaattca tcatcactac ccgggacttc tccaacgacg
    42721 actcagtcct cagagccgcc gagatgcgcg acaacgtggc cggcacgatt tccaaagcgt
    42781 acaagggcac cgtgcgcgcc gagggcaaga aaaagctgct gctcaagcac ctgcccgtgc
    42841 agcccggcgg ctgcacgcgc cgcaacggca atctcttcgt tttctgcacc gaccgcgact
    42901 accgcaagtt ccaccagggc atcgcgcagc tcaagcgcgc gcccgtcgat ctggagccca
    42961 gcgagatcca acaggtgacg agcaacatcc gctgccgcct gcagcccagc gagcgcgacc
    43021 cgccggcgcc caccgacgac ctgcagacgg ccgtgtcgcg cgtctgcacg ctcttcaacc
    43081 agctggtctt cacggcacag ctgcgccatt actgcgagca ccaggagaag atcgtggcct
    43141 acgcgcgcga cgagctgacc aagcgctgcg gcgagcgctc ggcgctgggc gtggaggtgc
    43201 acgcgctggt ggcgctgctg ccgcacgagc gccaccgcga cctgtgcaac gtgctcatcg
    43261 gcctgctgca ccagacgccg cacatgtggg cgcgctccat ccgcctcatc gccatcctgc
    43321 gtcactacct gcagaacagc ctgctgaacc tgctggtcag ctcgggacta gacatctcgc
    43381 aggtcttcga cgcctgctac cagagcgagg cctaccgcat cctcttccag atcggcaact
    43441 cggactcgcc cgcgccctcc ccttcctact gcgtgcccga cgaggaggcg gcggcggccc
    43501 tggaactctc acagcgggcc agcgcggcgg ccgtgctggc cgcggcggcc aacatccgtc
    43561 agcgcctgcc gccccctctc ccgtcgagcc gccctcccgc tccccgccgc cggcgccgcg
    43621 tcaagcaccg ctcctcgggc ggcgacgagg acgacgagcg cgacgacaac gaggacgagg
    43681 aggaggcggc ggccgccgcc ggagagcaga gaggaggaga ggaggagcag cagcaggagg
    43741 agacgacgac aacgaccccc acccccctgt gtatttaacg tgccccgaat aaaaaatttc
    43801 ccctggttcg tccgactccg ctgagtttta gtttcgtttt cgaaaggggg gccgccatgt
    43861 cgcagcagcc gggtcagccg ccgccggccg cgggcccgtc acaggcgccc cggccggctc
    43921 ccgggccgtc gcccacgcta ccggtgctgc cggtggacga cgcgctcaac tttcgtcccg
    43981 acctcttcgg cgacgatcac cggcggctgc tgctcgacat gctgacgcag agctgctcgg
    44041 ggttcgtggg cctgctcaac cacggcctgc cctcgcccac ctacctgctg gagtccctgg
    44101 tggacttcca gatccgcaac ccctacctgc gggtcaagcc ggtggcccag cagatcgtca
    44161 agatctgcat cctggccaac cactaccgca acagccgcga catcctggtg gacctgcgca
    44221 cccagctgga cgtgctctac tcgggcaccc tgcggacgcg catcctcaac gggctgctca
    44281 agctctgccg ccgtgcgcgg gagtccggcg tcacgccgga ggagatcagc gtgcacctgg
    44341 gcgccgacga cgtgacgtac ggggtgctga agcaggtgct gggcaagctg caccgcatcc
    44401 gcgacgcgct ggggctgcgg cccacgcccg aggccgaggt gcgttattcc accctcacgg
    44461 cctacaacct gctctacctg ccgccgccct tcaccacgca ggaggcggtg gaagtgttcg
    44521 ccgagaacct gtccaacgtg acgcagcgca acaaccggcc catgcgctgc atggccagca
    44581 tcaagcggcc cggcacgcgc tcacatgagg acgccctcaa cgacctgtac tttctggtca
    44641 gcgcgcgaca cctgcagctg cgacacacgc tcgagctgca gatgatgcgc ctgtgggtgt
    44701 tggagaagtg caaccggctc tgcgacgacc tgtacttctg ctacacgcag gtacccgaga
    44761 cgcgccagat cctggtgacg ctgatccggg gtctgcagct ctcgcgccag tccacctcgc
    44821 cggccttccg cccggtgctc tacaacctgc tgcagatgct cacgcagctg cacgaggccg
    44881 gcgtctacct ctgcccaggg tatttacacc acgccgccta tcagttgttg gaaaagatcc
    44941 aacggatctc agacgggcgc ggcggcgagg acgaagacga ggacgacgaa gaggacgggg
    45001 aggaagggcg gcgacaccgc gatccccgaa ccctgccgcg cgagatctcg ctcgatctgg
    45061 aatccgatcc cacggccgtg cagggcgaga ccttcttcct ctccaagaac ctgtacggaa
    45121 acccggacat cttccgcgtg cccgatcacc ccagccgcta cctgcggcgc cgtatgttcg
    45181 tgcaccggca ggacatcccg cagatcttct acaacatcca caacggagag atcaccaccg
    45241 agatctacaa cctgcgacgc atctacagca tgatgatcga aggcgccgcc cggcagacgg
    45301 gcctgacccc caagcgcttc ctggagatca tggaccgggc gccgctgggc caggagccgg
    45361 agcccgagct ggccgacggc tacgacctct tcgccgacgt ggaacggcga cccatggtcg
    45421 ttacgtcgtc atccacgtca tcggccgcct cttcgtcggc cgtggcctcc acctcctcgg
    45481 cctccgatta cggtacgggc gcctcgtcct cgggcgtcac cttcacccgg cccaccacca
    45541 cggcagcctt ctacacgtcg ccgtcgagcc gcatggactt ggagcgggcg ccccgtcagc
    45601 ggcggcgaat ggtgagcgtg gagcccttct cgccctactc ggtggcctac aaccagcacc
    45661 gacatcagcg ccgacgcaga cggccaccgc cgccggctcc gcggggtccg gcgcacaccc
    45721 gctatcaggg gccggacacc gagcggacac cgtaccgcgg cgacgatgac gaggaccccc
    45781 gcgacggact ggccgagacc ctgagaaacc tctgacgaga cagaggagca agaaaaggaa
    45841 gacgacgagg acgcgctctg accccctttt ctacgacgcg acgccccaaa gaataaaaca
    45901 ccgtcaacgg gtcttttgta caaaaaaatc agagagcctg ttgtctcttt tttattcggg
    45961 gagaacctag cagtttatag gaagataaca gggaaagtca agaagctttt atgtacagtc
    46021 cgctgaggaa agagtccttt ttttccagtt tcctcccttt cttttcttgg tcagacgtgg
    46081 ggaggagtga ggggcgccat gacgttggca ccgggcggga tgaggtcgcg acgcccggcg
    46141 tcgcagacct tgtagcgccg cctccggacg cagcgttcgc agggaggcat gtcccagagg
    46201 aagcccatgt aggtctcggg ctcgtcgtcc tggaagcgga aggacagctc aaagtggttg
    46261 agggtcccca ccttgccgag gattttctgt cgcacggcct cgacgtcgcc ctcggtggcg
    46321 gtagcgcaga ggtgcatgac ggagctgttg tccgccaagg ccttgagttc ctggggccac
    46381 atgtgggtgg cgatgtgcga gtcgctgagg accatcttgg cggaggccag catgctctcg
    46441 aggatggcgt cgcagatgcg tccctcggcc tcctcgtgcg agggtatccg gcggggctgc
    46501 gggggctggt cggcctcgtc gtcgtcctcg aacatggcca tggggtcggg ggtcttcttg
    46561 gggtgctggc acacgggcgt cttctccagg cgcaccaggg cctcgcgccg ggtgctgaag
    46621 cggtggttgc ggtagccctt cttgcccatg acgcaggtga acatgacgac gtcctcagcc
    46681 aggcggtaga cggcgtcggc ggcgggatcg tagccgtaaa cggttccgaa gttgtcgatg
    46741 agcacgtact gccgcacgat gaactccctg cgttcgatga cctcgtgccc cagggccccc
    46801 agcagctggt ggtagcagct gatacggggc acggtgtgga tcatgagttc catggtctgg
    46861 atgacgccgc cgccggtgac gacgctgaag gagttctcct tgaacttcat gacctcgccg
    46921 tcgtgggtcc agaaggcgaa gtgggtgtcg gggcactcgt cgaaggggtc gtcgatgacg
    46981 taggaacggt atcccctcct ggcgatctcg gccgacatgc tctcgacgtc gctgcggtac
    47041 agcatgatgg agttccagta atcatcgtac tccaccatgg ggcgctggta gtcgcgcatg
    47101 gtgtagaaga cgtcgcagtt acgaaagccc acgcgcagga actccttcat ggtggccgcc
    47161 agctcgtaga cgcagtcgtg gaggtcatcg tagcaataga cgccgccgcg cttgccgacg
    47221 agcacgatga tctgatagcg catgaagccc ggcccttcga gaaagccgat ggggtgcatg
    47281 tactcctggc agcagacgta ggcacctgag aagagaaaaa gccacgtacg ttgaagacac
    47341 ctggaaggag cgtgccgagc gaacgtcctc tttccaggtg tctccaacgt cgtgggctta
    47401 ccttgagagc agacggtacc catcttgccg acgaagggtc ccagggcgct gcgcgagcgg
    47461 agctggatgt agcatcgctc gggccagggc acatgcagcc gggcgccgca ctcctggtcg
    47521 aggaactcgt tgaggctgtt gaagtcctcg gcccggaccg cgatgcagcc gtagctgagc
    47581 agcgtgtccc ggaggtcgtc catgtcgagc ggggaagacg gcgagcgggc cacggtggcg
    47641 gtcggagtcc tcctcctgct gctcttgctg ctactgcccc tctcgcttct tcacgctccg
    47701 ccgctcccgc cggctcctga gatgctgtgc gccgacgaca cggcatttat agacactatc
    47761 agcgttgacg tcagacggca ttgtcgacgc cgctgtcgat gaagaaatgg tcgtcgtcct
    47821 gacgcgtgta tctgaaatct tcaatcaaat cgcgtcgacg ccagaaagag accatgcaga
    47881 agaggctgag tatgacgagc gtgcccgccg tggccgagaa catgctgatc atggcccagt
    47941 gtcccagggc gcggctctgg gaacgcagaa actccacacg gcggtttttc cacatgacgg
    48001 acagcttgct ccacatgccc catgactccg tgtcgttcca aaccgccgtg acgttgttgg
    48061 aaccgccgtt caccgtcacg ttggttatgc tgacgttcaa acgttggaaa cgacgcaata
    48121 gacggggaca cacgtcttgc agaaagatgt aattgctttc gacgtgccgg gaaagcaccg
    48181 tcttaacgac gtcggttgcg ttgtcagtgt cgttacgagt cacgttccag tacacgtgcc
    48241 ttcgagtcac gtccacattg ctggcggctc gcaaaacgta accgatattc aaggtcgtca
    48301 aattcaacgt cagcagtccc gtggtaatgt ttcgcctgtc aatcaaactc gtgttgcaaa
    48361 aaatcgcacc gtcgacctgc gatacgttgc tctttaggtc gctttgattc aggacccagc
    48421 tgggaaagag tccctccaga tgaaaacgca gtccgaagtt gagcattcta gcgtgccaat
    48481 gtcgattccc cttacgtgga aatgtcatgt tcaactgcag cgcctttttg gctcctagac
    48541 aggggccaca atagatcacc gttccgttgt acgtgcaatt cattttgcag ttttggaaac
    48601 caccgttgcg gtcagtttga ttgacaggtg cgctgtaagt gcaacccgct gtcactccgt
    48661 gcaccgtcag cacgcacgcg gatagcagcg cgagcagcgt gatgaaaacc tacgggggga
    48721 gaagacgggg ttttgctata aagcctgaaa tttttccctg tgaaatcccc actaccgttg
    48781 ggttacgtaa cggggtttat ttacctgaga cccgcgtttc tcggccacgc gataaaagac
    48841 accgacgcta cggaaatata aaatcaacgt acatgtttat tacgggtttt acacaggaat
    48901 ggggggaagt aataagaaag tctctagacg acgaccatct gtatgtcgtc gctggtgtac
    48961 accgtctctt cggcgccgac tatcagcggc ggggagggag aagcggtgca ggtggaggaa
    49021 gaggtggacg aacacgagga ctcgtccatc tcgcagggcg tcgtaggggg cagtacagtc
    49081 acgccgtttg cggacgacag catgttggga ggtgcggaca ggacccggtg gaccgtcgga
    49141 cggggggcga tatccacaaa gtgcgcgtgg tgaccgcggc gccgctgctg cggggactgt
    49201 tgcgattgtc gcggctgctg ctggggctga tccgtgacga ttagcgaatt ggcccgcagc
    49261 gagtcgcggt ccacgaaggc gacgggcatc ttaccctctc ggatcctgcg ctcggcctct
    49321 aggatggccc gcacgtagca gttgaccgac ttggcgaagg tccgcggacc taccgcgttc
    49381 ttgtccctgc gcgcctccaa cacttgtttc tcatagtcca gctggtggta gatcatcagc
    49441 agatcgtcca tgctctgcgc gtactgccgt atgtggttac gcacctccac tggaaacagg
    49501 gcgttccagt actcaaagac gatgacgccg tgccagaact gcgacatact gggcgccagg
    49561 tagaagagca gacccgactc gtaggcgaac acgtcccact tgggcgtcat gaagagcacc
    49621 acctgccgcg tgggccgcgg cgccgcctcc tcccaagact cgattacccc gaacatgacg
    49681 agctcctggt ccagcggggg gcagtggcgc tccagccagt tgatcttggc caggttcata
    49741 gtcaggaact cgtaggtcgg gtcgcagata cacacgtaga gccccgagtc gtgcggcagt
    49801 cgtacgcccc gcttcatgaa cttcttaact aagcatcgga gcgccacctt gcccaacgta
    49861 gaggcctgga tgaggctgcc cacgtccacc tgcgcctgct gccgctcggc ctcgtccagc
    49921 atgctcatga tggcggtcgt ggcgtgcgtg gtggcgacgg cagccatctt agaagagacc
    49981 gcggatcgcg cagggaagca gagagaaaca gatcgagttt atcccttccg tcgacggtct
    50041 cttactgtgt ctcgcaccgc gcctgtcgtc ggctcctgta gcgcagcagg gcctttttga
    50101 gggcgtcgta ggcctcccga gcgagtcccg tgagaccttc ggcgtccaga gggttgactt
    50161 cggggtccgg cgtctcgatt tcttcctccc gtctcctctc cccggcgtag taatcggggc
    50221 aggagtagtc gttgttgttc tcctccgcct cctgtccggt ccgcccgaag agcgcgaagg
    50281 tcaggtcgcg gggccactcc tcgccctcga tcacgccgta ctgccgctgc agccgggtcc
    50341 gccgctgctg ccgccgcacc tcgctcctca gccagggagg cagcgggtcc tcggcccgtt
    50401 tgcgctggat ccaacggtag ctcaggtacc agaaggttag caggcccaca ccaccgacga
    50461 ggtggacgta gggcagagac atcgccgaca tcgctcctca gcggtggacg gagccgaaag
    50521 ccgcgtgtcg gtgacacgtc gtcttgagac ggtgtcttat atatcttctt aagacgccgg
    50581 acatgacgcg cccaagacac gtggattttg gccttgagaa acgcatttct taagacgttc
    50641 gcgctgtcgc aagaccccat ctgagtcagg gaggtcccgt gagacggccg ttgtacgtat
    50701 gtcgtgactg tcgcgcgtgt ccttgaacgt cagataccgg tactgacgcg aggacccgac
    50761 agcttacgag acattgagca agaaagtccc tggaactgaa acgtcaaccc gtgcggtgac
    50821 cgacgtttcg gaacacgtca tttagcgttc ctacccaggt tcccgtcccc acttttttat
    50881 aaataaatca gaacgagacc tagaaagtca gtcaacatat tagttttatt ataattatta
    50941 atataataag tagtatcttt tattattatt attgcactgt gtgtagtgtg tatccaaaga
    51001 cgactactaa gccttgccgg cgtagtggta agtctgcagg ttcttgatga gctgcggata
    51061 gaaagaggaa aacgagccca gtcccagtag cccgatggtg tacatggccc aagtctctag
    51121 accgaagttg gcgggacgca ttctgaggtg gtaggcaacc ttctcggaca gccgggaggg
    51181 ctggttgaga cagcacgagc gcagcgacga caggtaaaac cggctttggt ccagtcccga
    51241 tacgtggacg atgtcggtgt gacaatccgc gggctgaacc gatggtggat ggctgttaca
    51301 cgtgcccgtc cgggtcttgt tacccacgtc gatcagcaac tcgggtttct cggagttgtt
    51361 gtccttgggt cggcagcact ggacgtccac ggtcatcagg ttcatgcccc ctttgtggta
    51421 catcgcgtaa acccatccct cgaacacctt ctggcagtag ctagtgttgc tcttgggggt
    51481 actggagatg acggctcccg tggtggtagt aggggtagta gcggtcatct gccccggcag
    51541 cccgaggaag acgatgatga gcagggtctt cggggccatc gtcgtgatca tgaagtgggt
    51601 ccgcatcttg gtggctcgga ggcgagacga gtgtcggagt cgctctgatg tcccgtccgg
    51661 tttttaacac ggtcccgggc ccgtgacgac attaaatagg aagggacggg gtgggggttg
    51721 ctgcgtcaga aatccgtgtc agaatcccga cgcggtttct tctcccacag cgtggtctcc
    51781 tcgtcgtccg actcggtgct cagcatgcga tacacctgtc ggcgactttg gaaggctttg
    51841 aaggtggagc agcagatgac gagaaataac ccgatgagga agcagacgac cccgaccatc
    51901 ccgatgcaca cactcatgtc gacaccgctg gcattggtgt cgttgccgga atggtagtaa
    51961 cagaaagacg acatgatcgc gggtgttggc atgaaagatc ggtcgtgtta tcgtcctttg
    52021 tgagcaggtt acatacatca tacacggtca ccccgatgtt cccgtcaccg tgtttccatt
    52081 cctccggttc agaaccaccg tgaacaccac ggccaagaaa atgatcccta atacagcgac
    52141 caccatgagg gccgcgctcc atttccagct ctgatccaga tacgccgtgg tgggagggtg
    52201 catcgtagcg ggtatgtcca tcatatccat atcgaacgtg tgccgccggg gcggcgagct
    52261 catcagacag tacgggggcc ggtagggcgg cgggctacag ttgggcagcg gcaggcggtt
    52321 gttgttgtga tccggagcgg cgttcatggt gatggcgacg tggggcccgc cggcctcctc
    52381 gtatctcggc ggcggaccca ggcccacggc ctgctcgtag ctcggaggcg cgtcatcctg
    52441 accgccgtcg cggccttctt cgtcgcggag gatgggagtg gggtccatcg cgtggcggtt
    52501 tcttctgttg cggctgtcgc gttatccctt tcaccgtcga agcaacggcg acgacgacaa
    52561 ggtgggcggt agagagcgcg gcgaagaaga gccgccaaag aggcccctct tcttccgcag
    52621 acgccggcag aagacgtcgc gcgggcagct ggtggcccga aaggccggca gtacgctctc
    52681 cggatggcta aagcagtccc gaccgaagca gtagttgttg ttgaaacgca ggaagcccac
    52741 gttgaagaag gtctgcagtc cgcgcgctag aaagtgagcc cggttggtct ccggatgtac
    52801 accgaagacc aggccgcact cgttaaccag gatggagatg tccaggcggc ggtgcggctc
    52861 cacctggacc gccttcacgg tgaaaatctg cagcacgttg agcgaacccg tgtcttttaa
    52921 ccaggtgggg tggtggggac tttcgtaggt ttggccacca ttcaagacgc acgtcgtcat
    52981 cgactcgcga ttgtccaccc agctgaagac gctgccctcg tgtttcatgc agaggcgcca
    53041 caggctcatg aggtctcgcg ccaccacaaa ctcccaaccc aggtcgccgc cgctgtcgaa
    53101 gtgggtccag cccagctcct cgcgcagggg cgcgaagttg cgcaggccat tcgagacgaa
    53161 tccgtggaag cccgagcgcg agatcaggta cacgcagtcg cccgagggcg cgtaacagta
    53221 cacgcggccg ccctcgccga tgaagatggc cagcggcgcg cggcccggct cgccctggca
    53281 ggccgtgccc accggcagca gaaagcggtc gcagcagagg aacaccttct ccagaccttt
    53341 aatattgaga tggctgaagt agtccaggcg gagcaggtcg cagtaggtga agtaccagtt
    53401 gaagggccag ccgatgtgca gcaccgtccc gctgacgcgg cgcaccagct tctgcagctc
    53461 cttgcgggcg tcgggcgcca ccgagcagcg gaaggtctcg ttcaccagct cggcggccag
    53521 ggcgtcctcc agcgagcgct ccttcatcac gtcgaggccg ctgctgcggc gtcgcagcgg
    53581 ccgatggtgc tgtccgctcc gggtcgaggt gccgctgtcg cgtctctcta gctctcccgg
    53641 ggccgcctcg aagctcactt ggctgaggct gctgctccgc cgacgaatgt ccccgatgca
    53701 ggcgggccgt ctccgcacgt tgcttccgct cctgccgccg ccgggcatgt tagttataca
    53761 cggtacgcga tcacgtggct tctggctcga ctccatcgcg tcccgagaac cgcgccctcc
    53821 gctcgctggc acccttcccg cccgttagcc gcacttttgc ttcttggggt tgggcacaaa
    53881 ctcgaaagtc acggaatcct cgctgtcgct ctcctctttg gcgtcgttga agtagctgct
    53941 cgagttgcgt tcgccgccgc ccccgccacc ggcgcccccc ttggacgtca ggtagctggt
    54001 gatcttgtgc tgctcgtact tgtccttgcc gtggtcgtga tcgcgctcga cgttgcccat
    54061 cttgttgcgc gagctggaac cgccgtgctt cttgcccccg ccgccgccac caccgccgcc
    54121 tccgccgatg ccgccgagcc ccagcatggg ctcgcctagc aggtcgttct ccagaccgga
    54181 gccgtcgtcg tgcatgctgc taccgccggc gttggagagg ccgccgcctc cgccaccgcc
    54241 gcgcgacgtc gacttgccgc caccaccgcc gccgccgtag cccttgtcga agggatcgcc
    54301 gcgctggaag ggctcctccg tgagaaagtt ctccacggcg aagaggccgt tgcggctggc
    54361 cacgtagagc agcgcgtcgt gctccgtcac caggcgcacg gtgcacggca gtttggtgac
    54421 ggcgcagttg agcaacgtct gatagaaatt cttgagctgc acgccgatgc gcatgttctt
    54481 gacgccgtgg aagctgacgc ggttgttggc ggtgaattcc agctcgctgc cgttgcccag
    54541 gatgaacttg atggccggcg gcccggcgtg gaccaggatc tgcacggcgc cgctggggcc
    54601 cggcggcttt ttgacgttgc gcttgacgcg ggtgtgcggc ccgatccact tgatgagttc
    54661 ggccaccacg gcgtagtcga ggtctacgtg cacggccgag ttctcgctct cgcgcacgat
    54721 gtcctggccg tgcacgcagg ccgagctgaa ctccatgttg aaatcgggcg cgcacatgga
    54781 gatcttggcc gagaggtccg agatatcctg cacgtagaac ttggtgaggt ccttgctgga
    54841 ggtcaggtac atgaagttac ccagcagcgg cgtggagttg ttgatggtct tgggctggaa
    54901 ggacttgtcg gtgatgtaga ggcacgagct gttgaaagtg atcttggaca cgcagtggct
    54961 gcgcaccgtt tgcaggatca gcgccggcgt gggcagaaaa gtgacggtgg tgttctcctt
    55021 gagcgcacgg atgacagatc gcagctgctg gatggccgac ttgtagggct taaggcgcag
    55081 cgccagcgtc ggcggctccg agagacgcgt cttgcgctcc atcgcggccc ctaggcgctc
    55141 cggcgcaccc gctcggcgat cacctccgca cccggcgaga cgcggacctc aaataaggtc
    55201 gcggcgcgga gaggagaaag ttatatacct cgggcgcgga cgctgaaaca cgaccggcga
    55261 tggcagtccg ccgcgctccg tcggcgttta atacagcccc gagcggctcg ccggcgagcc
    55321 cgcgggggac aaactaggag gaacagtact tatatactcc gaccttcagg tgcaagtggt
    55381 accatttcag catcctcgac agcagaacgt cgggggtcat ggaggagtcg tagtagaaga
    55441 gcggcgtcac gcaatggtcc acgaagacgc tgaggttgac gcacgagacc tccacgtcgt
    55501 tctggatctg ggcggcgcgc tggaagaggc actgcgccgc cttgccgtcc tcctggtgct
    55561 ccagccaggc gtagttgacc acgggtacgc gcagcgagcg ccgcgccgac gaggggaagt
    55621 agcactcgcg gttgagcgga cacagcgacc acaccgtctc ctcgtcgtac acgcagtccc
    55681 gcgcggccca caccgagggc gtcacgctcc acaggtgcgc cacctcgtcg tcgggcccca
    55741 ccgagaggaa ctggcagttg cgcatcccgt gctccagcat gtcggcgcgc agcgcctccc
    55801 agcgcgcggg cggcagcgac aggcgcggcc ggcggtacag ctcgaagatg aacttgccgc
    55861 cggcatagat ggtgcgctcg aaccagtcgc agcgcggcag gccggccttg cacaggtcca
    55921 cgctggcccg caccgccgcg aagtacatgt gctcgaagat gcgctcgatc aggtcccagg
    55981 aggcgaagta ggtgaagccc aggcgcatga gcaccgtgtg cagccccacc acgccgatgt
    56041 gcaggggccg cagccggtcc acggcgttct ccacccacca gtcggaggcg gccaccaggg
    56101 cgtccaggcg cgcgttgccc cagatcacgg cctccgtcac cagctcgcgc agcacgcgca
    56161 gatcgaagta gcgtcgcgta ttgcccagca ccacgtcggg cgagtgcggc tcgtgctgct
    56221 cgctgcgcgc gaacacgcag cgcgacaggt tgaccatcag ccgctgcacg ggagcgtcgt
    56281 actccccgaa gtggcacgat gccatgtcgg ggctgaggca ggccggcagg cagaggttgg
    56341 actcgcaggc cagcatcgag tacttgacca cgtgatggat gaagaccacc gaggcgcggc
    56401 cgcgcagggc gcacaccagc accttcttca agaaatcctc ggtgttgacc gtcaccttgg
    56461 ggcaggactc ctcgcagcgc cggtactcgc ggtcgaaggc cgcctcgtgg cccaggtccg
    56521 agaggcgccg cgccacggcc cgcccgaaga ggcagtactg cggctgacgg ccgcggtagc
    56581 gtttcatcag caggctaggc acgttgaaag cgtagcacac ccccgtgggc tccgacgtgc
    56641 attccttgag gatgtggttg atgacgcgta tggccgccac gtcccagagg tccacgaaga
    56701 agcgcaccac gggccggtgc acctcccgct cgcgcaccag gtcgcagtag ccgcccaggc
    56761 agcggatgac gctggtcgcg tcgacgtcga gccgcgtcac gttgatcgag accgagacgc
    56821 cgcagctcag gctgctcatc cacttgcaca tggccgccca accggcgtcg cgcgcgaacg
    56881 agtcggccga tatgaggaag tcgtagcacg gcatcttgtc gaagcccacg gtggacatgg
    56941 cgaaggtgga aagcgagagc tggccgtcgc gacagcgccg cagcaccgcc tccagcacct
    57001 cggcctcgtg ccgcacgttc aggagaaagc ggtagatgcg cgagtgcagg ctctcctcga
    57061 tggccgcggt cacggacgcc gccacgcgga tgaacacgcc gcccaggcac tcgtcctgcc
    57121 cgtgtagctg gcgacagatc ttgtccaggc acaggatggc cgggtagagg ccccagcagc
    57181 cggccagctc cacgaagcga taggtctcgt cggccacgcg cggcaggtcg tcggcgtgcc
    57241 gcagcacgaa gcggcgcagg gagtcatcgc acaactcgga ggcgtagctc agaggcgagc
    57301 ggctctcgcg cggccagttg gccttgatgt agaagcgacc cagcagcagg tcggtgcgcg
    57361 gcgactggtg gataagcgag ggcccgtggc gcatgaccat ctgaaagagc ctgaagctgc
    57421 ccagaccgcc gccgtgacgc gccagggcgt cgatctcgcg ccacagcgcc gtgcggtcgc
    57481 ccaccgtctc gcggacgggc tcctgcacgc cgcaaaagcg gaaccggccc cagtagccgt
    57541 ggcagtggca cttcttgccc atgacggcgc gcacggcgct gatcacgggc gagattttgc
    57601 agagcgaggc cccgaaatcc tcctcgtcct cgcgcgcctt cgagggcgcc ggcggcgaac
    57661 cccgagtcag cgtgccgtcg cgctccaggc acgtcacggg ggccgaaacg ggacgggacg
    57721 gcgaagaaga cgacgacacc gtctgggtct gcacggggat gcgaccgccg caaccgggtg
    57781 agagcaacga gtcgcagaag agatcgccgt cgcccagtac aggaccgacg gcgacgatcc
    57841 cacaatcgcc gttctcatca tgttcttcca cgacgcccag ctgccgcatg aagctcggcc
    57901 ggtgacgccg aacgccgtcg ctgctagaca cggattcgcc ggactcttcg gtctccatga
    57961 tgtcaacgtg gcccgctacc gcctcatctt cgctcgagga cgacagcggt ccctcctcga
    58021 tctcgctatc atcatcgtcc tcgctgctgt tgtcagcgcc gccgatcgcg gagaagagag
    58081 aagaggacga cgagggcgcg cgcgtgttgc tgctggcggc cacccgatac ggcgaagagg
    58141 gcagcagagg agagtcctcg ccttggctca tgagtttatg ggtgagtagc agagaaaatc
    58201 cagtcccctg aataaagaat ctgcccgaaa cgctcgcctc ccgtgtctct tatattgagt
    58261 ccgccccgtc tctcccagat tatccccgtc ttcttcccga aacccgtcag acaaactccc
    58321 taaattcccc gatctccacg caaaagttgt cgagtcgaaa gaccgagagc ttggtctcct
    58381 tgtgggtgat gaaggaggtg tgaatgtcat cggccagaca ccagcccagc ttttgtatga
    58441 cccccgtgca cagggggatc tgccgcggcc gcgtgatgcg gcggttgacg aagccgcagc
    58501 gctgccgggc gaactttccg cgcaccacgt cgaccagggt ctgccaatgg cccagacagg
    58561 tggtgaccac gtagatcgcg ggcttgtttt cgccctcctc atagtcgtaa atgatcatta
    58621 aatacacgaa ttgcagccta cccttgcttt cttcaagcgt caggtacatg tctttcggaa
    58681 tcatcaacgc gaaaacctcc gtcttgagcg tgttgtaaag gtagccgcgc atgacgcagg
    58741 tgagcagcga ggtcatgcct agcgagacgg ccttgacgca gcccaccgtc tccaggcggc
    58801 ggtgcagcag ccactgcggg ctgaggtcca gccactgcag ggcggcgcgc gccggcgacg
    58861 acgcatagac ggtctcgagc aggcagcgcg tggcggccgt gacgttactg gcgcggatgc
    58921 ccagcaggta aaggcccacg tagaggtggc gcggcgagtc gcagcccgtc tccatgcgca
    58981 ggatgagcga tccgggctgc gcctcgaact ccaccaggcc ctctggcgcg aagaagcgcg
    59041 ccgtcaggca ctggtggtcg gcgtggtaga ggtagcgaac cgatatagta tttacctcgc
    59101 gcttggcctt gagcgccgtc tccagctcgt tgtcctcgtc ggccggatcg cgcggccgct
    59161 tggccagcgt gcgcgcgtcc atcatgtcga agcgcacggt ggatttgaaa aagctggtgg
    59221 atcagctgcg gcacggcgcc gcgggcagtc aggagacgtt aaatatcctg agtcgcgtgg
    59281 agatcggggc cctggacgcc ctggaggtga acgtggggct gctgcgggcg ttcgtaagcg
    59341 cgctacagaa cgtctcgggc taccacttcg gcttcgtacg caaccacacc gtcttctacg
    59401 tgctgagcca cgccacgctg caggcggcgc gccagccgct ggacgccgcg cagcacttgt
    59461 acgaccacct ggagaagttc gtggcacgcg acagcggcgc cgccgccggc agcgagctcg
    59521 aggtctacga caacaccaag accctcgacg ccttcaaaaa gctcatcgaa gccgtgcgcg
    59581 agctcttcac catcgtcgaa tcgcagcacc cctttcccgc gtccggcgcc gcgggggttt
    59641 cgtccgagaa gcgcgccaag aaggacggta gtggcggcgg ccccggcggc gaccgcggct
    59701 cgcaggcgtt ggtgcggcag acgctggcgc gcctggagga gctcagacgc caggtggagc
    59761 cctacctcaa ctgccgcgcc gtggccgagc tggtggacat ggcctatcag cacgtcacct
    59821 actgggcctg cacactgatg ttctacaccg ccttccgcaa ggacaccgac acggcgctgg
    59881 accgcgtgct gctcatgtac tacttctaca cgcactatgg gccggtcaac ggcgatgtgg
    59941 ccgccgagtt ccaggagtac gtgcgtaacg cacgctccct caaagccttc ctggtctccg
    60001 acgtggacgc cgatcaacag cccggcgcgg aacaaatccg cgacgtcagc taccggctct
    60061 tcaccggcag cctgcagcag cgcgacagca ccggcctcac cttccccgtc atctctacca
    60121 agccctcggt agtcagcaac catcacctga cgcccgaacg gctcttcttc cacccggggc
    60181 tggtgacgcg actgctgagc gaggaggtgt cgagcacgca ggcctcgcgc caacgcctgg
    60241 agccgctaca gacagtgtgc gcgcggatca tcgatcgata cttcgccagc cagctcaagg
    60301 tcaccaagat gcaggacttg atcgacgtgg cccacgacct ggtggggcta ggcttcaact
    60361 acaacacctg cagcgcctac gcgcagacgg cgctgatgca gccggccaac ctgcgcagcc
    60421 cgctattcgt ggacgagacc aagaaccagc tcatcatgat aatctacaac gcctacatgt
    60481 tcttcctctg cctctacgtc tacagcccca ccttcttctt cgaacaccgg cggaggcaga
    60541 tcttggagca gaatcaatcc acgctggtag gctcccggga ggagctgcac ggcatctggg
    60601 agacggtgct gctcaacgtg cgcgcctact tccccctgcg gtacaccgag gagcagttcg
    60661 aggcccacac gcgcggcacc accaacgccg agcgcgagta cctgtaccgc gacctgagca
    60721 tcaagtgggg cacgatgctc ttcgtgctgc ggccgcgcgg gggacccggg ggcggcgcgg
    60781 gtcgcaccac gccgctgccc tccctggacg gggtgacgcg caacgacatc gtgcgacagt
    60841 gcggcatgct gcggctttcc gacggtcccg tctcctacga gccgctgctg gccttcagta
    60901 gccaccagga cttcccgcag gtgttcgcgc agctggtgct ggtgccgcag ttctcggaga
    60961 tcttcggcat cccgcagggt cagttcgaga cggtgggctc accacgtctc atgacgctca
    61021 tccagctgtg ccgcatcctg atgcccgacc aggtgacgct ctaccagaac ttggtctcca
    61081 tctacaacct gacgcacttc gtccgccagg tggacgcctc cgtcttcaag acggtgcgcg
    61141 actgcacgct ggagatcgcc gtcatcctct cgcagctgag cggcgagacg gtgaagccca
    61201 acatcgacct gctggtgcag ctcatgctgc agtccctctc ccacaatctg gccaccacag
    61261 tggaccccgt gatccgcgac atcacgcgca gcagcagcgg cagcctgcag aacttcattc
    61321 gccacacgcg cctctgttac tgcttggcgc tgagccgcgc gcacctgtcc aaggacatgc
    61381 agaccgtcta cctggagatc gagtcgcgtc acctgcacct gcccacggcc cgcttcctgc
    61441 aacagctcaa ggacctcata cgggccgaca aactgctcag cgacagcatg cggcacctga
    61501 gcgagcggct gcaggtcatc cgcacgcgcg tcaagcaggt gacgcaagac acggaagaga
    61561 tcagccgcta ctcgcgtggc cacccttcta ccacggagat gggacgctcg ctcaagaaaa
    61621 tgaccaccca gctgcggcag ctagagacgc gcgtgcagaa ctcgctgcag ggggcgcagc
    61681 gctccaacgg acgggtgatc gcctctctag agcgcgtgct caaaaccttc gaggtgctaa
    61741 gcacgcagaa cctggagcgt caggggttga cgctgtgcct gacggaagcc gcgggactgg
    61801 tacaggaggc gcgcagtttt cagccgttcc ccgtcaccgg gaccgccgcc ggctccggcg
    61861 tggatgcgga aaagacgttg cgtgatttct tcgaggggcc ctgggagggc gccgcggaac
    61921 cgcggcgcct gtccatgacg accaccacgg atagcgagca gatgccgccg ttccccgacg
    61981 tgatgggtga ccgctacgat ccgcagaacc ccataggcga cctattaaac tggtacatcg
    62041 tctcggtgga ccaagcgcag cgggacatct tctcgtcgat cgacccgccc gccgggcatg
    62101 cctcgcccgt cccgcggacg ccgcaaccat gaagaccttc caggccacgt gcgaccagtc
    62161 caaccgggaa cgcttcggcg cccgcgcggg gaaccaatgc gtgtgcaaca gcgcgatgtt
    62221 catccacgcg gcgcacctgc tgggactgtc accctcctcc cccctactcg cccaggaggc
    62281 gttggacgcc gtgctgcagg agggcgcccg gctggacgcg cggctggaga aggacctgca
    62341 aaaaaagcag cccggtaaga aactgcccgt ctaccggatg ggcgacgagg taccgcgacg
    62401 catcgactcg tccttcggca gcacggtgca cgcgctctcg cgccccttca acggaaccac
    62461 ggagacgcag gacctcggcg gctaccagtg tctgggcatc ttcgacttcc tgcgctacgc
    62521 ctacgccaag cagcggcccg tctacatgtt gatcatcgtc aactcgctag cacgcgccgt
    62581 gatcatcacc ccgcaggacc tcatcttcgt cttcgacccg caccgcacgt cgcaatgcag
    62641 caacgccgcc gcctaccagt gcgagagcct ccacgaggtg gtcatgctgc tgacgagctt
    62701 cggcgccgcc ctgtccaact tctactacga cgccctcttt ctctacatgc tggacctatc
    62761 ttcgggaccc gccctgcccg aggcccagat caacagcctc atcgtgacca cataccgcga
    62821 ccgcgacctc gaccttcccg tccccaccag cctgacgggc ccggcgtctt tgacgaccgt
    62881 ggccgcctcc gtcctacccg ccctacccgc accgccccag gtgtgccccg cctcagacat
    62941 ccctcccggt accgaccggc cactccccat ccctcccgac gacgccctcc cgctcgcccc
    63001 gctcgttccg ccacccaaaa agactccgga gaagcggcgc aaggaacccg gcgagagtaa
    63061 acatggaggc aagaagaagc cggcggcgcc cacgacgccc accagcggac aggccccgtc
    63121 ggccctggcg acgaccgcga ccccgtacag ctgcgccggc gcgctgcccg ccctccagca
    63181 gtaccagcag atggtcagcc agatggagca gcagctgcgc gggctgacga tcgacgcgcc
    63241 gccccagact agctggaccc tgtactcgtc ttctccgtcc gcggattccg gcagcggaac
    63301 ggccggaacc ggcggcgccg ccacctttga cgagtccttc ctcggcgacc gggtgcagca
    63361 gctgctgatc cacgccatca accacctctc gtgcctggag agcgactgcg atcccacctc
    63421 cacggccgcg cagaccgtca gcagcttcta cggcttcaac accggcatca acgccttcct
    63481 gtccaactgg gcgcaccacg gactcaacct gcgcaagatg cacgactacc tgcaacacaa
    63541 gaagtccatc tccagcgtcc tggaccgggc gctgatcgac aaaatgctca aggtcttcga
    63601 gccctgggcc cagcgtcacg gagccgccct cgtcacctgg gtggatgagc tgatgcgcca
    63661 ggtagagagg acccagctgt ccgacctgca gcgccgcctg gagaagtacc gcacgcgcaa
    63721 ccccgtgccc gtgaaccaga gcttcgtgtg tctgcggccc tccgacttca agaagatcac
    63781 gcagaccatc ggaacgcgac aggagtcgat ccagcgacag agggagaaga gccagaacct
    63841 ctacaaccag ctggcgggca tgctgatcag catcgacatc cacgatatcg gtagcaccga
    63901 aatcaacaag cgcgaggtgt ccaaggccct gacacaggtg gacgaggcgg cgcgccggga
    63961 gctgcagcag ttgggcaccc acaagatgct ggagctgcag caggacgtca accggctgag
    64021 cgtggagctg ctggcgcggc gccataacca gatcctggcc ggctttctgc ccctagagga
    64081 gctgcaggcg ctggagcgca ccatcgacca ggtgctggag gtgctcaacg acctgacggt
    64141 gctgggtctg tgcgagcccg gcctggaggc gggcttccag aacgtcaaag accagttcag
    64201 ctacctgatg acgggcaacg ccgtcaacga gtactcgctg ctggaggaga tcacgcgact
    64261 gcgtcagcag tacctgctgg ccacgcagca gcgcgaggac gtgctcatcc aggtacagga
    64321 cctgatcttc agtctggaga acctggtcaa ggacccctcc ccgcagcgcg gctcacagac
    64381 gacgctggcc atggtacacg agcagatgag ccagctgcag gccctgggcg ccctggacat
    64441 gcccgaggtg cgggcgcgtc tgcagaacgt ggagcgcggg ctgaacaaac tatacgagga
    64501 ggaggacgag acgcgcgagt acctccgcac gctgagttac gacaacccgc ccaccgatca
    64561 gggcctaaag cgctacggac gcctcaaggc catgttgcgc gacgacgccg acgcccgtct
    64621 gctgctgctc aacaccatcc tgcgcatctt cgacgacatg gtgaagcggc tggcgcggga
    64681 cgacacgctt cggccgcagg tcttcgacgc cgtcaactcg ctcatcaacc acctgccacc
    64741 gggctccgag gagatggaga acctgcgcgc ggccaacgcc atctattcgc agctgagcaa
    64801 gaagatggac gccgtggcca agacgccggc cggcgcggca ccgggcgatc ccaagcgcct
    64861 gcagaccctc aaggagctga cgtacttctt catgagtaac gatcagttct tcacgcacat
    64921 gctgaagctg aacgtgggcg ccgacgtgcg cgagctgtac gagcgctaca aacgcgagct
    64981 ggagcagctg cacgtggagc ggttggaaaa ggaatggcag gaggaggccg agaagctgcc
    65041 ggtgacctcg cacgacgacg tgcgccgctt cttggaccgc gcccctagca cgcgcatcct
    65101 ggcccgcgtg cagccccggc taatgacgcg cctgcacgaa ttcctggaca aggagaaccg
    65161 gcgccaggag gaagagcggc gccgacagct ggacgagtac cgacagatgg cgcaagcgga
    65221 cctcgcacgg gccgtggagt cagtgcgcaa cgatacgctc tcgaccgtgc ccggcatgcg
    65281 actggaggag acgcaggaga tactggccgg cctggatccg cgcgcgcaag aggaactgct
    65341 acgtaaattc aatcacgaca tgctgggggc gctgtcgcag ctccgaaaaa ccctggatga
    65401 ccgcatcagc cagtgcatgc aggacgtgct gtccggggag acggcgcgcc gccgatcgta
    65461 cgccgagcac gccactcaga cgcgcgcctc cctgacccac ctgcgccggg tcatgggtcc
    65521 ccgtctgatg caggagaccc aacgcaccct ggacgaggtg accaggcagg cgaccttcat
    65581 cgagcgctgt cagctgggcg acgccgagac cgtgttcacg ggcaccgact acgagcagga
    65641 ctacgcacgc taccgccagg gacagcaaca gctgcaacag cagctaaaca cggcccgcga
    65701 ggagctgacg cgcgccagcc aggacctgga gaacgccatc cgcgacccga aacagcttcc
    65761 gggaccaggc aagaaggaca gcggcgccgc ggcggccctg gccggcaaaa agggcatcga
    65821 cgctaggacg ctgacgggcc gcatcacacc gccgccggac aacttcggcc ggcccctgtt
    65881 caagaccatg ctggacaagc aggccgagac ggccaagaag gccctgcagg acgagacgga
    65941 actgatgaac cagaagctgc agtcgaccgt caaactccgc gaggaatacg tgacgtcgct
    66001 acagaaccaa tgggcagaac tggtaacgcg catgaaaatg gaatggctgg acgtggccac
    66061 gccggacacc aagtcgctgc tggagaaccc cgtgtgggcg ctgacagaaa tgctgggcaa
    66121 gacggtaccc accatgccgt acgtggcagc cgagcgagcc ctgcgttggg ccgccctctt
    66181 tatccaggag gccgtgaaac agatcagcgg ggacccctcg cacccgcagc gcgcgcagca
    66241 acagatgtac gaaacgctgc agcagcgaac cgcacagagc ctcgataccg tgacgcgtaa
    66301 cgtgaacgta aacgcggcgt gcgagaactt cgtgagccaa cagcagcagg agggaggcgg
    66361 actggcgggc acagccgacc cggaggtgat ccaagccgtg gaggccgcct ggcagcaact
    66421 ggatcccgct cgcgtggccg gcggcgagca gcgacaccag cgcgtgcgtg aaacgctgca
    66481 ccgcctgagc cagtcgctca ccgagctgga actgcaggac gcgctggtgt ccgagtatct
    66541 acaattgctg cacaacatcc agaccttcag ctacgggctg gatttcaagg cgcagctgga
    66601 caagatcgcc gacctcaaga cgcgcttcac cgacctggcg cgccagcgca acgtgcgtct
    66661 gagctccgac gcgcccctgc ccgacccgcg cgaccccaac gtgggcgcgt cgcacctgtc
    66721 gaccttcgtg cgcggcctgc aggccctgga gcgtcacgtg ctgtcggcgt tgacctatct
    66781 gacggaacag gtgaaccagt gcccggccat cgtgccgcga ctggacgaca tcccgcgggt
    66841 gatgccgccg gcccagacgg acggttcgct ggtgacgcag gaccggctga agcgtatgtg
    66901 cttcagccgc cgcgacgacc tgttcatcca ggtgctggac gtgttcggca ccgagcagtt
    66961 ggtgacgccc aagggcgagt ccatccagtt cacggccggc tacggcaacg tggtgttcaa
    67021 gtacctggcg ctgcggcagg acgagcgcag cctggcacgc aagtgctcgg gcctcaagaa
    67081 cgtggtctcg gtcaagtaca aggcagtgac ggtgtccgtg gccatcgcgc agaccctcaa
    67141 ggctttctgg ccccagatca cgcgctacga cctcaagccc tacttttccc agcagcagca
    67201 acagcagcgg gccgcacagg acgggggctc cgtacccctg ggtcccgcgc agccgcccga
    67261 agccaacacc ctgctcaacc tgaagctgtt ctgctacgtg gtgctcatgg cctgggacca
    67321 gcagatcgac ccgtggcagg agggcgggca gggaggacag ccgctgcgcc tgacgcccga
    67381 cgagttctgc atcgtcatga ccaccttctc ccctgagtac atctacacga tcatgaagta
    67441 cccgttgcag atgtcgctgg cctccctgac cacgggcatc caacgcgaca tcgtcaacaa
    67501 cgccctgagc aacaccagca tgccccccga ctactcgggc gaccaggtga agggcttcgc
    67561 cttcgaccgc accctgtggc cccaggtgtc gctgagcaag ctgttctggg actcggagat
    67621 catgcgccaa ctgtgtcagg cggcgggccc cgcgggccag agtcgccaac acgcgggcaa
    67681 gctactgatg tacgccctgt gcaccctagt gttcccccaa gacatgctgc actgcctgtg
    67741 gctggagctg aagcccaagt acgccgaggt ctacgcctcc gtccaggagc tggtgcaagt
    67801 gctcttcaag atcttctcgc aacagtgccg gctgctgaac gaagccaaca cccagaccca
    67861 gctgcccacc ggcgagcgcg tgctccaaag catccgcgtg cagcggcagg aacgcgagaa
    67921 gaacgacacg gacagcggtt ggggcggaac gggaggagac gactcggatc tcctcgagac
    67981 ttttattaac accgagaccg ccctggacat ggccctgggc tcttggctct tcggcatccc
    68041 cgtgtgcata ggcgtgtatg tgaccgatct ggccaaaggc cagcgtgtcc tggtcactcg
    68101 tcacatcgag tacacgaaca acgacccgga cttcaagaac atccaacgaa tcaaggatct
    68161 caacctcaac ccgctggtct ccaagacgtg gacggagacg ccgtacgagc agtgctggta
    68221 tcaggcgcag gtgctgcgtc tgcgccagta cctacgtcat cccgtgcgct tcgtttacac
    68281 accgctagtg gtgtatacgc cgcaggagcg gtacgttcac ctggcggtgc gaccgccgac
    68341 cccgggacag cggcacgaga tcccccgcct gacggtggag aatcccttcg tcccgtatcc
    68401 cctggacgag gattcctatc ccgccgacgg cgcaccgctg ccggccctgc ctcccctctc
    68461 ctcgtcgtct tcctcctccg cctcgggtcc cgcggcgacg gctccgccgg cgcccctcaa
    68521 ccgcgtgccg gtcagcatcg actttctgcg tcagaacccg ccgcccctca cccgtccgcc
    68581 gcgaccggcc tggcgccacc gacaccggac ggcggcagcg gccgccaact atcagcagca
    68641 gctgccggag agcagcgtgg atcccgaaga ctacgggacc tcggccttct tcgactcggc
    68701 gctgtccacg cagaccttca acgaccccat cttccagccg cagagcgtgg aagaggcggc
    68761 catgtgccgc gacgaactca tgaccgtggc gccgtcggcc gcccgcacgg acttcatcac
    68821 gccgccgctg acggtcctga cgcagaacat cctcagcgcg ctagagatcc tgcgcgccgt
    68881 ccggatagac ttgcgggccc tggcacagtc ggtcaacgag accctgaacc ggttacggtt
    68941 cctgtacctc ttgtgatgag gggcgagcgg acagatcggc acagaggtcg ggggcgagac
    69001 aggagaagtt ctttttccta gcgtctggtc cgggagacgg ccagcatgcg catgaagtcc
    69061 aacttgaagg cgttcttgtc ggcgaagaga ctcgacatgc gcacgtactt gctgagcatg
    69121 gcccccacca ccggatggtg attgttgtta tcgggcatca gttcggtcgg cagttccaac
    69181 accacgccgg cgacgtgacg ttgtttgtcg tcacgcttgt tgctcgtcat gccgccgacg
    69241 ctcccgacgc ccgccgcggc cgcgctagac atacccgacg tcggcggcac tcccgccgcc
    69301 gctcgggttc cgctggtgct ggtgatgatg gtggccgacg tggcaagcgg tctgtttaac
    69361 cagcgcgcag ccccgacaca gggcggcgcc gtcctcgctt tccaaacagc tgtcgcggta
    69421 ctcgcccgtc tgacagcgcg agcacagcag tccgtgtccg tgccacgtga gacgcagcag
    69481 acgcgggacg gtgacggcgc gcaccaccac ggtggagtcg caggtgcgcg aggcgcaggg
    69541 caggatcacg tcgaaggtca gacggtggtc gtagacggcg caggccgcgt tgaggcccag
    69601 caccgccttc cagcccacgc ggatacagcg caggccacag agggtctccg acacgagttc
    69661 gtagacgcgc tgcttgacca cccgctgact gccgcagagc gagcagtgca ccagctcggc
    69721 gttggtgttg aaaatgacgc tcttctcctg tcggtcccga taatagaaca tcgagttgag
    69781 cgggaagttc tgctgacagt gcagcttctc cttgcccaga ttgaggcaat ggccgcactg
    69841 acggcatacc acggcgacga gggagcggcc gtcgagatga cgctcgcact tgaggcgaca
    69901 caggcaccag agcggcaggt cgatgacgct gccgatgagg ccgccgcgca gcgccacgcc
    69961 caggccatag agaacgatct tggtgggctc tacctgtcgc gcctgcttcg cgacgccgga
    70021 cgcctgacca cccgcgcccg cccccgcgga gaagccgacg cgcgtctcgt cgtgcagtcc
    70081 cagcgagcgc agcggtacca ggtaacgcgg acacgtgtca caaaacgtct gcaccgcctg
    70141 tcgggccagc acgtacagcg ggttgccgca gggcacctgg ccggcgtgcc gccgaagggc
    70201 cgctatcagg gcctcgagct gcggcgagcg cggctgccta tcacgagtcc actcgttgcg
    70261 gtggtacacc ggcaggtcgg gtcggccctc gaagcgcttg gcgcgcagca gggctaggca
    70321 gggcgagctg gtggggtgca gcacgggcag gcgcaggtcg gcgccgaaga gaaagcggtg
    70381 caggtcgccc agcagcgagg cggtgacgcc gtccagcagg gcgttgagct tgtcggcggg
    70441 gtagagccgc aggcggcggt agaggtagcg ggcgtcgtag cgttcgaagc gcaggaaggc
    70501 caccgtcgcc gaaaccgcgt ggaagcagtt catggagtat acgtaggcta ggaagacaaa
    70561 gtaaggcttg gtcatcacca gccgcttaaa caccgacgtg accgcctcgc gctcggccgg
    70621 ccgacacagc agccactcgc gcagaaagcg ctggtagagc cggtcgccga gctcgcggtt
    70681 gagaaagcgc ttgtcggtca cgaagagatg aaggacacac gcacgctgcg gctggtgctg
    70741 cagctgctgc tggaaaaccg acggcgtctg cgccgcaagc tgcgtcggcg cctgcgccgg
    70801 atgtaccggc acttcgtcca gctgcagcgc gccgcggccg atcaccagct gcacgtggaa
    70861 atggtcatcg tggacgcaca gcggcccgaa gaggcgcagc aaggcctcat ggaaagcgtc
    70921 ccccgccgcc gcctcccagg aggagagcaa cgacgacata tcgccacacc agggccagca
    70981 gcgccgtcag agccgtcagc gccagcaggg tccacagcag cgagcggagc ggctccggac
    71041 ggagccacgc cgacggagat gagaaccagg aactacgtac ggactgacgc tggctggaga
    71101 ccggcggagg atagtccctc gagcgcccaa agcgcggcgc catgggccga cgttgctgat
    71161 cgtagtcgcg tcgacgacgc acgtcgctct tgggggacgt cgggggactc gtcgccgcct
    71221 cctcctctgc tgttgcctcc tctgcctctt cggcgtcctc caggtccacc tcctcgaatt
    71281 cgcatccgcc tcgtccccta caaccgcggc actgacagca cagacgccac gatcccgcca
    71341 acatcggcgg aggcgggggc cgcggcacgg gcccctgggg caccagcacc tggggcggcg
    71401 gcgtccgata cagccgcttc ttggccaacg acgacgcgcc tggcgacgaa cccgccgccg
    71461 ccgacgccgt cgtccgcgtg agcgaggcgg cggccccgaa cctgacagag gacgaggcgg
    71521 ggatcgcggg ggaagacatg cgcccgctga acagagaagc gcaacccgaa accacgccgg
    71581 ccgcgacgct gcgaccgacg ccggccgacg tcaccgagcc cgccgccgaa gacgacgccg
    71641 cctttttggc gtacagttcg cgcagcaggt tctcgtactc gttctcgttc tccggcccga
    71701 aggcgatcag ctcgatgttg aagaccgagg ccgagttgga gcggcgcacc acgcacttgg
    71761 tgagcacgcc gtaggccgag ggcttgatct cctcgatgtc cttgagcgtg acgatgagcg
    71821 actcgttcac cttgagcacg ttaaactctc cgacgtggcg cgccgagacc agcttgaccg
    71881 gcgcgcgcac aaaacaacag agggagacgg cgcagccggt gttcttaaag atgaagcagg
    71941 gcacgtgatc cgtgcggctc tcccagtagc tcagcaggta ctccacgcag tacaccgtgt
    72001 cggtctttaa catggcgtcg cacaccgagt agttggggtt cttgcagatg agcccggcgt
    72061 ccgtgacgcg cagctcgctg gggcccagct tcaggatgcg ccgcgtggcc tgcaccaggt
    72121 cctggtgcag acccttgctc atctccatcg cgtccgaccc gcaaccgcgt cggcgtttta
    72181 tttacccgac gccagctcgt ctttgccctc caggattccg ttgatatcca tcagcttggt
    72241 gacgatcgcc gttaatagtt gggtcttctc gcgcaggatc tgcccgtgac tgcacgaggc
    72301 gcactcgccg tgcacgtact tgaggaaggc ggcgtacttc tggcccgcgt tcacgaaatt
    72361 taaccgcgcg tccagcgagg gcagcagcag atcgtaaacg cgcggtaaca tcggctcgaa
    72421 ctgcaccagc aggtcatctt ccgcctcgcc cagcccgtac tcggcgtcct cgtcgatcac
    72481 cagcggcgga ggcactgagg aagagggcga gtcctcgccg tcgtcgtcgc gactgtcgtc
    72541 tacctcgaac ctcccctctc cccctttata atcatctacc tcacgacccg ggtcttctcc
    72601 tccgagctgc ggaggcggcg gcgacggtgt cgtcgtctcg cgacctctca gcgtcgccat
    72661 cgcaaccggc ggctcccgct agcgcactga cttctcccgt ctgatccccc aagctgtcga
    72721 gccatgaatt ccacgatggg cctgggcggc gcccctattc cgccccgtcc acccacggcg
    72781 ctgtcgtcct cggcgatcca cgcctcctcg gtcttcgccg acctctgcag ccccccgcgt
    72841 ctcgagcacc cgccgtcggc ggcacagctc caagacccgc acgcctacca ccaccagcag
    72901 cagcaggctc accgcgacgg cctgggcgcg gcgacggtag gcacggcggt cgtcgtcacc
    72961 gcaggctcac gctacacggg ctggagcgcc gaacacaccc agtgggactc ggaactgacg
    73021 actgagctcc tgtggcacgc gcatcctcat caagtagccg acgagcccgc ggcggtcgtg
    73081 cccggggggg tccagctcct gtccaacgcc gacctgggcc tcaacttcga cgaccacgcc
    73141 atgtcggtga ccctcagctc cgccggccac cgcagcgcca cgcaatccac cgtggccacg
    73201 gaggtgctgc acggcggggg cagcggcggc ggcgccgcct cggcctgcga cctggacgcg
    73261 gagctggccg gcatcgacgt gaccgacccc gagcgcctgc ggcgcctctg cgcgccgctc
    73321 tccatcgaca cgcgctgcaa cctctgcgcc atcatcagca tctgcctgcg gcaggacgcc
    73381 gagcagacct ggctgctcga ctacagcctg ttgtgcttca agtgcaacta cgcgccgcgc
    73441 acggccctca gcacgctcat cgtcatgtcc gagttcatcc acctgctgcg ccgccacttc
    73501 cccgacctgc acgccgacga gctctttcgg caccacgtcc tcaccgtctt cgactttcac
    73561 ctgcacttct tcatccaccg ctgcttcgag aagcaggtcg gcgacgccgt ggagaacgag
    73621 aacatcacgc tcaaccacct ggccgtggtg cgggcgctgg tcatgaacga ggacctggcg
    73681 ccctacacca agatgcggcg cgcctgccag cccaagcaga aggcctccgc cgcggccgcc
    73741 tccaagacgc ccgaggcgcc caaggcgctg ctcaagagct tcgtggagcg cagcgacccg
    73801 ggccgcgacc gcttcgtgca gctgctcttc tacatgtggg ccggcaccgg cgtcatgagc
    73861 gccacgccgc tgcccgagct gaccgagatc aagttcaacc gcctggacgc gctgacggcc
    73921 gagggcaacg acgtcaacca cagcgacgag agcctccccc cgcccgagat ccgcaaggcc
    73981 gtgggccccg tctacctctg ccccgtgccc gtgttcctca ccaagaacca gaccagcacc
    74041 gtgtgcctgc tgtgcgagct catgtcctgc tcgtactacg acaacctggt actgcgcgag
    74101 ctctaccgcc gcgtcacctc ctactgccag aacaacgtca agatggtcga ccgcatccag
    74161 ctggtgctgg ccgacatgct gcgcgactgc gcgacgccca tgggcgccgt gcaggacgac
    74221 gtggcgcgcc acggggccca ggtgccgctg gccgactgcg ccgcggcgcc cggcgcgcgg
    74281 cccgacgccg tcttctgcca cgtcctgcga caggtgggcg tcacgggcat ctacaagcac
    74341 ttcttctgcg atccgcagtg cgccggcaac atccgcatca ccaacgaggc cgtgctcttc
    74401 ggtcgcctgc accctcagca cctgcacgag atgaaactgg gcatctgtca cgacaattac
    74461 tatataagcc cgctgccacg ccgggtctgg ctctacatcg cgctcttcaa agcttttcag
    74521 attgcaaaac gcagcaacaa gagcaagacg cagctcacgg actttgtgcg cgacttcgcg
    74581 cagctgctgg agcagagcgg catcaagctg gtggagccct cgtacgtggt ggacaagtat
    74641 gtctgagggc ggcgacggag cggcggcgcg gcgtcccgcg gccggcgcgc ctcgccgccg
    74701 cgccaacagc ggggtggtgc gcgggaccct ggagcgccgc tcggccctgc gctcgctcta
    74761 ccgcaagcag cagcgacggc ggcgccgcgg cagcggctcc ctgctctcct gctcgtcgtc
    74821 ggtctcccga ctggcgtcgc cgtcgacgtg gctggagtat gacgacggcg gcagcggtag
    74881 cggcgagacg cggacggacg gcgccgagcg cgacggcgtc ccgcgcctca cgctgcacga
    74941 cctgcacgac atcttccgcg agcaccccga cctggaggtc aagtacctca acatgatgaa
    75001 gatggccatc acgggcaagg agtccatctg cctgcccttc aacttccact cgcaccgcca
    75061 gcacacctgc ctggacatct cgccctacgg caacgagcag gtctcgcgca tcgcctgcac
    75121 ctcgtgcgag gagcaccaga tcctgcccac cgcctccgac gccatggtgg ccttcatcaa
    75181 ccagacctcg aacatcatga aaaatcgcaa cttttattac ggtttctgca aaagcaccga
    75241 gctgctcaag ctctccacca accagccgcc catcttccag atctactaca ttctgcacgc
    75301 cgccaaccac gacatcgtgc ccttcatgca cgccgaggag ggccggctgc acatgcacgt
    75361 catcttcgag aaccccgacg tgcacatccc ctgcgactgc gtcacccaga tgctgacggc
    75421 ggcccgcgac gactaccacc tgacgctcaa catcgtcagg ggccacgtcg tggtcagcgt
    75481 cctgtgtcac accgtctcgg gcagcagcgt caagatcgac gtaaccatcc tgcagcgcaa
    75541 gatcgacgag atggacatcc ccaacgacgt gagcgagtcc ttcgagcgct acaaggagct
    75601 catccaggag ctgtgtcagt tcagcggcgc cggcggcggc tacgccagcg ccctcctgtc
    75661 ctcgtcctcc tcttccgctt cgcgttcggg cggcgccacg gctcagtcgc cgacgatgac
    75721 gacggcaaca gcggcgcagt cccaccatca tcaccaccat cacgccggca ccgcggtcca
    75781 gcccccgtcc gcaccacagc cgccgctgtt cctcaacagc attcgtgctc cttgacgctg
    75841 tagggcagaa aggccgcctc caggtgcaga cgccgcggca gcaccatgct gaggaacctg
    75901 tccttgcggc cgatctcgcc ctcggggaag atgggcgaca gcacgttcgt cacggccttg
    75961 agcacctgat cgaagtactt gtcggcgtgg atgggcacgt tgtgctcgcg cacgtacgtc
    76021 ggatcctcgg ccacctcgta gttacacacc cccgacgagg agcggccctc gccgggcgcc
    76081 gtcagcacgt agaagactcg gtcgcccacc gacggcagct cctcggagcg ggccgccaga
    76141 cgcttgatga cggcgatgtg cggcaggttg gactggcggt acagcgagat gtccttggac
    76201 agcaccgacg acagcaccag gtcctcgacg cgcacacggc gcaggtacag gtcgtcgcgg
    76261 gcctgcgtga ggcgccacag gatgggccag aagcccgccg gcacgccctg ggcgcgcacg
    76321 tcctcgagcg tgaggcgcga gaggcgcacg gccgcctgcg agacctcgcg gtcgtcgaag
    76381 agcaacgaca gcacgtcgcg cgtcacgccc ttgacgaact cgcaggccgt cttgcgcacc
    76441 aggtccacgc ccttcatgct caggcccgcg gcgccctcca ccttgccgat gtagcgcttc
    76501 ttgcagatca tcatcagcga cacgaagacc ttctcgaact cgagcttcac gggctcgttg
    76561 aacagacagg ccgtgacgta gtcggccaga gcgggaccgc gcgacaccag ggcctgcgcc
    76621 gtcagcccgc ggtagtggac gaacacgctg tccgtgtccc cgtagatgac ccgagcctcc
    76681 accgtccagc cgccgctacc accgccgccc cgccgttccg cctcctctcc tactctcggc
    76741 ctcttatacg gtatgtggcg atgaagccga cgacgggtcc gtgtagcggt ggcaccggcg
    76801 gcggcagtaa agactaagga atgagtcctg ccaccgaccc cgttctcccc tcctccacca
    76861 ccaccttcct cctccactat catctccaga tccccgtgta ccacatctcc ctcctcttcc
    76921 tcctcttccc gcgcgtcctc gtcctcggag gcgaccgcgt agtcctcttg attaaaaaaa
    76981 ttgcgtaaga aacacggctc cgagaaattg tcctcgatga agcgcgcggt gcgttccagc
    77041 atgtcgcggc cgatgcgcgt gatgctggcg gcgatgggca ggcacggcat catgccgttg
    77101 accacgccgg tgaagccgta gaaggcgttg caggtcacct tgagggccat ctgctccttg
    77161 tcgagcagca tgcggcgcat ggggtcgcgg cactcgcgca tgcactcgcg cacggccttg
    77221 cgctgcgaga cccacttgtt gagcagctcc gacagcaccg agacgcgcac cgaggcccgc
    77281 acgaagcggt gggtgatgcc gttctccagc gtgacgctgt agacgtcggc ggggtccacg
    77341 gggtactcgc cgccgggcac cagcagggtg gagtagcaca ggttgtgggc catgatgatg
    77401 gaggggtaga ggctggcgaa gtcgaagacc gccacggggt cgttgtagta gcccaccacg
    77461 ggctcgaaga cggtggcacc ctggtaggca gcggcagccg acgacggggc cacggccgag
    77521 aggatgccgc cgttggtgcc cgtgacactg ccgccgccgc tgctaccgct acaaccgccg
    77581 ctagtgccgc tcgcgccgct gaccgtggac acgccgtcgc aactggacgt ggtttcttcc
    77641 gacgagaccg gcgtcaaggc gttgaagacc gccgtggccg aacccacgtc accgggcgcg
    77701 cccgtgacgg cgccggccga gaggatcgac gtgttggaac tgccgtcggg agacagcagg
    77761 ccggggggca cgctggcgaa gacagccgtg gcggcgttgt tggcgacggc ggcctcggtg
    77821 ggcggcgtct ggtagtggtt gggcaggatg tagtcgcggc aggcgcactc gtcaagcagc
    77881 gaggtgtaga tgcggatctg ctgcccgtcg aagatgacgc gacgcatggg gatcttggcc
    77941 agacgggcga tggcgccggc ctcgtagtgg aagttgatgg tgttgaagag atcgcgcacc
    78001 aacagggcgt cctgcaggca gtagcggccc acctgcgcgc gcccctgcgc gttggccacg
    78061 aacttcacgg ggatctcctt gtaggacagg tcgtccttgc gctgacccag atacagctcg
    78121 gccatggtgt tgagcttgta gttgggcgag ttggtcttgg ccatgcacac ggggtacatg
    78181 tcgaccacca cgcagcccga gatgtacacc ttggtgggcg cgttagcggc ggcggccgcg
    78241 aacgaggcac gatcctggtg gcgccgatag agcgtgggac tgtggaggaa gaaacggccg
    78301 ccctgagcga cgggcacctt gcagaagcgc tgcacgtcca gcttgtagag gtactcgagg
    78361 cgcgtgagga tgtacttcaa gtcgaaggag ttgatgttgt agccggtcat gaaagacggc
    78421 gcgtaccgct gaaaaaagag catgaagccc agcagcagct cgtactccga ggggaactcg
    78481 tagacgtcgg cctcgcccac gggatcacag gtaccgatgg tgaagaggtg cagacccgag
    78541 cgaccgaaga cggggggctg cgcgcccacg cccgcagtcg ccgcctgcgg gtagtaggga
    78601 atccccccgc tctccccgtt cccgtgatga gactgtgtcg gcgccggtgt cgcacccccg
    78661 ttgacgccca ccccgccagc gccgtcggcg ctaccacccc ccgtctcgta gcagacacac
    78721 gagatctgaa tgacgatgtc gtcgggcttc tcggcgcagg ggaagccgcc gtctgcgctc
    78781 atgcactcga tatcgaagga gaggcagcgg tagagcggcc aggagttgtc gtcgggcacg
    78841 gccacgaggt ccgagacgtc gcagtcgacc tcgatgtcgc aggtcgacga gcggccctgg
    78901 tggcgccagt cgtaacggtt gacggagcac cagccgaagg tggtgatccg ccggtcgatg
    78961 accaggcgcg tcagggggtc cacgcgggcc tcgtagacgg ggaagccgcg ctccagcagg
    79021 tactcgccga tctttctggc catgctccag ttactgatcg acacacactg caggtcgggc
    79081 acgggccgcg taccgtagcc gtagatggag gtcttggtgg ccggcgtgac agacatggcg
    79141 tagggggtcc ggggctcggg caccagctcc cccacgctgg cgatgacctc gcgcaaccgc
    79201 tcggtgtcgc cgtactcgca gtaaaagtag gtacgctgcc cgaagacgtt gacgcagatg
    79261 ctgtagccgt gctcggtggc gccgaagaaa cgcagcacgt tgcccgaggg caccagatgc
    79321 ccgcggtagc gcggcgacac gttctccggc gagtcgaaga agagcacccc gtccacctga
    79381 tcgtaggtgt gaaagcgaat gggccccacc acgcgaccca ccagggtctc gcgcaaagga
    79441 cacggccaga tcaggtcggg agtcaacaag tgtttaatct cgcggtaaaa catgatggga
    79501 acacggccag tcttgtgctt aatcagtccc gtctgaccgt cgaacatcac gccccgcggc
    79561 acgatctgca tgaactgctt ctgcacgccg gagcgcttgc tggtgggcag cggaaagcaa
    79621 gctccctcgc tgctgctact gttgccgccg tcgctgctct gatcctggcc gctactgccg
    79681 ctgccgccgc catcgaactt gccggggcga ccgcggcgcc tcggcgtcgt ctgctgctgc
    79741 agcggcgact gttgcgaacg acgtccgcga ccgcccgcgg ccgcgttgat cctgcaattc
    79801 ccgactaaac caccgccgcc gacactcgta ccgacatcag cgccgggccg gtgaggaccg
    79861 gcgttcaagt aaggattgaa aaacatgccg cggcgagcgg aacctgacag aggtcgggac
    79921 tctacaggaa aagtcaacac acactaccag tccgttatct ggcgtataat tatgtttttt
    79981 tgggggggtt tacgagtctc tgtctctcta ccttgtatca cacgtcctcc tcggaaccta
    80041 ggtgttggta accgtttttc cgatgccgga tcctgtcgag caaattgggc ttgggcggct
    80101 tctgctgcgg ctgctgtttc ttgttgctgc tgttgtcctc ggaggaagca ccgttgttgt
    80161 ctctgctcat cgggggtgcc gacggcgcga ccacgatgtt gggagcgccc ttgtgttttt
    80221 gcggccggtg ctgcgcgtcc agccgctgga gggccaggag catctgaaac gcttgttctg
    80281 tggtgtaggg ctgcacgctt gtggtcgcag acttatggcc agaattataa acactgtctt
    80341 cgtaggaagg cggagcttgg ttcgaagacg acggcgcgtc cgacgtgctg gtgacggtgg
    80401 tgctggagct gcgcgactgg atcatgtagg ggaagagctg ctccagcggc tgcatgtaca
    80461 tgcgacgttg gcgcgtgtag atcaaataaa tgataaccag tacggccaag gcgacgagga
    80521 tgatggtgaa ggcgccgaag gggttcttga ggaaggcggc gacgccctcg acgacggagg
    80581 ccaccgcgcc gcccacggct ccgatggccg tgcccaccgc cttgccggcg gagcccaggc
    80641 cgctcatgag gtcgtcgagt cccttgaggt agggcggcag cgggttgacc accttgtcct
    80701 ccacgtactt gacacgctgc ttgtaggagt tgaactcgcg catgatgtcc tcgagatcga
    80761 agacgttgct ggaacgcaac tcctgctgcg agtagagctc cagcgccctg aagtccgtgt
    80821 tctccagcgg attgatgtcc agcgcgatca tgctgtcgac cgtggcgata gtgctgaggt
    80881 cgatcatgcg cttgaacatg tagtccacgt actcgtagga cgagttgccg gcgatgaaga
    80941 tcttgaggct gggtagctgg cactcctcgg tgcggtggtt gcccaacagg atctcgttgt
    81001 cctcaccgag ctgcccgtac tgcacgtgag agctgttgac gaaggtgaac atgacgacgg
    81061 ggcgcgagta gcagcggccc ttctccttgg tgtgcatgtc ccgcagcacc ttgacgctgg
    81121 tctggttgat gttgacgcac tgcgccaacc ccagcacgtc gcccatgaag cgcgcggcga
    81181 tgggcttgtc gtagatggcc gagaggatgg ccgaagggtt gatcttgctg agctccttga
    81241 agacctctag ggtgcgccgt tggtccacgc accaggcctc ggcgatctgg gccaaagctt
    81301 tgttgatgta gttgcgcagc gtgtcgtagg tgaactgcaa ctgagcgtac atgacgttat
    81361 ggatgacgtc cgtgctgttg taagagagct gactggtgct ggtgtctctt ttgtgcctgg
    81421 tgccgtttct catcctctcc aaggtctcgt tctggatctt ggcaaaatct tccagatcag
    81481 ccagggactt ttgcttgatc ccctgccaga agaccaccag tccgccggtg gtctcgaaga
    81541 cctcgacctt accgtgcttg acgtaggtct cgttgtagga agaattgaac atagtctcta
    81601 gctgagtcag ggccttatcc ttgatacagg ccaaacctgg gtccgagatg ttaacagggg
    81661 tcttcttgga gaggaaggtg gccgtcatct tggacgaggt gaagtgaagg gagtcgtggg
    81721 tctcggcgcg gatggtgcgg tctgaactct cccagtaggc gtactgacag gtggtattct
    81781 gctcatcttc cacgtcccag gagagcacgg agtcgccccg ctccaaaaag gccaccagct
    81841 tgtgggtctt cttgtgggaa ttccactgcc catagtcctc gaccatgctg tagttggcga
    81901 tcaggtagaa cttatcagcg ttctccccga agtacttccc gttggtcttg ttgtagaagg
    81961 gagagatgtc gaccacgtca ccggtggagg tggcgaagaa gtgatagggg tacttggagc
    82021 gggcggtggt caccgtcacc atgcagttaa ggctgcaggt ctcgcggtag agccaggtgc
    82081 tgccgcgggt gtggtactgc tccttgacgg tgacgtagcg ggtgctatgg gtgttggagt
    82141 agtcgtcggg gatgagcttc atggtcttgt tctcgtagct gtcctcgtga taggccacaa
    82201 agacggtgtc ccccatgacc ttgctgtagg aattgtagca ctgtccgttg ttattgatga
    82261 aatgcacctc ccacatgggg ggtggcacgt actccgtgtt ggagcccagc aggtaggtac
    82321 tgtagatgta ggcgtagctg cggcggaagg tgagcacctt ttgaaagaca cgtaccttga
    82381 aagtgtgcgc ctggatgttg cgcttgtaga ccaccatcat accttcgtcc aggtcctcct
    82441 tggtgggctt gaccgaggtg cagtggatgt tccggtcgaa gcggatgagg tccgtcccct
    82501 gggccatgga gcagacacga tagggatact tgctgatgtt gaccccgatg acatcgtccg
    82561 gccgcagggt ggtgttgaag atgtattccg taccgttggt agtgctctcc tgctgagtcg
    82621 tccgggtggt cgtacgaccg gaggaagaag acccacctgg cacagagggg gtgggtggtt
    82681 gtccagacgt gctagatgac gaaggagctc catacacgcc gccggaggag ggcgtccgca
    82741 gcaagctaac gcagactacc aggcaccaga tcttggccca catggtcgat gcgggccaag
    82801 tccagcaacg aggctgcgtt gcgggtccgc ttgcgggacg agatcacgcg cgaccggcgg
    82861 gccgtggagc acagggacga ggtggacgac gaagaagccg acgagaggag ggcaccgggc
    82921 ggcacaggtg gaggtgccca agcctgttgt tgcgggttcg gctctcggaa gacggcaccc
    82981 gctgttggcg cgtcgccact ctcatccggt ctggacaagt gccggtagag gaggaggtaa
    83041 aggtccttgg acttataaag acttccctcg tgacgaagca ataatggcca ctctttgtta
    83101 tacgtgagga tgagatcgcg gtccgggttc aactcgtcgc gcaggcacgc gatcgacagc
    83161 tgttttccga aagtttcgtt atatagtgcg accgacaaca cgagctcgcg aacgtgcatc
    83221 cacatctcct tctgcagaac gttcaggtcc tggcactcgc tgaagttgaa gaagctcatg
    83281 tacttgacca ccatccactc gctggggtac acggtgccct cggcgcactt gaccagatcg
    83341 tccttggcgt gggggagcac gcctgcgtta tcgcaggcgt aggccatgtc cacattgtgc
    83401 gacagggggt agcggtcggt gcagtgggtg aacaggggtc cgttgcagag ttcgtagatc
    83461 tgctggccca acagagggag ggactcgaca ggaaggctct tgtggatgag gttgttgacc
    83521 acgtacaggt gctcgtcgta ggtgagactc tggcccacgt ccagcatttc gcggtcctgc
    83581 ccgtagcggc tgcggtagat gaagccgttc atcatcttgg agaggaaatc gaggcacacg
    83641 gggcccacca ggttgacgtc gatgagcttg gtagtcagcc gctcctgggc cttgatgcag
    83701 cggatgactt tgccgtagcc cacctccgag accttctgca gataggcgcg cttgcgcacg
    83761 ttgacctcgc gcgtgacgtt gtggacgcgc gagcgggcgt ccaaggggtc cagggcctcg
    83821 tgctcctcct caccgcgggg ggcctgggac agggtggcgg cgccccccgc cgcgctcctc
    83881 cgaccgcgcc cccgaaacct gctactcccg ttgtggccgt aggtacccgt cccctccatc
    83941 gactcctcct cctccgtcct cgacccagtc ttcgggtgca tctgcgggtg gcgcgaagtc
    84001 ccccgctccg gcccgtcgcc ccccgtgcca tcgggcagcg gccgccggat ttcctcgagg
    84061 atgcgcttga ttttggtgta catctcgttg ctttcgtgga gcttgttgaa cacgggattg
    84121 tcctcgaagg cctgaatgct gagggacgta atgagatcga tgatcctgct gggggcggca
    84181 aagaccgagc ccacgaacat gcgctcctcc ccggccagca ccttttcccc gagcgcgaag
    84241 atgtcctcca cgtcctcccc gtacaggtgg cgactgatgg tgttcatgag cacccgacac
    84301 aggtggtggt agacatttag ctgctggatg gtgaccccca cccgcttgac tataacctcc
    84361 gaagtacggg accagtaggt aaaatccgac aaggaatata ttcgttccgg tatatccgta
    84421 aacaggttgt actccctcag cgcctcctcc gcctcctgga tgtagctgtg gtaggccgat
    84481 gaagaagaaa agaggctttt gagggccgaa aggaccccag ccaaacgggg gatgcgctcc
    84541 gtcaactcca aaaggtcctg ctccaccgtt tggatgttca catccgactg gctggagggg
    84601 cgatgcaccg ctatatggtt gcacagcaag ccctgcagcc gcttgttcag cgagcggccc
    84661 tggttcggga tgatggtcag ctcctcgtag cactgcgcgc acgtcgtccc ttcgacgtag
    84721 gcttcctgac gcgccaccgg cgagatgccg cacaggcgtc gcagcagcgc cagcagctgc
    84781 gtgcacacct ccaggccggc ctccggtgcc aggatcccgt acacgtagtt catcttgcac
    84841 agaaagcgct cgatgtcgtt gagcgtggcc aggctgacgc tgaacctgac gctgtcggtg
    84901 aagcgcaact ccaccgtgtg atggcggtcg cagtgatcca aacgcagcac cgtacggtag
    84961 aaggccgccc ggtccgggtg gcgcgagtag gccgtcagcg cccggtccag cagggccgta
    85021 tcctcgtgca gcgccttcag cagcatctcc aggtagagcg tcagcagcga gctctgcgta
    85081 cggttctgcg ccaccacctc cggatagatc ttcctgtaca gatacacgat agccgctgcg
    85141 tttctcttga acggcgtgca ttccgccagc aaaacgttgg gatcgcagta ttttagacat
    85201 tccagctcca tggcgtattc gttgcatttc gaacacacta cacagagttt ctgcaacaaa
    85261 ttcatcgccc gtcccttgct cggtcgcgta cgacactgcg tcacccggcg ccgcgccgga
    85321 cagagacatg gggccggcgc gcaaataact ggctacccgc tccgcgcgcc ggctgacgtg
    85381 gacgttaata tagaaccacg tcgccgtcgc tccagccttg gcccgcggcc cgccgcaggc
    85441 cggcgtctct ctcaccccct ccttctcctc cgcctcacaa gcggctgcgc ttggccggca
    85501 gcaggcctcc ggtgcccagc cccccgccgg cctcgtcgtc cgcgccggcg agaaaggtgg
    85561 tcgtcgtggt gccggtgccc gcgcccccgc cgggacccgc ggtcgtctca cccaggacgc
    85621 cgaagcccat ggcgttgccc agcgacgggc ctgaggcgcc gccgccgccg ccccccacca
    85681 ccaccacgga ctccaccgag ggcgcgaaga gggccgagag gtcgtgcacc tcccccccgg
    85741 cagccgcggc cgccagctgt tccgagccgg cgtccagcac gcgccgcagg ttctccaggg
    85801 agaagtcctc cacgccctgc tcctgcagcg ccgcgaactt ggccatgagc gaggtggcca
    85861 gcgcctcgca gccgtccacg aagaacaaga cgtcgtcacg ctcgggaaag tcctcgcggg
    85921 tgctcatgat ctcgtagagg gccatgacct ctggatcgca gtcgggattc tccgagtcca
    85981 aggccgacat gacccgactc ttggtcaggt cggcgtcgaa gagcacgttc tcgcgccgcg
    86041 agcgcttaat cagcacctcc gagagcttag tggccagcag acagcgctga cgcatgaagc
    86101 ggtagtcgtg accgcccaac gagctgacgt tgaggttccg ctccacgccg ttgcccgaga
    86161 agtagccgat ctgaccgaac tggtagatct ccttgctgtt gttgacgccg gcgtacttct
    86221 cgatgctgaa gggcacggtg accagggagc gctgctcgaa gacggtgcgc accagcgact
    86281 cgcgggccac ggtggaggcg aagggcggcg gcacgccggc ggccttgagc tccttgacgt
    86341 gcagggcgaa gtcggccggc gaggcgaagt tgggggtggc gcccaacacg tagggaaact
    86401 gggcgtgatt ctggcacgtc agccgggtgg tgaggccgtg cagcgagccg atgtagtcct
    86461 tgaagccgta gtagcagagg aacttgttgt ggaagcggtt ctccacgtaa ctgagcacgc
    86521 aatcgggcgg cacgtcgatg aggtcgtgat cgttgtagtc gctggtgacg tgcaccagga
    86581 acttgacgaa agcgttgaag tcggccatgt cgccgatggg cacgttcttg ggcagagcgt
    86641 tggagcagac cttctgccag aactggaggc agggcacgcc gcagccgggg aagaagcgct
    86701 cgtggtggcg gtagagcagg aagcccagac aacccttggc cggattcctc ttgacgacgt
    86761 gatcgcgccg aaagaagacg ctggcgctgc cgcccttgcc cggccgcgag atgggccggt
    86821 tcttgacgcg gaacatgagg aggctgggca ccgagaggcg cgagagcttg atctccatgg
    86881 gcaccaccgc gtacgtaccg cgaccgtaga gcctgaagtc cagcaggcgg tcgtggtccg
    86941 agttcttgga cgacttgatg ttcttggtaa acaggaaacc tttcctggac gaagtggtgg
    87001 agaacgcccc gtggatggat tgaaagtgtt gactcaccca cttggaaacc aggctggcgg
    87061 tgagggggtt gtctacgatg taggaggcgg cggtgatgag ggccacgtgc tggatgacca
    87121 ggaacaccac cctgaagtac tcgtaggaga gcagcgggtg gaaggcggcg gcgtaggggt
    87181 tgaggtccag gttgaaggcc tgcgtggcgc ccaccacctc gtcgcgactg ctcttcatgc
    87241 gcacctcgga gacgaagctc atggcctcgt cgtccacgaa cttgttgagg gccgagaaga
    87301 cgttgacgaa gtcgctccgc ccgctgacgt tgaccgtgtc ctcgccggtc agcgggtcga
    87361 tgagtcgcat cttgcggcag tagtccagga tgcgatgcag gcgatgggtg cggtccacgc
    87421 tggcgctgac cagacggccc gagccggagc ccgaggagga ggccgaggtg gaggacgagg
    87481 cggcggaggt gacgccgacg ctcacgccca ggggatcgtc gcctttccca tccagccccc
    87541 caccgacgtc cttggactca gcgctgtagc ggcggccgaa ggtgcccagc acatccacgt
    87601 cgctgagaaa gcgcgactgc atgaccacca cgcagggctc gcgcttgggc agcttgtgga
    87661 tgacgggcag gcgggtgcgc acgcggacga aggccgtgtt gtagcaggtg tggcagcagg
    87721 tgccgccgca ggcctcgcac aggctggagg cgcagcccac gatgtggttg ctgagcgtgg
    87781 aggcgcccga gaggcccgtg ttgtagatgc agacccggtt gaggtgccag acgaagcccg
    87841 agaccagctg cggacaggtg gcgcaggcca gggccaggtg ctgaggcccg tagcgctcat
    87901 ccttaggtac cacgccctga aacttgatga cctttcgccc atcgttgtag gtgtcctcgc
    87961 aggcgctggc caggccgttg gcgaagtgga tggacttgag caacgactcc tggctggccg
    88021 ccgcgccggg catgctcttc atggacgaga ggtaaaccag acggttgtag tagagcaccg
    88081 agttggaact gaagaccagg gcgctgacgt gcgtggacag gtgcagcttg agctcgttga
    88141 gcgcgcggat gaggtcgcgg tggtcggcgg cgcccgtgac cacgggccac tcggcgaagt
    88201 tcatggagtc ggcggcctcg taagccgaat cgaagaagac cgaagcgaag ctgaagccca
    88261 gctcgcaggt gacggcgtcg ctgagcatca ggtggtcctt ctccaggctg ctgagcttct
    88321 ggctcatgta gccgaagtag cgcttgtgcg gcgccagctt gaccgagtgc tggctgtcgt
    88381 gcacgaactg gcgcagggcc gcctcgatga ggatgcgggt ctcgccgaag cgcagcgact
    88441 gaccccagga ggtgtacacg tagtagaaga gcgtctcgct gacgtcgggc acgtagaggc
    88501 cgcgctcttg cacgaaggcg ctgcgcgtct ccagggagac gtcgtccgcc tcggcgtcgg
    88561 gctgcagcga gttgaagagg gtgggcgggt agagcggcac gcgcagcgac tcgcagccgt
    88621 gcaggcgcac cgaaacggcc tcctcggggc agggcaccag ctggcccgcg taaagaaact
    88681 ccttgagccc attgcccaca gccacgtgcg ccgtgacctc gtccgggtca cagcccagcg
    88741 aggcgcagag ggccgccagg tcggtgggcc ggcggcccgg ctcggggaca aaggtctcga
    88801 gcccgtactt gagacgggtc tcctcgcaga gccggcgcac gtcgccgtgg tcctccgaga
    88861 agtccacgat accccgcgtg ttgtgaaaga acaggacaaa gggacagaag gacgtgacct
    88921 tggtgagcac gccgccgtcg tagcacagca cgggcgtgcg aaccgagacg gcaaaatcgt
    88981 ggtccaccgt gaggcccacg agcagaggag cgatgaccac gggcgagcag cgatcacaga
    89041 gcgagagcgc cgccagaacc tctcgcgtct cgtcgcccag cttggtcagg tacagaaatg
    89101 ccgcgggccc caccggcgcc acggcggtga gttcctcgcc gctcatggtg cgggtgaacg
    89161 ggcgacaatg acagcgcgga ttcctgggga attttatacc aagcaaaaaa tcagcacgtc
    89221 atgtttgacg tactgacgca ccgcggacaa aaaccgcaag ccccggggag acgagcggcg
    89281 aaccgggccg gcggagaaga attgctaacc ggggacaccg gccgacctcc agcgcggaga
    89341 ccgctaacgc gcgccgcgtc ccgcgaaaat agcgtgatgg tacaacccgc gtccgcgccg
    89401 cctctggccg acggcggtag ttcaccgtcc gcgatgtcgc acccaagcac gcacatgccc
    89461 cagacaccga cccagaccca cgacacgtcg ttgttcgcac aagcagcaca tacacacgcc
    89521 gtccctaccc gtccccgcag aacggcgttt ctaaaaccgc ggatcgcggt ccgcagagcg
    89581 ggaagagcag gacggtccca gaaaccccac ggtttacata cctaaaccgc gcgtcgcggt
    89641 cggcgtaagc gccgtagcgc acacccgaaa cgccgtttat cgcctcgcca aaccgcgaaa
    89701 cggtccgacg tcgtttattt ccgacgtcta gggcgaggac gcgacagttt atgggtgaat
    89761 aagcaggaaa agttaagcag accggagcaa cctagtcccc atattccccc cgccatcccc
    89821 cagcggcccg acccgagggg tcggcggtcc agaaacccgc gcgcacaggg acggcgcttt
    89881 caacgcgacc acgcggttcc ccgagacttg cgccgtgtcg gccgacggcg tttcgttccg
    89941 aggcctgttt gttggcatgt cgcccatacg acgccacctg gcggtgtgtg aaaacccgca
    90001 ccgagccgag gttcgatccc caggcgccat ctggtggcgg atgaaaaagc cgcgtctctg
    90061 gcggccgttc ggggttcaac cggcgggtgg cgctgcgggg acacgttgtt tcggtccagc
    90121 gccccctggc ggctcgcgcc cgcccgtcgt cgcgcgagcg cacacgcggg cgggcgcgca
    90181 cgcgcgcggt aaaaaagaag cggtgcctag gtacgccccc tagtgggcgg atcccagccc
    90241 cggatactga tacgccccct tcttgaaacc acgccccgta taccgtgatt ggattccaca
    90301 cctaggaacg cccactctag taacgcccct tatactgtat gcattgtaaa caaaaacacc
    90361 tatttgcata ctaggtacgc ccccgtaggg ggggtacccc ggtaagaaaa ctacgtaccc
    90421 ctactggggt acgccccctg gcagggctat acaccgtacc ggaactatac gaccctaacc
    90481 taggtacgta ccctagaatg acgtaattcg tagggtatac gtagttacct atgcaaatat
    90541 gctcccctag gatatgcaaa tcttccctac taggcctagt tccctctgta tagcccgaaa
    90601 actgtcaggt cacgccccct aggtacgccc actaacaaat ttgcatacac ctgggaggag
    90661 tgggtaccgc cccctaggta tgtaccggaa ggaaaaaaca cagaatcgga accggatacg
    90721 gtaccccgga ggggcggtac ctaggtacac cccctagtgg acacgccccg gatacggtat
    90781 atacccccgc tccggtatat acaccctgat ccctaggtac ccgctctgtt cccgcatagc
    90841 tgatcccgta taaatataat aacggagaaa gcgtaacgga gagcccttac ccccctcccc
    90901 agcccccccc cccttccccg gggatgggag gcacccccaa tagagcatgc gcggcacagt
    90961 gccaacgcga agcgcgcatg cgcacgttga actgcgcatg cgtcggcgtc ggtgttgttg
    91021 ccgggcaacg cacgtaactt gttactgcgc atgcgatttt tgtcggcgtg gtttatggga
    91081 tggcgacggt tacctggcaa ccacgttgaa agtgatctgc gcgtgcgccg caccgtgtcg
    91141 gcgtggttta tgggatggat ctcggttgtc cggacaacgc aacaggggcc cgtctgcgcc
    91201 tgcgccggtc ggggattccc cggcatcccg taatactccg cgatcagtta ccgtggcgac
    91261 gtttcagggc gcatgcgcct ctggaagcgg taccgcgggc gcgtcgtggg cacagtacgg
    91321 ggatcccatg gatccggatg gggccctcgg ggtcccgtcc gggacacgca tctgcgcatg
    91381 cgcggtctcg gttactatac gcgcgtatgc gtgtgcgcgc gggggcacgc gcaggcgagg
    91441 tgctggtcgg gaggacggtg ggggaggggg ccgaaccccg ggcccggacc cccgacccaa
    91501 atcccggccc acagggcgac cgtgcgcatg cgcctggggg ctttctatgc gcgcatacgc
    91561 gcgcagctcg cgggtgtatg cgtgggtggg ggatgggcac caacaacagg caatggaggt
    91621 gggcggagcg tcgaccgggg agcccgatgg aaaattacca ggtccgccca caaggggcgg
    91681 tgtgtgggtc acgaggtgcc gatgggcggg atagaatgtt cgcgaaactc gggaggctat
    91741 aaaagccggc gtgcccgcgg ctccctggcg cattccgcag cgggctcctg ggcgtgctgc
    91801 ggtctgcgtg ccgctccttc cgacccctac cctcccccat ccaccctgcc taccctaccc
    91861 cgcgggtccc gcatcccccc acacccgggc ggcggttggg cacccccacc ctgcaccccc
    91921 catccgggtt ttgctctccc atcccccctc cagggcggcg gaccaggacg gcggcggcgg
    91981 tgcgaccacg gacggacgga cccccggatc caggacggcg gcggcgatgc ggtggacccg
    92041 gcggcggacc ccgtggcggc gagggcggaa cccggcggcc gatccggcgc gaacggagcg
    92101 ggagcggcga ggcgcggcgg cggcggcggt gggtccgggg gtccccgggg tgcctcccgt
    92161 agcgatggcg gaccgggggt cggggggtgc gcagggcggt gccccgggtc ggaacccccg
    92221 ggtgcggttc gggcggcggg gcttcccggc tccttccacc ggctcgcccg ggggtcgggg
    92281 cgatgccctg gcctcccctc ccccgcccct gctcgggtcc cggggtccct ctacccccat
    92341 cccgtcgacc ctccctgggt gccgctgccg ctaccggccg gagccggtcg tcaggtaaaa
    92401 ccctccccca cccccgtccc ggatcccatc cgcccgcctc gctcccggaa ccctccgtcc
    92461 tgcccgtccg ctcgcccgct gccgtcgctc cgccggctcc tccgggtctg gtaaacccgg
    92521 gtggagccct caccccccag cctccccgca ccccgctcgg cttgcccgct cgggggtctc
    92581 ccagcctctc cgggcgtggt ccgccacctc acccccgctt gctagtcccg agcctcagcc
    92641 agcgttcccc tcccccaacc cggaatcgcc caccctcggt tggcggctcc gggttgggtg
    92701 tggcatccgg tcctcgccgg atcgctgacg tcatgacacg gaaccgaggg tcccatcccc
    92761 ccggtcgagc agcctcggcg aggtgccggg tccctgggac acgatgaggt cccaggatcc
    92821 acccgcgacc tccggaccgt ctgcctgccc gtatacgcac atcccgggca ccccagataa
    92881 aatccgaaaa tggggggttt cgttccccgg tcgcgtccac gttcggtcta aagacgccat
    92941 tccaatatgg cgcttgtctc gtaaccgcac cccggaaatt tccggggtca tctccaaccc
    93001 cgtgcgctcg atacggcagc gacggcgcca tttttccgat cgaacaccaa aatcccagca
    93061 ccatcgggcc ccccagcaac cccgatcgta ccatccggaa aaaaggcagg catggcgtct
    93121 agccgccgta gccgcaccct caaaaaagaa ccccgctccc gtccctggcc gttttccacc
    93181 tattccggga gcggcatggg ttggagctgg ggttggcggt ttgggattcg gtttctgggg
    93241 agaccacctc cggccgtcgc tcgacgtccc tctaccgggg ctcgacggtc ggaggtgcca
    93301 gatccgatcc ctcgccgatc aatccctcag aaaaggtgga ccggatcaaa aaatcacgac
    93361 gcgaccggga accgaaagag acgagaggct cgttaaaagc tttcactccc attcgccaaa
    93421 tttgtcttcc tgatcctctc cccgtaacgt gtcgagctcc gtggcacgga aaggtcgaat
    93481 cgacacccct agcgagatta ccggaacgtg gtcgtcctca ccgccacgcg atccgccatc
    93541 tcgcaccccc gtgacgtgcg atccaaaacg ccccgtcctg agctccgggg tcgggcgcga
    93601 gatggcggac gggtctcgaa tcgaccttgt ccgaaaagcg agctatctcc tcgaggaggg
    93661 ttaggcgaga tttttgaaaa agtggcctag agagaacgct gaggacccgg ctggggcgaa
    93721 aggtctaaaa cgccgccgct agtggggggt ccgggttgcc aaaattcccc tgtcccggac
    93781 cccggtcggc cttttggctt ttccttcccc tgaccggcgt cggagaaaag tcgcgtgagc
    93841 cgtcggccga tacgaagccc ggctctccca ccacgtcgat tttttcgaga ctaaaaagat
    93901 ggcggactaa aaaaccaccg tggtccgggc acggcactag gtgacgaatc tcgttcctcc
    93961 cgccctctga cgcggatggc ttcgtacttg gcactttgcc aagggagtgg ctcgcgtgat
    94021 gtgacgtccg catccgggat gcagacggac gtggctctca catccgcgag taacgacgtg
    94081 tttacgagct aagtcgggaa cctcgccctt ccggagtgac gcacatagct cgccggggcc
    94141 cgccttctgt ccaggccggt tccaaagcgg cgtgtctgag tcacccggag gcgacgcgca
    94201 acaacccctc ccccctcctc atcctagtgt taattttccc agcacgaaac gatgcacctt
    94261 tttgaactgc tttattagat gctataacaa actcctttgg agatacaagt caaatcactc
    94321 aacgccatta tatcacagtg tatgaattat cttttttaca tgacacatgc tgcctatgat
    94381 gaatattttg tctgtttact atgttaacga aaagacaagt aggatgaatt gttatataat
    94441 atacaaagtt atacttactg agaacaaaag atatctccgc taataggaat tttagacaat
    94501 ctctcatagt gttaaacgac aagaaaagaa aaagggagac gacgcggatc cctgtacccg
    94561 gaaccgcccc gtgtacggcg cggtgatgcc tccggatcgg ggagaaaaga cacgggaacg
    94621 aggttggagg agacggacgt tccctttgcc gtcgtcgcgt tttagggacg gcgggaaaag
    94681 ccggagggaa cggcagagag tctccgcctc gattttttgg tttcccgtga gacgatgatg
    94741 ccagctcgat ccgggaccgc cgtagcgggg tgttttttaa tttattttat atatacgcta
    94801 tgtatctact gtttttccgg gtcctgcgcg tcgttgctgc agttagcaca cataattaca
    94861 tatttttgat aagaaagata ctttttttgg actagactcc tcacatctct atgtacttct
    94921 ttcggttttc catttgaata ccgtctcttt ttatattttt tgaacaaaaa caagattgaa
    94981 gaaaactcca tatgtgtgta tgttttttta atcatacgaa atagaactct acaccgaact
    95041 gtcgctcttt cttattccct tagatgaaga aaactccgat tatttgctat ttttttgagt
    95101 gttactgaat aatacattgc tacatacgga atagacatgt ccctgttgta ctactgtgtg
    95161 tgtattagtt tatttttgtt ttgtatacct agttctatag cttgcttacg ttttggaaaa
    95221 agaataagag gatagggtaa ggcggccgcg ccgacggcaa ggagtcggcc ggccgggccc
    95281 accagatgct acaagataaa aatgagaata atgatatttg agaaatatgt gtaacgatat
    95341 ttcatccgca gagccgggga ggtccggcga agatgatttt tttttcggtt tttcttttta
    95401 aaaatatatg gctcttttga tacatatcta caaccacgaa ctcctttttt ttattctctg
    95461 cattttagct acacaagtaa aaacaagttt ttgattttct tttttgtaat acctttacga
    95521 tggtagacaa gaaaaagact cgtcttccct gttgtgatac attctcttta ataatgatag
    95581 acaatgatga tctagaatat attctccttt ctttcctctc ccccgtgatt tttttttgtt
    95641 ctatgatgtc cttctcctcc tgtgacagca caactctatg tacaaaaata agaatagctc
    95701 tataggaaat ccatcaacta cactaagaag aagcagccgg tcacggcggg ttcaggcacg
    95761 aattagctac acaacgctat gataatatat aaaaaaatca ttcttgttct agacttgaga
    95821 tattctctcc gtgagagaca gatactgaaa caagggacaa tactgtgtaa gaaagaaaaa
    95881 aaatgcaacc aagatagatg atgtaagaaa cagaaaaaaa gacatgcaga tcacagtcgc
    95941 tgatgatacg tcgtccgtcc tctcctcctc tgttctggct gcgtggagag acggcgggga
    96001 atgatcgtct ccgatgcggg ttgtggtttc ccgagccgga tcagagccct cacggatgcg
    96061 gttcggggac ccgcggggag cgatctccgc tgtcgtctcc cgcggcgctc acgaaaaaac
    96121 tacaaacggc gacgatgacg ataaaagaat aggatacgat atagccagat aaggaaaaaa
    96181 agtgttcacg ctggaataaa aaacacaaaa gagaaataga tgcacggccc gccgttgcct
    96241 ccacgttacg atagaatcaa tcatgatatc tcttactacc tttagaactg tatctagata
    96301 taaccgaaaa gcaagaacca ttacaaaacc atcaaatatc acttagcaac aactctttaa
    96361 cctgtcgtct ctaaatcacc attccctttt tgtctccttt tccccgctat tatttctcca
    96421 tgtgtaagaa tctctgtaga aaacctgata tagaaaaagg aaaaagctag aatcgatgag
    96481 aaattgatcg acagccatct cgttgaagaa cgacaccacc acggaatcct ttgcacattt
    96541 gctcgctaac ataggggggg tctcgaaaag agatgcgtat gtctccctca tcacacgtaa
    96601 ggtgtttcag aagaagacga atttcttccg ctgccttttt ttgtgtccat cgactcgtcc
    96661 gttgtatatg ttcaatcact tcgttatact cttaagaaca caaaagacat gatcgcacag
    96721 tgtagaaaca cgcaccgtgt atgtcaaccc caagcaaaaa gagaaaaagt tgttaggacc
    96781 tggagaggta aacgggtgac gtttcctctg tcccaccttc gaaagaagac aaaagcaaca
    96841 atgatcaaga aacatgacaa cagagaacgg tcgccgtcgc cgccggcagc agcggcggcg
    96901 ctacgggcac gatcgcgcgt aaaagtaaat gaacatgaaa atgtagagat agacgccgtg
    96961 acggcgaagt tgggtgtccc caccaccacc acgaaatgga aaaaaataat ttccaaggat
    97021 agaataaacg ttctgtgtgt atatatatgt gaaatctcct aggataggta ggtactgtat
    97081 aaatgatcat tcaggatgct taagtttctt ttctagatga ttttagatag acttttgata
    97141 taaaaagaac tggagactgt agctctctct accgaactca aaagaaaaaa tacacaaatg
    97201 acattgatcc cccgcaatat aagaaatgtg ctttactgtg aacaaaaaaa caactgttat
    97261 attctgcgcg cgtacaccga tatagcagag atacgcatga ggctcgctca gaaagttgtg
    97321 atagcttgcg cagcaggcca aagccagtga aatgtgttta ctgacactgt cgcacgcgac
    97381 agattctttg tgtatatttc ctcccaaaaa aactcctcac catagccacc attcacatca
    97441 ctagtcgcgg tctaagcgaa aaagagacta gaaaagcgaa cgcagaaaac acaacaacgg
    97501 tcggaggatc gtcgccgtcg gtaccatctc ccctccgtct cctccgtcgc tttcgaccgt
    97561 cgtcgttgcc gccgcttctc acccgcgagc cgccatcggt ggcggctgtc tctaccgcgg
    97621 gcgaccacgg agagagacga cggcgcgaga acgagaagcc agcccagatg atggaggagg
    97681 agtagtagga gatggccgcc gagaagacac ggcgacggct ccggcctggc catgaatgaa
    97741 atgtgcagaa aacgatataa atttttaccc gtacctttgg atgtatatag atagatctag
    97801 ttttgtgtag aacaatgtgt ttttattatt tattatacct catattatac gctatttaac
    97861 catatcgaag ctagaaaatg atagaatgtc ttaggaaaca aaaaagtgta catattttag
    97921 ctcatccgcc tttgggccat cgctaagttt aaaagtgcta agacgtgttc ctcttcatat
    97981 gtgagtgttc tcggcccgat tctgaacaca aaagtataat gtgtatttgt tgttgtgtgt
    98041 agatacttga cccgttcaat gcctacccca cgatatcaac aacgacccgt ccctagggac
    98101 acatggtaaa aagagggagg tggtgacgat gtcgtcgtca ccatcgctta cagacgacta
    98161 ctactgttat cccgccctgg gaaccaagaa cgcaataaaa aaatcggcaa gatcgataag
    98221 agatgaaaca atcacacggt gtgtctgtcg ttttttttat atatcttatg aaaaacacga
    98281 acatccgaat cggggtgggg aggacggcac agtgtttgga gggagagaga caggcaagtc
    98341 aatgagagat gtcgacgcgg accgctagag ggagacgaca tgcttcgttc ttcctcagta
    98401 ctcgtccatg tcgtcgctgt aacacagcat ctcttcctcg tagtcgggcg tctgacagcg
    98461 catgacgacg gattcgggcg aagtggcgcc cgaggcttcg gcggcgctgc tgctgttatt
    98521 gtccggtggt ggcggggcgg gcgtacggtg agacgacgca gaggaggagg tagtcgtagt
    98581 ggtggtcgtc gtgggcaacg agggctgggt ggtcgtcgtg gacatctggg actcttcgtc
    98641 ctcttcttcc tccgagccat cgtcgtctcc ggcggaccag ctgtcgtggt ccggcagtcc
    98701 cctccttttc tttcggcttc tgccgccacg tcgctcctcc tcttcttcct cctcgtcctc
    98761 ttcttccgca ggtggctgct ttggcttctt caggatggac gtcgtaccga agttgacgtc
    98821 gcagcggagg gtacctgccg cgggggtggt cgtcgtagtc gtattattac tattatttga
    98881 cgcggtggta gtcgtcgtac cgaagaggag ggacgagggt acggccggga tctgaggtga
    98941 cggcgaggag gtgatggtgg tgttggtact gctaccgccg ctcgtgctag ggggcgccgt
    99001 cgtcgcggcg gagaacatgg gcgagttgtg tcggatcgcg ggaccgagcg gagacgggtg
    99061 gtggcggcta gcgacggcgg cgcctttagg aggcgtcagg ggaggtaccg cggtcgtctt
    99121 gtagacgatg gcgccggctc cgggccggtc cgaggtaggg actttgacga ggtcttggct
    99181 gctgctgtcg tcttcctcat cctccagttc tccctctgaa tactggtgag ggctccttct
    99241 tttcctgctc cttctctcat aagctgtcga gctctgcttc tccggcctgg gggctgaagg
    99301 tggcggcgga ggatacggcg gggtccgcgg tcctttgggg gtgtgcgacg aagacgacgt
    99361 cgtggtggta cctgaggatt gagacgtcgg agcgatggct ccgttgttgt ggtggtgcga
    99421 cttcgcgccc agggatgacg ggtgatgagg aggaaggcgg tgaggctgct gttgttgctg
    99481 gtggtcgtcg gcgaagatgg tgaggtccag cagcgtctgc tcgtcgaagg gacagtaggc
    99541 cagcatgaag cggtagggcg ccagacagcg ctggatccgg agctcgcaca tctcgttctg
    99601 gcactcgtgc cgctggaggg cgcccaggat caggtcggag accgtgccgc agcggtaggt
    99661 gcccatggcg ttgttggcgt cgaactggtc gaagaactgc ggcgcgttgg tgacctgcag
    99721 cgcccggcgg cgcagcgcca cggccacccg cgaaaaggag cacacgtagg ccatggcccg
    99781 gtgcacgggg ttgccgaagg tctcgggcgg ccgcttctgc aggtcgcagg cgtcgtcgcg
    99841 cacccagccg ctcatttggc ccggcttctt gaccaggcgc ttgagcaggt tgcagttgtc
    99901 gccccagccc tcctggtggt cgaggatgca gcccaggtcc aggttgctga gcttgttgaa
    99961 gagcagctgg cgcatggcgg ccaccgtctc catgtagggg tcgtgcgggt tgaccggtag
   100021 cccgtggagg tagtggtact tcatgtagct cagcgtctcg tcgatgatgg ccagcagcgt
   100081 gtgcaggttg ggcgtgttga agacggcgaa gatcttctcc accaccagac gacgcagcag
   100141 cggctcgtcc agccagtcga actgctggcg gatgtgcagc aggtagtcgg tgtgcatgag
   100201 ctcgtcgtgc gacagcagga tgcgaccccg cggctggcgg tcctgcggga aggccgtggg
   100261 gctcttgagg tcgttggggt agggcgccag gcgcaggctc tcggccgtgt accgctgcag
   100321 gtcgtaggcc ggcgaggtgg agctgggcga ggtgcccgac gacgagctgt cgccgccgcc
   100381 gccgcagcag ccaccgcctt tgtggagccg cgcctgtttc ttcttttcga tcagccggct
   100441 caggtgctgc agctcctctt cgtccatggc gtccagttca tcgtctagga gggcgaacat
   100501 gggcgggtgg ttgttatggt gatggtggtg agaagaagcg gcggcgctcg ggagcagggc
   100561 cgccgaagaa gagtggtgac ggccgttgct accgccgcca ggtggcaccg cgggcgtcgg
   100621 acggtgcacg gtggcgggac agctggggat ccgacgacga tactcgccct cggcgtccga
   100681 cttaccgccg taggggccgg tggacgaggc ggcgaagcgt ctcttggccg ggggacctcg
   100741 aaaaccggcc gtcccgccgc gttgcgtcgg ctgcggatgg tgatagtggt gatgctgatg
   100801 cggaggcgcc gccgcggccg ctgatggagg aggcgggggg ttcatgtcgt cgtccggggc
   100861 ttcgccgtcg tcctgttcgt agcgcgagga ggacgaacaa gaagagggtc gcctgggctg
   100921 cgactgtgat tgttgcgcgg ggacgcaggg tcggtgagag gctccggccg ggactgctcc
   100981 atgctgctgc gtcgactgat aagaagtcgg cgagggtggg ctccgctcgc gtcgggattt
   101041 ccgcggcacg ggttcgtagt ccagacagaa gcgccgtgcc cggcgcgcac ggcgttctcg
   101101 ctcgctgagg gaggacaggg gcgcgtcctg gcgggcacgc ccgtgcagct ccatggcggc
   101161 cgccgacggc cggatcctgc cgtcggcacg cggcctgcta atatatagat gacgaaaccc
   101221 cgcgaggggg gcgggtcggc gggcacgcgg aaagcgcggc gcggtctgcg tccctctcct
   101281 cagacggcgt ccgcgcccgg cgggcggatc ttgaccgaga tgtgcacgtt tttggcgttg
   101341 gagtggcact tcttggtgaa gcagcggctc cagaggctgg cccagagcgc gtagctgtgc
   101401 tcggtgcgca ggtcgatgaa cacctgcacc gtctcctgcg ggttgcggtg tacgtagttg
   101461 aggcagcgaa agtcccgggt gcgcgagccg tcgcgccgct tgacggccac gcaggagagc
   101521 ccgtgcggct ggaagagcag tacgttgggc gcggtgaact gctcgctcac gtgcgcctcg
   101581 tagtggcgcg tgaggtgctc gagcagcggc ggccagacgc ggccgaccag caggcgctgc
   101641 agctccgtct cgtagacgac gacggcgtcg tcgtcccccc gctccgcgcg aggagccccg
   101701 tacaggtggt agctcaggac gtcggccagg gcccggcgct ggtagcgcgt cacgttcagc
   101761 gagcgcgtct cgatgaagtt ggcgtcgggc gaggggcaga tcttgtcctg tacgctcagc
   101821 acgatgcgcg gcgggggcga gatggggaag gccggcaggt cgtgcggcgg atggtggtgc
   101881 agcaggttgc gcaggtccag ttgggcgcgc acgaagccca gggggcggtc gcggtaggcc
   101941 tcgggcacga tgaagagcgg cagcaggcgg cggtacatga agtagccgtc gtcctggtcc
   102001 atcttgtaca tgtagggcag gcgcaccgag cggccgtggt ggtagatgcc cgtgtccagg
   102061 ctgttctcgg ggtgcgagat ggggtccagc aggcggtgca gctgcgtgtc caggcacagg
   102121 gcgtggttga gcacctgggc cacggcgcgc agcacggccg ggttgagcac tacggtgttg
   102181 gcggggaagg gcgtgatgat gcgcaggccc agcttctccg tgcagcggca gtagaggggc
   102241 gagttgttct tgtcaccggt ggcgtctccc ccctcctctt ccttcgtctt ggggtggcga
   102301 ctttcgccga cccgctgtcc ttcttcctcc ctccgcatct ccccctcctc tgtcgcgtcc
   102361 cgcccctcgt gctcctcgtt ctcgaaattc aggtactcgt ccccgtcgta gtaggcgtcc
   102421 gcggcatcgt cgtcgtgcgc gtgggcgccg acgccggggt ggcggcaggc gctcttgaag
   102481 aagtacacgg ggtgccggtc ctggtaggtg tagccgaaga ggctggtcca cacggcgatc
   102541 cagacgcgcc gcaggccgcg gcagatctcg aagaccgtgt gcttagagag gcccgagacg
   102601 ccgtcgcgca gccgcaggtc catgtcggcc acgaagttga agacgggcag gcgctcgttg
   102661 aagatctcgt gacgcgtgta gtagaactgc gtctcggggc tggcgctggc cacgtcgtcg
   102721 tcgtgcagcc agatcatgtc ggtcagggcc tcgtccgtga agcggctgtc gggcacgtgc
   102781 ttgagcaggt cgaaggggaa catgctgcgg tgccaggtct cggagaagac ggcgcagaag
   102841 acgtgctggt cgttgggcag gtgcacgcgg tagagcggca gcggctgcgc gatgacggcg
   102901 ccggcggccg ccagctcggg cggcagcaag tagcggcgct gcgagaagcg cgccagggcg
   102961 cccgtggcgt aggtctgggc cgtgcgtagc gaggcgcaga ggcgcagcac gcccgacagg
   103021 gagcgctcaa tggaggaaaa cacggaatcg gacaggcggt tgatctggtc cagtttcctc
   103081 agtagctggg acgacgtccc gaagaaaccc gtgaggctcg ctccatcggt acggtagccg
   103141 tacccagaca tgcgcaggtg ctgcagacag ggcgggtgcg cgggcgaggg ctgctgctgg
   103201 ggatgcgaag ggggcggata ggacgcgggg tgaggctggt ggggagagcc caggggcagc
   103261 aggcgcgtct ccacgtagtc gtggagaaag ttgtccagcg agaagtagcg ctccatgacc
   103321 tggatgaggt cgccggccag gcggcggccc aagaataacg gttcgcgcgt gcactgctgc
   103381 tcggccggcg ccgtctcgtc gtaggccacc acgcgccggt actccagcag gcgctgacgc
   103441 gccagcgccg tgcggtaggc caggtagacg tagtgcacgc agaccgtgtc gggcagccgc
   103501 gcgtgctcgc ggaaggtgtt gatctgcgcg tcgacgtgcg tgagctccgc caggtcgcgg
   103561 cggttgcgcg ccacggcgta ggcgacgaac tgcggcacgc gctggcgaaa gggcgagccc
   103621 agcagcaggc gcgcgaactc gctcatggag gcgtgcgtgg ggatgacggg gcccaggtcg
   103681 cccgcgcaga agctgcgcac gtactcctcc acggtgggca cggtgctgta ctggccctcg
   103741 aacaggtagt aggccatgct cagcagcacc tggccctccg tgtggccgaa ggtgctgatg
   103801 aaccacgacg gtgacgtggg gcacaggaaa accaggttca ggtgccgcag caccgccgcg
   103861 tggtggaagt agaccaggtg cttgaactcg cgcacctcgc cgccgtgctc cggcgagatg
   103921 accgtgcgga acaggtggct gtacaggggc cgcgtctcgg cctcgtccag gctggcgatc
   103981 agcgccgaca gggggatggg ctgccgcgcg gtcaggtaac gggagagatt gagcacgtcg
   104041 ttgtcgaccg cgaacaccgg cgccacccgc cgcgagtccg tgcatttctg cgtctgcagg
   104101 cagaagtaaa cgcggcgcga ggcgtgatgt ttcaccagca gggggtacac gcagtgctcc
   104161 gacgccgtct gcgccagcac gttggtgact atatgagcag aatcatactc tgtcgcgaac
   104221 agaacgagcg tcatcgccgt ggggacacga tggagctggc ccggcgcctg tgtggcttct
   104281 tgctctgtcg ccgccgcccc gcgcccgtgg ccgattacgt gctgctgcag cccagcgagg
   104341 acgtggagct gcgcgagctg caggccttcc tcgaggagaa cttcaagcag ctggatatca
   104401 cgcccgagga tctgcgctcc ttctcccgcg acaccgaggt ggtcaaccac ctgctcaagc
   104461 ttgtgccgct ctaccgccag tgccagagca agtgcctctt cctcaagggc tacctcgcgg
   104521 acggctgtct gcctcacacg cggcccgcgg ccgaggtgga gtgtaggaag tcgcagcgca
   104581 tcctcgaggc cctggacatt ttgatcctta agctggtggt cggcgagttc gtcatgtccg
   104641 acaccgagag tctggagatg ttgctggaca agttctccac ggatcaggcc tcgctgctcg
   104701 aggtgcagaa ggtcatgggt ctggtggaca tggactgcga gaagagcgcc ttcatgctcg
   104761 acgccgccgc ctcttcggaa aacgcggagc tcgagggggc cgtgggcggc gtcgacgtgc
   104821 cctcgaccgc ggtctcttct tctgtttctt ctccggcctc tgtcgcggcc agccacttgg
   104881 tgggggcctt tacctgcccc tcgatcaccg ccacctcgct gatccccgag aacacgggcg
   104941 tgacgcggcc ccccgacacg ctgggcgaga tcacgaccct gtccacgccc tcggtgatac
   105001 ggttcgatcc cagcctgctg ccgtccgacg acgatgacga cgagcgcgac gccgtcggtt
   105061 actcgaaggt cgtgccgcgg gggcgccgcg agacgtcgga ggagtcttct tcgctgctgc
   105121 aggagcggga acgggagcgc ttcgaggacg gcccgcccgt gcgcgagcag ccccaggggc
   105181 gatcccaccg ccgccaccac cgcagtagca gcggcgagcg cgaggttttg agcctcctga
   105241 ggcagacccc cgaggtcccc caggacgagg tggtgacgac gccgccgacg ctgggccccc
   105301 cgccgatcgt gggatccgcc cgcgagctgc gcggcgtcaa gaaaaagcgg gccagcatcc
   105361 tgacggtgtg acggcaccca aagacaaacc gtgggaacgc ggacgattca agtacgtgca
   105421 tttccacgtc tgtcgtcgtc tgtgggcgac gtgacgttag agagagactc agagacacgg
   105481 ggtttgtggt aaccagtgac gtgttttatt gtcccgcgcg tgacggcgat ggggatgggg
   105541 caagaggaaa gcacgtacgt gagctagaag ctgtcgtcct cgtgggaact gtacggcctg
   105601 tcgacgacgt cccagtggtg taccgctctc ttcctgtggc tccatgtcgc gcccgtgtcc
   105661 tcgtcctcct cgtcgtcggc gtccgccgcc gtgtcgtcgc cgccgccggc gcagccgctc
   105721 aggcgctgca gcagggcgtg ctcgggcgtg tgcgtgaagc ccagctcggg ggtgggcggc
   105781 acgatcagtt gcccgatggg gtggctgccc accagcaggt aggcgaagcg gcgggtggtg
   105841 aagaccacct tggtcatggt ggtgttgggg gagatgcaga cggtggtgcc cgaggcgtta
   105901 accaccgtga cgcaggccac ggtgcccggc agccagatgg tggggcggat gatgaggtcc
   105961 gattggctaa agtggcgcgt gcccacgatc agggcgcaga tgccgggggc gtgtacgtag
   106021 gccgcgtcga agtagacggt ctgcgtgtgg ccggcgcgga tgatgaccgt gtgtcgggtg
   106081 cgcagcgtga agaagccgtg ttcgttgggc gggggcacgt tcatgagctg ccagggctcg
   106141 ggcgcgaagc aggggaagac gccgatgtcg ccctcgatgg tgcccggaaa gatggcctgg
   106201 aagttgtagc tgaggttgac gatgtccatc tggggcatct gtaggcccgg ctcgattagc
   106261 tcgggcatgc agacgaactg cgcgtccaga catttgtaga aggtgatgcc gaagaagccc
   106321 tcggggatgt agaggctgat gcccagcgag gtggggatct tgcgctcccg tgacagccag
   106381 atgatgtgct tgttgtggaa ggccagctgc gtctggcact gcttgacgat gaagctggag
   106441 ggcagccatt tgtaagggat tttgggctgc ggtagcgggg aaccgccatc tccgccgcct
   106501 cctccgtcgt cgggtggcgt gaagaggttc tgaaagtccg tgtcgctggc gaagcgcacg
   106561 cagtagcgca tgttgagcga cttctcggcc agcatcggcg gcggggggtc cccgttatcc
   106621 ttaattatta aagatggcgg ttcccagaag cgctgaaagc gcgagtgggc cggtcgcgag
   106681 agcacgatct gcgagtcgat ccggtcggtg aggaccgtga gcatcgtggg acgatgccaa
   106741 aggcgatcga tatggccaat aaactgatgg tattgatcct ggtggtgagt acggtggcta
   106801 ccaatatgac ttcgacttca ccttcgagta caaagtctac aagcagcaca acgacgacga
   106861 ccactacaac tactacgagg accagcagtt cgacgacaag aaaggtttcg tcgtcatcat
   106921 catcagtaac ctctgccagg atgagtactc acgttaccac tcatcatatc tttcatccga
   106981 tgaagataca caacaacagc gacttttaca acgagaactg cacgtcgcat atgtatcaca
   107041 tatctttcaa ggtcttcgcg gcctggtgga ctctcatcaa tctctttatc ctggtcggcg
   107101 ccttctgtat ggtgttgcgg cactgctgct tccagacgtt cacgagcgct accaccaaag
   107161 gctactgagg gacgagacgt tctccgggcg gtgtcgtaga gtgatattgg tacgattgcg
   107221 aatctcttcc ttgaagacca tggagtcgat gtaatcccac aagggatcga tgtagttctg
   107281 ccggagaagg atgtggctcc ggttgacctc gggtgcttcc tggtagagcg atgtgaggtt
   107341 cagggttccg tagatggtgg acggggtttg attgtgcgcc acctggtgtg tgtgtcggac
   107401 cgtgtcggag atggccgtga ggttgcgaga tcgctggcag tagggctcgg agtagtagcg
   107461 gaacgtgctg tagacccagg tcacgaggtc ctggagttgc gtggctagta tgggattctt
   107521 gaaacacgcg ccctcgttga cgtcgcaaga cttggtgggt agcgtgacgc tggcattttt
   107581 gctaacgccg ttcctggtga cgttggctga tgtagtaatg gcgtgtatgg tggttgtagt
   107641 gacgttgttt gtagtgacgg tggcgttcct tttggttcgt ttctgcgtct taggtaacgt
   107701 tatctctttg gcagtttgtt tacgttttaa ctttcgcatc gtgttcttga gcttggtgct
   107761 gttgaagtac ttggggacgc ggaacatatt acggctcatg gcgttggcca ggtagaaact
   107821 gctcgtgcaa ttacgttgaa cgtatctgag aatcagcgcg ctcaggccca tgaagtagac
   107881 ggtctgactg tctacgctga ttctctggga gccgacggtg attagggtgt tccaccgcgg
   107941 cacgttgtag agcatgggat tatacgtggt gaagttacgg caatcgtcgt cgttttcgcc
   108001 ggtctcattc cgacggctga tcgaaatgtt cagcatctcg gagaggcagc gcatagatgg
   108061 cacattaccg caaggtggca gcagaaacgt gatgtttttt gttacgttgt cgtacttgga
   108121 gtacacgtag cgggctcggc gcaactggtt ggagtagaaa tcgagccaga gatatgtgac
   108181 gttcatggtt ttggggccgg ccaggatgta gcgcttgggg aacttgggca tgggggctac
   108241 ggtcacgttg ttgaggatca gcggggcgta gtctgtgcta ttgtccctcg tctgtggtgt
   108301 tttgatcgtc tttactttat atctgcctct agaccgctta cgtgtttcaa tttcgagttt
   108361 gagttttaag atctccagta attgttctcg tgttggttgt ctatattcgt tgaatatctt
   108421 ctgtatgtgt ggaggattgg tctgcacggg tctctgggcc gcaacctgac acaggacgaa
   108481 gcaccataag gccagacagg cgccgcacgc taacccgacc ccgtgtcttg ccattgcagg
   108541 gaccccgccc cgtctgtctg catcaccgtc tggctcgccc tggtgtactc gctgatgatc
   108601 ctggcgatcc tgctcttcgt ctaccgctgc gtcgttggct tcgacggcga cctggtcacc
   108661 cggaccctgg ccgtatacca cctctgtcac tctcagcggg gtcccccgct ctcgtgtcaa
   108721 cacaatacct caacctcgta aataaatacg cagagacctc agattacaga gtatcacagt
   108781 gtcacgcgtc tttattatta tcggcatctc cacacaacat tcgtaccttt atctgcccct
   108841 ctccccgact tctgttaggt tctgtaccgt gagatcggac cctaggcgct cgaggcgcgg
   108901 cagcagccac cacagttttc tggggaacat cagtgggagg aagaagtggg ttattattat
   108961 catggtgatg atttttttta gcacagcttg agcaggcgat atatcaggta aatggccacg
   109021 atggccgaca gtgcgtagat ggccatcatc agtgcgcggc tgtcggtggc gtctatgacc
   109081 acgtcggtca cctccaggac cgtgccgttt ttcaacagca tgaggtagtg ggtccgcggc
   109141 gagggtacca ccacgttgtt gccagcgtcc agggcgaaca gcacgtcctc gccgtcgtgc
   109201 aggtacatga ggttcacgat gccctgcgtg tcgtcgtact ccatcagggc gctctggcag
   109261 aaggcgcagt cctccagcga gatgttgaag gccgccacga tgggtcgcgt ggtgtgcatg
   109321 ttgcgcgtca gctcgcactc ctcgtggctc tcggtgcgcg tgatgatcag gctctggccc
   109381 accaccgtgg tggagaccgg gtaggaggtg cccttgagca ggtacttctc gcccgtcacg
   109441 tagctggtgt gttcggacac ggtcagcgcc gagaaggact cgtccagcgg caggcaggcc
   109501 aggtcgcgga aggcgctcag ggtgcgcggc tgcatcatgg ccaggataga cagggccgtg
   109561 ggcacggtct cgggtatggg cgcgtctggg aacatgcgcg ccaggcgctc cagcgagtgg
   109621 tcgcgccggc cgctgctcga gcagggcgtg tacaggtcgc tcaggtattc gtggtggtcg
   109681 tcggctagca tgcgcgtgaa gtgcgccagc tcggccagcg agcacaggcc cgtctcgatg
   109741 atgaagatga gccgccgctc gttcgtgtgt tccgacatgg agtggatcat ggcacccagc
   109801 aggtagagct cctggcgggc gaaggccgag aggaaggagg ccaggtggga cttgtgcagg
   109861 gtcaccgcaa actggcccag ctgctgcatg gcccacttgg ggatggcttt ctcgtcattg
   109921 tgtcgggcca ggatgtaggc cgcccgcgtc aggctgggta ccgtgctcac tgcccccacc
   109981 gcggtgaagg ccttgcgtgc catctccacg gcgcgggggt aggacagcgt cgtgttgcct
   110041 gacggggggt cgatctgtcg ccgcaggcac acggtcatga agtcctgcgc ctgcagtagg
   110101 gcggcctgcc ggtccagcag gcgggagatg tgcacccggc tctcgtgggc gcgctgcggt
   110161 gaccccgccg acagcagcgt cagtccgtac ccgaaggcca gctctaccgc gctgcggtca
   110221 agcgggctct gacagcgccc gtttttcagt gctttcacgg cgtacccgtg gaaggccgcc
   110281 atgatggcgc tcatatccag atagttgatc ttgagcgcgg cctccagaaa gtcgggctct
   110341 ttgaggtagg ggtgccggtg caggtgggac ttcttgatga gcaccagcag ctcgtgcttc
   110401 tgggtctggc gcagcacgaa gttgtcgcgc tggtaggggg ccttgaaggc cacgcgtgac
   110461 aggtcgccga agagcaggag cgctggcgcg tcgtcgatcg tcgcccgtag tgcgaagaag
   110521 tcctccgtca gcgtgagcgt gagaacggag cggcggttgt tggtgcccag ggggaggaat
   110581 tcctgctcca ggcaggggat cagggcgctg aagagcaggt cgtggtcttt gaacaggtgg
   110641 caggtctgct ggaaggcggg ccgatgcacc tgttccgggt gatccacgta cgggagcgtg
   110701 aagacgaggt ccttgggcga gggcggctgc atctgtaccg cgggcatcgg catctcgccg
   110761 ggcgccggca cggtcacggc ccggtcggcc agcgcgtcgg tggcctcgag cttgaggtcg
   110821 aaggcgcggt acgacggcag gtcccgggtg gagaccagcg cgtacacgtc cagccgtcgg
   110881 tagtaggcct ccagggtctc gctcaggtcc acctggttca gaagctgctc cgccagaaga
   110941 cccgaaaaca gacagcgagg catctggaat acatcgtact cgttgaagct tcggaagaag
   111001 ttgaaggaga tggcgttctc tttgaccacg gtgctgttcc gcacggtgcc gttggtgcac
   111061 tgggtgttgt tctcgcggag gaagcggacg ggtcgcccgt aggtgttgat gaggaggtcg
   111121 aaagagttgg ggtccacttg gacggcttca gcgccccagg cgaccctcgt cttcgtggtc
   111181 gtaccatagc gtgattggca gaggtagagg tacaggagga tgcagaggta gcagaggtag
   111241 atagacaaat cgtaccgctg gggccacggg acggtccgca tagcgcggcc gccccggcga
   111301 cggcgccgcg gacggtgggc tgggcgatgg cgccggaaag tgggcgacac gggtcacaag
   111361 tcgcgccccc gtctatttaa tacgatgtag tgcgcggctc cctcgggctg ggggcactgt
   111421 agcgccggac tgtaagagag gagagacgtg tcccgctcgc catgtccttc tcctcggatc
   111481 ccggcgccgg gactagcggc gacggagggg acgcgctgca gcggctcccc catttctgca
   111541 agcgggcggg caagcgcaag cacctggaca tctaccgtcg cctgctacgg gcctttccct
   111601 ccttcgcggc gctcaaccgc ctgctgggcg acctcttccc gccgccgctc aaaaagtacc
   111661 gccggcgcct ctacctcgag gtgcggctga gccggcgggt tccggactgc gtggtagtct
   111721 tcctctcgcc ccgcggcgac gaggtcgaac cgccggcgaa acccaaaccg ccgcacgccg
   111781 tctgctacgt gatcgagttc aagaccacgc agtcggacgc cgacgtccag tccgtgcgcc
   111841 ggcacgccac ccacagcctg cagtacgccg agggtctgcg ccagctcaag ggcgccctcg
   111901 tggactttga gtttctgcgg gtgccctctg gcggcgccag cgagatctgg agcgtggtgc
   111961 ccagcatcgt ctttttccag cgccacgccg ccagcccctc gttcggacgt accttccgcg
   112021 ccgcccgctt cgacctgtgt accgacgccg ccctcgacta cctggcgcgg cggcaggatg
   112081 agtctgttgc gcacattctg gcagctaccc atcgccgtct acgagcccca ccgggaaaac
   112141 gttctgcggt gccccgaccg cgtactgcga cgcctgctgg aggacgccgc ggtggggatc
   112201 aggggcggct ggcgggaaga cttcatcatg gatcgggtgc gcaagcggta tctgcgcgag
   112261 gagctgcgcg acctcaacga caaggtacac acttactgcg aggatctgga ggggcgcgtg
   112321 tccgaagcgg aggcgctgct caatcagcag tgcgaggtcg tcgaggtact gccgccgtcc
   112381 caggggagtc acggcggcac tctgccagaa cacgctcttt atagtcggca cgatgccatc
   112441 acgggacccg acggcggggt gattgccaca ccgtacgcac gcggcggctg cggcgtctcg
   112501 tccacctggc tggcgcagtg cgccgaccgg ccgcctttcg gaccgacgcc cgctcaggcg
   112561 gcccaggcgg ccctggtggg cgcgcccggc ggggccacct acttcggcat cacgcagaac
   112621 gaccccttta tccgcttcca caccgatttc cgcggcgagc tggtcagcac catgttcgag
   112681 aacgcctcca cctggacctt ctccttcggc atctggtact atcgcctcaa gagggggctc
   112741 tacacccagc ccaggtggaa gcgcgtctac cacctggccc agatggagaa cttctccatc
   112801 tcgcaggagc tcctgctggg ggtggtcaac gccctagaga gcgtgaccgt ctacccggcc
   112861 tacgactgcg tgctctccga tctggaggcc gccatgtgcc tgctggccgc ctacgggcac
   112921 gcgctctggg acggccgcga ccccccggat tccgtggcgg gcgtcatggc cgagctgccc
   112981 cagctgctcc cgcggctggc cgacgacgtc agccgcgaga tcgccgcctg ggagggcccc
   113041 gtcacgggca actactacgc ctaccgcgac ccgcccgaga tgcgctacta catgccgctc
   113101 agcggcgggc gccactacca cccgggcacc ttcgaccggc acgtgctggt gcgcctcttt
   113161 cacaaacgcg ccgtgctcca gcaccttccg ggctacgagg cgcagacggc cgccgtggtg
   113221 caggagcggc tctcgggcca ggtgcgcgac gatgtgctct cgctctggac ccgccgcctg
   113281 ctcgcggcca agatgggccg cgaggtgccc gtcttcgtgc acgagcagca gtacctgcgc
   113341 tcgggcctca cgtgcatcac ggggctgctc ttgctgtgga agattgccaa ctcggacagc
   113401 gtcttcgctc cgcgctcggg caaattcacg ctctcggacc tgctgggcca agacgccggg
   113461 gggcttccag ggggacgggc cgggggcgag gaggagggtt acggcggacg ccgcgggcgg
   113521 gtgcgcaact ttgagtttct ggtgcagtac tacctgacgc cctggtacgc gcgcgaccag
   113581 acgttgacgt tctcgcagct ctttcccggc ctggccctca tggccgtcac cgagagcgtg
   113641 cgcagcggct gggatccctc gcgccgggac gaccaccagc gcgaggagga cgcggtgggg
   113701 ctgggcctcg ggggcaacgg gggcggcgct ctgctcatgc agctcagccg cgtcaacccc
   113761 gtggccgagt acatgttcgc gcagagctcc aagcagtacg gcgatctgcg ccgcctggag
   113821 gtgcacgacg cgctgctctt ccactacgaa cacgggctgg gccgcctctc gtcggtggcc
   113881 ctgccgcggc accgcgtctc catcctcggt tcctccctat tcaacgtcaa cgatatttac
   113941 gaactcctct actttctggt gctggggttt cttccgagcg tggcggtggt gtaagcgccg
   114001 tcacgtgtcg cccgcagcat aaagggcgtt cgcgagcgag ccaggttaga gaagagggtc
   114061 tcggcgtcga cacggaggag gcagacagac ggcaggcggc cggccgggca ccggctgcaa
   114121 ccctctcctc ttctgcctgg taccgatgac cgtcgcgctc tcctcctcga ccagcctgaa
   114181 cgtggcgaag atcgtcgtcc ccaacgcagc catgatcgcc gaccgcgccg cctcggatct
   114241 gctcaccggc atgttcgcct ccatcagcgt cctcaacctg ctggccatcg ttggctgcct
   114301 ctggatgctg cgcgtcaccc gaccgtccat cgccgtgcag gtctttacgt ggaatctggt
   114361 gctcagccag ttcttttcca tcgtcgctac ggtgttctct aagggtatga cgctgtccgt
   114421 gtataacgcc gcggacctgg gcttctgccg cctggcgctc ttcgtcgaag acgtgggtct
   114481 ctactccact tcgctgctgt ttctcttcct catcctcgac cgcctggccg ccatcgcgca
   114541 gggccgagac ctgtggcggc accagacccg cgagaacgtc agcctggccc tctacgtggt
   114601 ggccttcatc tgggtgctgt ccgtcgtggc cgccgtgccc accgccgcca cgggcaccat
   114661 cgatttccgc tggcgcggtt gcgagatccc gctgcagtac tcgggcgtgg acctgactat
   114721 caagatgtgg ttcgtcatgg gcgcccctat gatcgccgtc ctctcgtacg tcgtggactt
   114781 gagttacaac gacaagcgcg acgccgcctg gccctacgtg ggtcgcgtct gcagttacta
   114841 cgtgacctgt ctgctgctct acgtgcccca ctactgcttc agggtgttgc gtagcgtggt
   114901 ggagcccggc gacacgacct tcgggatcat ggactacatg gagctgggca cgcgcaccgt
   114961 gctcatgctg cgccttagcg tgctgccgct gttcatcgtg gcgctcttct cgagcaaccc
   115021 tacccaggac ctggacgtgt ccctcgagcg gctgctggag agctgctcgc gcagcggcgg
   115081 ctgctgcggc gtcagtcgcc tgttgcgaaa gctgatggag atgctgaaga ggatgctcca
   115141 cagcgtggag ttggtagtgc gcttcgattt tgggtccacg tcggagaagc ccgacgtcgc
   115201 ccagaaaccc tgctcctgcg ccgtcgccgc ccccgtcgtg accgccggcg tctccactac
   115261 gtcggacaag gccacgctgg tagaacacgt cgaggacgtg gcctacgatg acgttcctag
   115321 caccaccatc gaagtcgtct cggccgagag ttcctccgtg ttgtgcgccg ccgtggtcgg
   115381 gggcagcatg cccgtcacgg ggatttagag ggaggacctg acggtttacg gtttggtagc
   115441 agcgatagga ccaaaaaacc acacagacag cacaggaggt cacgcgtcgc tggccagggc
   115501 cggcatgtgc agggcgcggg cggccgccac ggcctccgga ctcagcgccg cggcgcgggg
   115561 gtgacggtgg ttgtgcggac ggtggtagtg gtgcagggac agcgtcccgg cgaatgttct
   115621 gtaatcctcc ataataaagg taaaaatgcc cgtctcgtgt cgactcctct ggatctcgaa
   115681 ggcgtcgggg gtgatgcgca tcttgccggt accgatcagg taaaagtacc acatcttttg
   115741 acagatgatg cggatcaggg gctcgtgcgt gtcggcgccc cagtggcggg tgaagaaggc
   115801 ggccaggcgg aacagccggt gtccgtacag cgtgcccagg gagaagagga tgttgccgtt
   115861 gcgggccagg tcctcgggga aggagatcag aaggccggtg tgacggcgca cgaagcgcgt
   115921 cagcagtccg ccgctcaggc gcgggtggct cagcaggcgc tggctcaggc gggcggcgca
   115981 cgcctcgtca aacacggccg cgttaaagtc caggcccggg aaggcctggg tcagctcgcg
   116041 gtagaggtga ggccagtacg gttggggcgt cttgcggctc agtacggcgt tgtccgagac
   116101 gcccaggttg ttcatggtct cgcgcaggag cagcgtctcc aggccgcggt ggaagagcat
   116161 cacgcagatg agccgcagga tcttgagctc ttccaggcgc agcgagtgca gcggctgtcc
   116221 gcgcgacatc ttttcgctga tctgtaatat tagatgattg gcgcaggtga aggagaactt
   116281 gccggtgcgc acctgctgct gctcctgtgg ccgcggagag gagggagacg tcgccgtcgc
   116341 cgccgcttcg tcgtcctcgt cggccatcgg ctgtcctaga ggaggaaacg acggcaacga
   116401 tggctggggg ggacctttcg tccccttctt cctccgtcgt ctacgtgggc ggcttcctca
   116461 cgcgctacga ccagccgccc gacgaggccg agctgctgct gccgcgcgac gtggtggaac
   116521 gttggttggg tagcggcggc gatggcacgc cgatgcctct caacgtcaac cacgacgacg
   116581 cggccgtggt gggacacgtg gcggcgatga agagcgtccg tgacggcctc ttctgcctgg
   116641 gttgcgtcac ctcgccgcgc tttctggaga tcgtcagccg cgcctccgaa aagtccgagc
   116701 tggtctcgcg cggccctccc tgcaagtcgc tgcggcccga caaggtggtg gagttcctca
   116761 gcggcagcta cgccggcctc tcgctctcca gccgccgctg ttgcccgtcg tcggtggagg
   116821 cctcggaagc gccgtccact tccacggcgg tcccggagtc ggcgcccttc aaacacgtgg
   116881 ctctgtgcag cgtgggccgc cgccgcggca cgctggccgt ctacggccgc gaccccgact
   116941 gggtgctgca gcggtttcca gacctgacgg ccgccgaccg cgacgacctg cgcgcgcagt
   117001 ggcgcggctg cggcggcgcg ccggcgggag acccctttcg ctccgacagc tacggcctgc
   117061 tgggcaacag cgtggacgcg ctctacattc gcgagcgcct gcccaagctg cgctacgaca
   117121 agcagctggt cggcgtgacg gagcgcgagt cgtacgtcaa ggccagtgtt tcgcccgagg
   117181 cggccgcgga gccggcggtc acgccgtgcg atattaaagc ggacgaggcc gcctccgccg
   117241 ctcagccgcc gcctcctctt ccaccgccac gccgcagcgc gccggctccc tccaagccta
   117301 acccgccgtc gctgccgccg cccgaggcgg tggagatgtc gcacccgctg acggccgcgg
   117361 cggctcccgg cgccgccgcc atcccgccac cgccgtcgtc ggccgtggtg ccggctcccc
   117421 tcacgctgcc ccacgacgga gtttatttac ccaaagacgc tttcttctcg ctcatcgggg
   117481 ccagtcgcca acccgcggtc cccgctacgg cgcctccgtc ctatcccgcc gtcggtgccg
   117541 tgcccgcgta tcctcaccat ccctccccgt attctcacca gcccccgccg cctcctccac
   117601 acccggcgac gggcctgtcc ggcggggcgt acggcggtat gcactccgtg ggctacgacg
   117661 acctggcggc acgtcacttc ggagcctacg atcccggcgt ctactgggcg cggcgctacg
   117721 accacctacc gccgcccccg tcctacccgg cgccgtatgc ggcctacggt cccccgccgc
   117781 cgccgccacc tcagcagcag caccaccatc atcaccgtag acgcgacatg atggacgatg
   117841 cgccgtcgac gtgggagcgg tacccttacg acggagctcc tccgccgccg ccgtcccagc
   117901 agcatggtgg cggcggacac cgtcagaagc agcgtagcgg taaacgtcgc aaagaggcct
   117961 cgcagtcgtc ctcgtccgac gaggacctga gtttccccgg cgaggccgag cacggccggg
   118021 cgcggaaaaa gctcaagaac cacggcggtg cgcaggacgg gggaggagga gagcatcatc
   118081 gcggcggcgg ccagcaccag cgctacgacg agctgcgcga cgccatccac gagctcaagc
   118141 gcgatctctt cgccgcccgc caggggtccg cattgctctc ggccgccatc cccgtgcccg
   118201 gtgtcagcca ctcggcggcg ccgtcgccca cgaccacgac cgcctccagc cccgccgaga
   118261 cgcccatgat caccggcgac gccaccccac cgccgcagac gacgcccgcc ggcaaagtcg
   118321 gggccgccga gcgcgcggcc gccgccgtcg ccggggtggt caatgcctcg tgtcgggtgg
   118381 atcacgcggt agccggcacc agcggcggta gcagcagcac taccaccgcc gccggcctgc
   118441 ccgccgccgc gttggccctg cagaacccgc ccaaggacat ggtggacttg aaccgtcggc
   118501 tctttgtggc cgccctcaat aaaatggagt aaaaaagtgg accccggtcg tgtgtgactt
   118561 cttctgtctg ttttcccgtc ctctgttgag ccctcaataa aagattacac acgctcggcc
   118621 ggttcgttcg aggtaatcgg tgtacgggtg ctttattatc atcagcgtca tgcagactgg
   118681 ttgtatatat aacgtaccat gatcacagca gtggcttttc agagacagac acacagacat
   118741 acatacacgc acatcagaca gcatgcttat ttttttctct cagatgcggg gtcggcttcg
   118801 ggaggcggcg gtaccgctgg tggagggcag gctcatgggc gaggggcgcg gcaccggcac
   118861 gggctgcagg ttgctggtga agtcggcggc cgtgcgcacg tcgccctgca tctcgctgcg
   118921 gaggtaggag gtgggtttca gggctgcctg ttccacgctg cccgtcaggg gtaccaggtt
   118981 gtctatgttc acgaatacgt tccaggaggg gatgacgagc atgaggtcct cgccctcgtc
   119041 ggcgccgcgg cgtgggcggc ggcgtcccgt cagggccagc gcccgagaca gtccctcctc
   119101 ggtgtccgac tcctcctcct ctgagctctc ctcgaaggcg gcgaacacgg attcggatag
   119161 ggcgggcggc gtcggggtgc tggagcgctc ctcctcttcc tcttcttcct cctcgccttc
   119221 caacggcagc tcgccgggcg actggggtcg gaactcggat acctcaccgc gcatcacggc
   119281 cctccgagga aacaggccgg cgcgcagctg gatctggggc cgcttgatct tctcggtctt
   119341 gcccggcagc aggttgagca cgccgcgctt gaacaggtgg atggtgccca gtatctgcat
   119401 gtgctcgatt cgcacggagt tctcgcccgt ccaggtgagg cggatggtga tgcgcacgcg
   119461 gtcgggcagg ggtccggcct ccatggacac gccggggatg tccgccggga agaagatcac
   119521 gtcgtgggtg ttgttggtct cgaaggcgtt ctgcacctgc acgatgtact cgcgatggag
   119581 gcgcgacagt gtgaagccgc gcggggcgtg cagggtgaag ccgttgtcgc catgccgggt
   119641 caggtgcggg tacgggttgt gccgcagcac cacctcggcg ccgtgcgtat agagtgagaa
   119701 gtgcaggaac acgctgggcg gcgggtgcag cgtctcgtgc tgcaggtgga cgtttaccca
   119761 ctggccgcgg gcgtccgtct ccgctttgtg gatgtaggtg ttgcggtccg agcacgacag
   119821 cagctccacg gcgtccacca gcctcagcgg gatggccccg gcccggaaga tgaactcggt
   119881 ggtgaagatc tgctcggcct ccaggctgcg gtccaccttc cggcgccagc ggggcgacac
   119941 ggtggtgcgc acgccccagt ggtaggcggt gcgtcggata tccacccggg cctcggtccg
   120001 cagtcggttc tcctcgtcgc cccgcgggtg ggcctggaac aggtggatgc cgctgacggg
   120061 cacccgctcc aggggcagtc cgaaggccag caccgagatg ggcgtcgacg agccgggcga
   120121 catgcgccgc tggctgtagt tgatcaggtc ggccttgagc tggtcgcgct cgcccaccgc
   120181 gcagtgcccc ttgacgttca ggtccgtcag gtccaccgtg tcgtgctgcg atttgttctc
   120241 ctggaagagg cacagcaccg aggtgcggct cacctccacg gaggtgcgca ggtccaggat
   120301 tttgaggcgg tccggttcca gcgacgagtc gtggttggtg accaggcgca acacctggca
   120361 gtgcatccgg ccgaaggtgg atccgttatc cccgggcgct cccccgggac cgccggccgc
   120421 cgagggccct tccccgggcg aaggagatcg agacatgcgg tggccgctgc tgctgcttcg
   120481 gacgaaggag gacgggaagg gggatcggga gcgagacggc acagaggatg ggtgcaaaga
   120541 gacaggtgaa gaggaggaca ccgatgctcg cgtccgccgc aaataataca gcgacgtccg
   120601 caggtgtctc cgccgagagg cgcgtgtggg ggacgacgtg gctttttata gacacccccc
   120661 gagcgcggtg gctcaacccc ggtgcttttt gggtgtcgag gcgatgcacg gcgcggccgc
   120721 cggctcctgc cggtagcgtc tgcgttttgg cagcgggcag ggcacccaca cgccctccag
   120781 atcgtggaag atgcggtaga catcgtcggc gtcccagaag aactcctggt acttgaggtt
   120841 gtggccctgg accgtggcca ccaggggcac caggtggcgc gcctggatgc cggcctgcca
   120901 ctggggccag gtgaacacgg ccgggttgct gctgtcgatg tccgagtcct cgtcggtatc
   120961 ctcctcgggt gccatgctgg actcggcctt gaggcggccg cgcgtcatca cgcccgtgca
   121021 ggtggtcggg ggcggctgct tgcgtttgcg gctgcccgcg gcggcggctc cggcgagggg
   121081 cagggggcgg ggcggtttgc ggtccgccag ctcgtcctcg tcggagtcgg agccgctgct
   121141 ccagacctcc tcggcggcgc cgacctcgtc gccgctgcgc cggtcccagg tgtgctggta
   121201 ctccagcttg ccgcatacgc ggaactggtc ggtgaaggtg gggtgttcgc tgtactgggg
   121261 gccgcgcagc atgagcatgt cgcggtcgaa gaagaagagg gcggccagcg cgtcgtactg
   121321 gcgtatctcc acggtctcgc gcagggcgcg cagctccagg aagatgtgct gtccgctcat
   121381 cagcaggttg ctcgagatgc tcaggcccgg gatgaccttg gggcagatga ggccgaagtg
   121441 ttcgtgggag gtgaaggcca cgtccagcat gacgtgcgcc gtcttgcccg gcttgatgac
   121501 caggctcttg ggggccatga tggtgaagcc gttgcgctgg tgcttgcgca tgaagggctg
   121561 cgggttgcgc gtcatggtta ggtcctcctc ctcgtcggag cccagcgaca ggtgcagaaa
   121621 gagcttgcag gccggcacgt cctcgtggaa ggactccagg tagaccttca tgtagtgctc
   121681 ggccaccacc tgcatcttga ccacgcgcgt gttctccagc gagcacacca gctggctggc
   121741 gctcaccacc tggcgcagcg ccacgtcctt ggtgttgaag atgaacgacg tggtgtagta
   121801 cacgtcgggc tccttccact ggttctgctg ccgcgcccac gataggttag acacggtcag
   121861 gcgcgcctgc cacacctgct tgcccgactg gtggatgatg gtgtcggcca cgggcaggtg
   121921 gcggtacttg cgctcggccg tggtggggta gtggtgcacg ttgatgtcgg gcacgttcac
   121981 catcttgagc ggcatggcgt acacgtacag cgacatgggc tcctggctgg ggcagatggc
   122041 ccggcccgtg gggttgtgca cgttcaccgt cacgttctgc acctcctcgc ccgtgtgata
   122101 ggtgtgctgc accatcaggt ggttgtcgcc ccggtggcag ggggtcgact cgggcgtgta
   122161 ctgcgagatc aggatcagtg agtgctggct gaccttcacg tcgatgcccg tctgcagcga
   122221 cttggtctcg tgcggctgca gcggcgtctc gccgcggctg aacacggctt tcagcacgtg
   122281 ccccgagatg gggcccagga cgtttatcat ttcgggctgg cgacgccctc gcgactccat
   122341 gctgcctgcg agcgcgggtg ccggcgactg agcgccgcca cgtcgctggg cgtctactta
   122401 catactacgg cccaagccgc gtggggaatc ccggctttcg acgtcgaaaa cgaagcacac
   122461 gacacgcgga tcggcgtgga acacaacgga ttgctttatt catttacccg acaccccgaa
   122521 agacgacaga ccaccaccat cgacccggac gcgacgacca caacgcccgg tgggaaaaag
   122581 aagagagacc ctcccccaga tgatactaca acagcagtag cagagagaga cagtgacttg
   122641 tagtgttttg tgggttgttg cggcggcgtc cctagaggtc gccgcagatc atggctagcg
   122701 tcacggggct cggtttctcg gtcgccggcg tttgctgttg ttcctgcgtc ggctcggcgc
   122761 tcaacagccg catgggcagc aggtcctgga gcgcgatcga ggcgcccagc accgacagct
   122821 gcggggccgg tcggttgtgc agcgccgact tcacctgata cgtgagcgcc gacaggcagc
   122881 cgcggttgag cgtgtgcttg gacgagatga aatacagacg tcccagcacc gagtcccgcg
   122941 gcagcgacac gccgccgcta ccgtcgtcgt cctgaccgct ctggttgtgg tggttgctat
   123001 ggttgacgac gccgtcaccg ctcgcgttgc tgctatccgc tgcgttgcta tgattaccgc
   123061 tcaccagcac cgtgatctcg agccacgtgc ggggtagcca gaccgtcacg ggcatcttga
   123121 gtccctgacg gttctggggg acgaagagtc cgaggtaggg gccgtagaaa cggcgataga
   123181 tccgcagcgt gtgcgacgcc ttgaggcaca gctcgtaggg cacgcgcacc tccagaccgt
   123241 cctcgccggg ccgctgtacg aagtacggca gcggcgcgtc ggaaaagaag ggccggcgca
   123301 ccgtctcgcg gcgcagtcgc aggcggaacg acaccgggtc gctgggaccc tcgctgcggt
   123361 cgcacgtcac gttgaaacgc aggacgcagt cctggtacag cgtgagcgac gacagcgtca
   123421 ggtccgcggg cgactcggcg tccagttcca gccgtccgaa caccgacggc cccagcgccg
   123481 cggccgtggc ctccgacagc cgcaccgaca ggcggctagt caggccgcgc ggacccgaga
   123541 tgccgccctc cacccggtgc cagcacagcg cgtgccgcac ctgcaccgtc aggctgggcg
   123601 tcagctccgt gtccgtcgcc ggcggggtgt cgtcgtcgcc gctgccgccc gcaatccgcg
   123661 tcgcttcgaa cgtcagttcg ggcaggtgca gcgccaggca gtcgtgcagc gccgcgtgat
   123721 gcgtgccctt gcgtcgcagg ggcagccgcc gtagcagcgg cgtgatgatg cgcagcgcaa
   123781 acaggttcag cgacaggcgc acgatggcca tctgcgccag ctgctggtcg atcatcgagc
   123841 gcacgatgtg acatcccgga cgcgcgggga acagcgagaa ggccggccgg atgtccgagt
   123901 cctcgttaga caccacgcag aggatgcctc gttcgcggtc ctcgttgcgg tcgtcttcgt
   123961 cctcctcctc ttcccccgct ccttccttct cctcgtttcc cgccgttctc tcctcggaag
   124021 ctgtcgcgtg ctgtcggcgc gcggcgctgt tctccaccag ttgcagcggc gccgatagca
   124081 ggatctggaa ggggtgctgc agttcctcgg gtcgcaggtc gatgtgcagc tggatcaggt
   124141 ggtaggtgcc gcggtgcgtc agcggctgct tggcgttgtg cttgtccgtc agcgtcagga
   124201 tggtgtcgtc gtcgggcccg acggcgtggg cgggaagcag cgcgtcgctg tggtgattcc
   124261 cgcccgcgcc gctgcctccg ccgccgctgc cgtgcaggcg atagcgcctg tgcgcctgcc
   124321 ggctgggggt gagcgggccc tttctggccc gcgaccgggc ccgattccga agggttgggt
   124381 cgccgcgcgg catgcttggt gtctgcgggc gcgagagggc tggctcagcc cttaaatatg
   124441 caggtcgccg atttgttatc gggagaaacg tcacacaccg taaagatcgt ctgctcgcga
   124501 atgaggtcat ccagctgtcg cagcatgaca aacagggccg acagccgcga gatctcctcg
   124561 tccggcgaga cgtggttggg ccgcggcggc acgcgttcgc cgccgcgctc gcggtccgtc
   124621 cgcgtcagca gctcttggca cttgacgagc agcatggagc tgtcctccag cgccagcttg
   124681 cgcacgtacg tcacgatcag gtccgaggcc aggttggcca ccatggacat ggacaggcag
   124741 gccgtcttca tgtcgagtag caggtagttg tcgatcaccg ggtcgggcag cgtgaaggtg
   124801 gcgtcgcggt aggtgatggt ctttagctgg tgcacggccg cctttacctc ctcgtacgag
   124861 cggtcgagcg agaacaggcc catgatcagc agccgctggt tgatctcctg cgccagtggc
   124921 accgggatga cccagggcag caccagctcc cacttgccta gcgtcagcag attttcgcgc
   124981 gccatgggtc cgttgaagag cggcggcagc aggcacagcg cgtcgccctt ctcccacagc
   125041 acggggcccg tgttcagcac ggtgtacagc agtccgtggg tgggcacgtg cagcaggatc
   125101 tggttgccct ccacgcggcg cagcagcgtc agggtcatgt tgcgcagcag gctgcgcatc
   125161 cgcgggtatc cgcgcgtgtg gtccgtgtac tggtgcaggc ctagctgtag gtgcttgatg
   125221 aggtgcaggc gctgcgggat gggcaccacg gccgccgtca gcttggccag tttgcccagg
   125281 tcggcgatgg tcagcttgtg gtcgaaggtg cagaagatgg tggactccat ggccgccatg
   125341 gtggcggcgg caacgcggga gaaaaagaaa cgacgcgcac gggggcgaga tcaacgtccg
   125401 cgcagcacgg cgctccgtca ggcgagccgc gtcgttcgcg gacgcggcgg tgggtccggc
   125461 cacagagcga cacgcggccc acgctgttcg tccgcgctcg tcgcagtccg cgcttcacga
   125521 gttaaataac atgtgctgct gcagcgggat gatctcgccc accacgtagt tgccgaagtg
   125581 cgtctcggac gtggcgaacg cgcccgcgcc gcccttcatc ttggtctcca tcaggcccag
   125641 cgtcgtggtg ctgaggatcg gcagcgcttc ctgcgtcaga cggcacgggt tttcgatcag
   125701 ttgttccgtg ccctcgacgc agatgtactg cgtgtccgtg tcgccgcgga tgcagtcctt
   125761 ggcccgcagc aggtactcgt cgatggtctt gaacagcgtc ttgttggagt tgatgatctc
   125821 gtccgtgtcg aagaactgcg cgcacgggct gtagaacttg cagttgtagc ccagcttctc
   125881 gcggtgcctc gtgttgtaca gcacgtcgct caggcagccg gcctgcgagg cccaggggtt
   125941 gtgcgtggcc gtaaacgtct gcgcgtcggg ctcgcggtgg tcgtacagcg ccttggtggc
   126001 cgcgtccgtg tcgtacgggt ccacgcccag catgcacgag gcccggccgc gcgggttgtt
   126061 tgtgatcttg tagtagttga tgtcggccga cgcgggcgtc agcaccagtt cgcacaccgc
   126121 cttctgtccg tgcaccgtgg ccgccgcgtt gcgctccgac atgctgccga acgtcagcat
   126181 ggagatggtc tccgtgtcca gcagctgtgg ccgcgccacc cccacggcgt gccggatcca
   126241 gcggtcgatc tcgtcgtgcc ggtacacgtg catggggaag acggcgaaca ggtcctgcac
   126301 gcgcacgccc atgtcggtgc gcacccggtt cacgtaggcc acgcacgtgt tcgacgtgta
   126361 gcccagcccc atgtcaacgg tgttgatgtt ctgcgacacg tggtacgtgg tgctgatgtc
   126421 gcgctcctcc ttggtcacga tggggttggt gatgatcacc gacgtgcacg acttgccgct
   126481 gtacagcagc atgtccacct cgaacgtgtc ggtgcgcacg gccgtcaggg cgaagcccgg
   126541 gtggatgtgg gccttggtct gcagcaccag cgacaccggc gagatcttgt acagcatgga
   126601 ggccagcgtc atgaccgagt gcagcacgtt ggggcaggtg gccgagtagc gcgagaaagg
   126661 cgagcgcagc cagctgtggt actcgtgcgc gaaggccgtg ggcagcggga agccgccgtc
   126721 gtgccggtgg tagtgcggga agtcggtgat gtagcgcttg atgtcgtcgt tgatgcccga
   126781 gccgatcacc gggtccgagt agaagcggtg gaagggcacc gccaggcagt actcgaccat
   126841 gatcttgggc gccgtcaccg cacagcagcc gttgtacagc acgaactgca gcgacgtgaa
   126901 gtccggcagg ccctggcgct gcgcgtggtc cagctccgcg cgcacctcca gcaccttcgc
   126961 gtgctcgccc acgaactgca ccgccaggaa cagctcgcgg caggcctgcg tcagtgagac
   127021 gtgcgcgtcc gtggcgatgt cctccaccag ctcgctcagc agctcgccta cctgctgtcg
   127081 ctgtgccgcc gcggaacccg cgccgtcgtc gccggccgcc ccgctgccgc tgcccgacgt
   127141 ggcggtgccc gacgacgccg ccgcggtgcc cgtcgcgctg gccgtcgccg tcgtcgacgc
   127201 ggcctgtcgg tcagccgcca gcaggaacgt cgggcggtag aagaggtcca ccagcagcgt
   127261 cttgaggttg agtcccagcc cgcaggcgcg gttgttggtc atggccggca tgaggcacag
   127321 gtagaagacc ttctgcagcg tccactcgtc gtcgctggcg cggtggtcct ccacgaagag
   127381 cggctcgtcg gcgtccatgg cgcccaggcg cggcacgtcc gacacgccgt ggtggcgcgc
   127441 ctcgatgttg gcgttggtca gcggctgccg gtcggccacg atctgcacgc cctccgtggt
   127501 gcgcggcagg tgcgtgatga agggcggcca caggcggtgg tcgtgcagcg cgttcacgta
   127561 ggccgccagc ggctcgtcgg ccagctggcc gttgttgacg cccgccagcg ccgagatgcg
   127621 cgtcaccagt cgcaggatgg ccaccaggtt gcggtagtgg aagagcatgt gcggcggcag
   127681 cacgccgtcg gccaggtgct cggcgatcag cgtcaccagc gagtagctgt gcgcgaaggc
   127741 cagtaggctg cgcgtctgat acatgttgac gatgcagcgc gccacgaagt tgcgcaggat
   127801 caggaaggcg tccgtgttgc cgtgcaccag cacgtccacc aggtagaaga gctcggggta
   127861 gttggcgttg gtcacggtgc tcttgaagag ccgcagcgtc tcctcgtagt cgggcggcgg
   127921 ccgtagccgc acgtgctcca tgatctgcca ggcgcgcagc tcgtggaagg gccccggcgc
   127981 cagcccgtcg ggcaggttgc ccaccaggat gcgcggcgtg cacagcggca ccgtctcgct
   128041 gttgtcctgg cagtgcgtga agtcgaagaa ggggtgcagc tcggtgtaga gcgtcagatt
   128101 gcccaccttg tagaagtcgg tgaccacgaa gtcctgcttc atctcgttca ccgtgcgcgg
   128161 cacctcgcgc cgcacgcggt agaagtggcc gacgcgccgc gcgatgccgc ccatgggctc
   128221 gcgctggaag cgcgactcca gcaggcgctg catcatgggg tccgagggcg gcccgcgctc
   128281 ggcgaaggcc tgcaggcagg gcgtggggtc gtgcagcacc gggtggcaca gcgtcttgag
   128341 cgcgtccacg aagtccatct tctggatggc gcggtcgcgg ttcagcaggt aggccgtggt
   128401 gggcagcgcg ttgcggatgg tgtcggtcag cttgagcttg ctctccaccg tggtgtagcc
   128461 gcggtcctcg ggcaggtaca ggcccacggg gaagaagaag gtcaggtcca cgttgcgctc
   128521 cagcgggtcc ttggtgtcgg tgtttttgta gacgcgccgc aggttctcca ggatgaccga
   128581 gcgctcgccc aggcggatca cgtccatggg cagcggcgtg aggctgtgcg cgccggcctg
   128641 cgacagcgag tcgctgggca ggtgcggctg gcccgacgtc aggtggccct tgtaggagtt
   128701 gaagtcggcc aggatggagt ggtaggcgat ggccgtcacg gcgttctcgg ggctgagcac
   128761 gaagttgccg taggtggccg gcgccgacac cgtctccttg ctgatgaggc ccgagagcag
   128821 cgacatgatg atctgcatca cgttggccgt gctcaccatc acgccgctga tcttggcgcc
   128881 cgagcccgtg gtgtaggtgg tggggttctc caggatgctg tcggtggcgg cctccaccag
   128941 gcgcgtgagg aacttgacga tgtagtcgcg gtctttggtg cggttgagca ggaacagcgt
   129001 ggccagcagc ttctgcttga agctctgcag gatgttgctg cgctggatgc ggttgagggc
   129061 ctggcgcgcc agcgtggcgt tctccaccag cgtctgcacc acgaagtacg gcggcgcttt
   129121 gcgcagcagc gtctgcaaga agctgtggat caggccgcgc tccatggcgt cggccgtgtt
   129181 cttgagcgcg cgcagcaccg tgtgcatggc ctccacgttg aggatcttgt ccaggatggt
   129241 gccctcgaag gtctcgcgca ggtacgtcag gcaggcggcg ctcagctcga aggggatggt
   129301 gatgggcgac ttctcgctgt atttggtgac catgatggtg gtctggcgcg tggtgggcag
   129361 tccggcgccg ctggccacgc gcggcacctg gatgtggaag agcatcttgc ccgtggtcag
   129421 cttgttgagg tcgtggaact tgatggcgtg cgccgccgcc gccagcccgc tggtcaggaa
   129481 gtagacccac tccaggcggt tgcagaaggt gccgaagatg gcctcgaagt ggatgttgta
   129541 gcgctcgggg tcgtcgccgt agtagatgcg cagcgcctcg aacatctcct cgcccgcgct
   129601 ggttttcacg tgcgtcagaa agtccgcggg gatccctact ttagggagga gctcgagcgc
   129661 cgaccagttc tccatcgcgg cggcgctggc acggcgggcc cgacgatggc tgctccgccg
   129721 cgccgcgccg gccgcgacgc tctaatagtc gagtcgccgg ccgcccggcg ggtgctcaac
   129781 gtccccgtgc acgtgaattc gtacaatctc acgcaggagc tgtcgacggg cgaggacgcc
   129841 cgcttctgcc ggccgcggcc cgtcgacgcc gagcgcgtcc gcgccgtctt cgccgccctc
   129901 taccgcgcct gtcccgcgca cgtgcgcgcc gaggccgacc gcgtcaagtt ggtgctgggc
   129961 cgcctgctgc tggggcccgt ggccgtgccc tgctactgcg acgagtgggt gacggccggg
   130021 gaggaggagg acgacgacgg ggcggccgcg cgcctgctgc gcgaacacct ggccgagacg
   130081 gcgcagttct gccgcgggcc gctgctctac gtgcaccgtc gctgccgctg cgccggcggc
   130141 ggcgcgcaac ggccgctggc tttcagcgtc atggaggggc acgtggccac gcacgtcttc
   130201 cgcggcctgc tctcgctggc cgagtggaac tgccagctgc cgggcctctt ctgcccctgc
   130261 gtcgtcggcg gcgccgccgc tgccgccacc gagcgctacg ccctggcctg cctgccgcgc
   130321 gatctcagcc tgcacatgga cgactacccc tacctcatgg tggagatcgg ccgcgtgctg
   130381 ggcgtcagtg aggtggacga ctacgtgggc gccctctccg gctacctggg cgaggccgcg
   130441 gcgccgcgca tccaggtcca ctacaagctg ctcttcgggc tcaacgtgcg gccgcaggcg
   130501 ccgtgcgcgc tcagcgccac cggcgatttc tttctgctgg agttgcagaa gctctggctg
   130561 ggcgtggagt atcacaacga ggtcacggcc gagtttttcg gtcgcgtgct ggcccagcta
   130621 caccgcgagc gcggccgcgt catgatggcc ctgcggctgc ccgagcagac cgtgtgccac
   130681 ctgagcgcct tcgtgctcag ccgcttcaag cgccaggtgc tgtacttcaa gctgcaggtc
   130741 agctacggca agtacaaaca cgcgcacgcc agcggcctcc accccaacct cctgtgctac
   130801 cgccgcctca gcgtcacgtt cgcggacacg gacacggtgt ggagaaatct tttctacgtt
   130861 tattacgaac tgagtcggga cgtgtcggcg ggcgcgagcg ccgcgccggg ggagcagaaa
   130921 gggaagaaga cggccaccaa ggaggaggag ggggaacagg aggagaagaa cggggaaagc
   130981 aggggacacc acggcgagga cgatgacgag gatgaggagt atcagcgtcg gcaccgtctc
   131041 tcgtcgtcgg gtcacggcgt cggcggtcga ggtcgcacgc agttactggt ggccccgccg
   131101 ccgcccgtca cgtcgttgtc gggccggagt cacgacgtgg ccatctccgt gccgccctcc
   131161 tccacgtccc gtctcctggg cggcggcggc gggcctctgg acgcggtggc ggcgaccgcg
   131221 gctcgcgcgg gctccggacg gcggggcggc gcggctgccg ggaagggaca gcgcgacccc
   131281 tcggccgatc gcatccgccg ctacgtctgc atcatctcgc gtctcatgtt cgcccgctac
   131341 ggcgagaggg gccggcgcca gagacagcgt cgcgacggcg atgccgacgg gagcggcgct
   131401 tttgatttca ccggccagaa cctacgtcgg gcctaccagg aacaccgtcg gcggcgtcac
   131461 ctggccgtgc agcgcttcgc cccgtgccgt cgcaagctca tcggcggcat ggagttcgcc
   131521 gaggtgacgg gcgtcagcct ggaccgcatc gccgtcaacg ccttcaacac caaccgggtc
   131581 atcaacatga aggccgcgct ctcggcctcg tcggcctcct gcgccggctg ctgccgcctc
   131641 aaccgcctgc ccaagaacat gacccacagc ttcgtcatgt acaagcacac cttcaaggaa
   131701 ccggcctgca ccgtcagcac cttcgtctcc aacgacgcgg tgtacctgaa ctcgctcaac
   131761 gtcaacatcc gcggatcgta cctcgagttt ctctactcgc tgggcgtcta ccgcctgcac
   131821 gtcaacatcg atcacttctt cctgccggcc gtggtgtgca acagcaactc gtcgctggac
   131881 gtgcacggcc tggaggacca ggcggtgatc cgcagcgagc gcagcagggt gtactggacc
   131941 accaacttcc cctgcatgat ctcgcacacc aacaacgtca acgtgggctg gttcaaggcg
   132001 gccacggcca tcgtgccgcg cgtgtcgggc agcgatctgg aggccatcct gctgaaggag
   132061 ctgtcgtgca tcaagaatat gcgcgacgtg tgcatcgact acgggctgca ccgcgtgttc
   132121 acgcagctgg agctgcgcaa ttcgtaccag atcccgttcc tctccaagca gctgatcctc
   132181 tttatccgcg tctgcctcct caagctgcac ggccgggaga agcggctcta cctggatcgc
   132241 ctagtatttg aggcggcgca gcgcggcctg ttcgactaca gcaagaacct gacggcgcac
   132301 accaagatca agcacacgtg cgcgctgatc ggcagccgcc tggccaacaa cgtgcccaag
   132361 atcctggccc ggaataagaa ggtcaagttg gaccacctgg gccgcaacgc caacctcttg
   132421 accgtgtgcc gccacgtgga ggccaacaaa atctcccgcg tgcgcctgcg ggtgctagtg
   132481 gaagtgctga gcacgttgca gggtatcagc ggcacgccgc acacccgcga ggtcatccgg
   132541 cagacgctgt ttcgcctgtg cggcgacgcc gctggtagcg gtggtgggct gttcggcgcg
   132601 tccggtcagc cgtcttcgga gaccgccgtc ggcgcggacg tgatttttgc ttctggtctc
   132661 acgtcgtcgt caccgccacc accgccctcg gtgccgccgt cttctccggt cgacaccaga
   132721 agatgatgga agcggcggcg tcggcgtccg caacggcttc cagactcggc ggcggcgcca
   132781 ccggcggttc tgcttcctcg tctttcttgg aagaagacga tcggctcgcg cccggctggc
   132841 gggacgcggc actggtccaa ggcgacggaa gtgtccgcga gcacgcattc aaaaacgtag
   132901 cgttatccga gctggtccgt cgcgtcatcc cgccgccgcc tgacgccgac gaaggcgtgg
   132961 ttttcgcctc cgagctctct ttgtacagca gcgggcgtgt gagtcgcatt tcgtccgtct
   133021 tctctatcta ctggcagggc cactccgagt tggtctacat ccttacgggt ctcacacact
   133081 gcacgaaact agtggtcgaa tgtgggcaga tgaaggggac ggtaacgggg gaccggggtt
   133141 gggacgggga cagccgccac cggcacagta tcagcagccc ccaccacagt ggctccagca
   133201 gcagcagtca cagccatcgc agccgccaca ctggttacag caacagccgc cctcgccaca
   133261 gccacagcag tggcagcagt accagtacca ccaccagcag cagccgggac accagcagtg
   133321 gcggcctcgg cgatcgggac gaccgcggtc ggggcgcggg ttcaggggcg atggcggtcg
   133381 aggacgacct cctctacgaa gtccccggaa tctatatgat tcgggtctcg gacgggaata
   133441 tgggtccgag gaacgtggta tggccgaaga ccagtgtgct ctgggcgccg gacgtggaga
   133501 tcagcacggt ccgccggcac agcgcggcgg tccgcgcttt cgcgtcggct ctcaggaact
   133561 acatgttttg gatggggcgc cgttcgcagg aggagctgga ggtgtgtccg cccgaggtcg
   133621 aggatcacct ggcgccgctg ctgcggggcc caacccgcgg cgattcggag attttcgacg
   133681 gcctcgtggg cagcgcctat cagcgcctac gtcagagcga catcccgcgc tcttcgagcc
   133741 tcctgctgga gcactgtgtg ggcatggcca gcctcaagaa gctgctgctg ctggacctgc
   133801 cccgcctgga gaacttctat ctctgtcagg tgtgcctgta cgagctggac gaggacgagg
   133861 tgggcgagga gatgctcggt atgctggccg gcaggcccgg cgattccggg gacgcggcgg
   133921 agtttttcct ccaccgcaag actatgaagg tggccgcctg tctggcgctg atgctgaact
   133981 gcctgcacaa gtaccaggag gggctgtcga ctatcgagca gctgcaatcg gtgctacagc
   134041 agcaacgttt ggacgagaac gacctcatcc tggtggcgct gcgccgctac taccgtcacc
   134101 gtacgggcgt ccatgcgcgg acgctggccg cggccaaggc tctcatctcc gagttcgcgg
   134161 agaacttctc tcccatgggc agttacacac gcctgggttt cgaccgcctg ggcgccctgg
   134221 acgcggaggt gtccatccag gacctggtgg ccgtcctgcg cgcctagctg accctgaagt
   134281 ggatggcgtg catctcgtcg cacaggtagg tggccatgat gacggcgatg atgaggtcgt
   134341 cggagaagcg ctggtgccgc ttggccgagt agctgcccgc gccgccctcg gccagggtga
   134401 cccggtgcag gttctgcagc tgctccagca ggtactcgat ggggtcgtgg ttgagcttga
   134461 tggtgtagga gaccacctcc tgcgaggcct tgatgtagcc cgagttgaag cgcgagatga
   134521 actgctccac ggccagcgcc ttgtcgtggc ccatgaggta gaagggctgc tggatgcggt
   134581 tggtgtcggg cgtgtggtag aagagcaccc ggatgagttt ggtgctctgc acgctctggc
   134641 ggatgaggca ggcgatgcgc acggccgccg cctggttgct gttgccctcc acggcgatgc
   134701 gcagctcgtc caggtagggg tgcaggctga ggatggagac ggccatgtgc gccgcgcact
   134761 cggagatggc cacctcggag ctctcggaga ggtcgcgcag gaagaagtgc tccaggccgt
   134821 agatgatgaa ctggtggcgg taggtgccca cggccgccac gcccgtgccc gaggccttgc
   134881 ggttggtggt gaaggccggg tccaggtaga tgtagagggt cttgccgaag tagtcgtagg
   134941 cgttggtgtt gagcgtgctg tagcgcagga tgtcgaactc ctcgcggctc tggtccgtga
   135001 tgagcacgtt gttctgcgcg atcttgttgg tgccgccgat gatctcgtcc atgaaggcgc
   135061 ccggcatgaa catgttggcc gtcttgcgca cctgcgagtt gaggctgatg aaggtgggct
   135121 tgtgcagccg gtagcagggg caggccgtgg cgtcgccctt ctcggtgaag ctgtgcaggt
   135181 gctcctcgca cacgtacgag accacgttga gcatgtcgaa gggcgcgtta ttgagacgcg
   135241 tcaggaagca ggtggcgtcg ctggtggtgt tggtggacga gatgaagatg atcttggtgg
   135301 tgttctgcgc caggaagccc aggatggtgt tgaaggcctc cttcttgatg aagtgggcct
   135361 cgtccaccag cagcaggtgg aagttctggc ctcggatgct ctgcgagtag gggaggaggg
   135421 aggagaagcg cgaaaacgaa accatgaaaa acaaacacaa caggccgggg tcgggcgggt
   135481 tgcctccctc ccgcgcgcgc cgtctccgcg gcggttatcg cccgcgggcg ccaaaccgtg
   135541 ccgaggcggg cgggaaccaa tcacccggcg cgatttggcg cccgcgggaa ccgtcggtcc
   135601 gccccccgtc gacgcggacg cagtggcgcg cacataaaac cgaaagcggc gacgtcgcgc
   135661 ggcgtcccca cgcccgccat gaacgcgctg ttgacggaac tcaaccgcct gggggtcgcg
   135721 cacgcgtcct ccgaggatgt cttcctcttc gtcgaccgcc tctttcacaa tttcgccttt
   135781 ctcttccaga ccgaggagtc cagcccccgt cgcctggaat tggtctccgg cctctttgag
   135841 cacctgacgg tggaatgcgt caatgacatc gtggacgcgt gcaaccaccc ggacgttccc
   135901 gggaccgaag gcggtggcgg cagtggcgct gcgggaggag gagcagcggc ggagggaggc
   135961 gcggcgacga acgctcccgt gcccatgagc accgggaacg tcagcccttc cgtcgtcagc
   136021 tcctccaagc tctcttgtga ctcccccgtc tttgtgccgg cctcggccac ggccgcggga
   136081 tgtgcgacgc ctcgggcgcc tgcgacatga ggcacgtcca caacgccttc accgaggaga
   136141 tccagctgca ctcgctgtac gcctgcacgc ggtgcttccg cacgcacctg tgcgacctgg
   136201 gcagcggctg cgcgctcatc tccacgctgg agggctcggt gtgcgtcaag acgggactgg
   136261 tgtacgaggc gctctacccc gtggcgcgcc gccaccacct gctggagccc atcgaggaga
   136321 cgtcgctcga cgacgtcaac atcatcggcg cggttctcag cggcgtctac agctacctca
   136381 tgacgcacgc cggccgctac gccgacgtga ttcaggaggt ggtggagcgc gaccgcctca
   136441 aaaagcaggt ggaggacagt atttacttta ctttcaataa agtctttcgt tccatgcaca
   136501 acgtcaaccg tatctcggtg cccgtcatta gtcagttgtt cattcagctc atcatcggca
   136561 tctactccaa gcagaccaag tacgactcgt gcgtcatcaa ggtcagccgc aagaagcgcg
   136621 aggacgcgct gctcaagcag atgcgttccg agtatggaaa cgcacctgta ttcggatctg
   136681 gcctttgagg cgcgcttcgc cgccgactgg cagctgccgc tgcacctggt gctcgatcac
   136741 tcggcactct cgtgcgagga ggccgagacg ctgcgctacg tctactaccg caacgccgtg
   136801 cgacccgcgc cgccgccgca gagcaccgag cagggcgggc ccgagcagga cgccgccgag
   136861 gactggcagc gcgccgcctt ccgcgtcctg ccgcgcccgc tcgagctgct ggcctacctg
   136921 cgcgacagcg ggctcacggt cacgctgccc gccgacgacc ccggcgtgcg catgtactac
   136981 gccgtcttca ccaccctggg cctgcgctgt cccgacaagc gcatctcggg ctcgcagatg
   137041 ctctacctgc gtctgatgtg ggaccagggg cgccagcgtg actgggagtt cctggcacgc
   137101 gacctgctgc gcgaggagat cgaggccaac cggatagatc ggcatcagcg cgagctggcc
   137161 gaggcccggg cggtcaataa ccggcggctg acctcaggca ccgcccggcc cctgctgtct
   137221 tccgccacta catcttctgc tccgtcccat cctctgctag gttccgagcc cgcgttcgga
   137281 cgctcggact cgcccgccat ggccgcggcc gcagcggccg ccgccgagct gcccccgctg
   137341 gagtcggcgg ccgggacgcc cttctttcag atcccccgcg caccggccgg ggccgacggc
   137401 ggcagcgggc agagcggggg ccccagcgac ctggagctgc gggtggcgcg gctgctgcgc
   137461 ggcgaccccg agttcaccta tcacgcgggc ccgctggagc cgccctcccg catccgcgga
   137521 cgcgaactgg tgcagacgcg cgtcgacatc aaccccgacc tcatgtacgc caccagcgcg
   137581 caggagcccg tggaggtatc gcgcaccgac gagtggaagg gcgccggcgt gtcgcggcgc
   137641 cgcgaggtct gggacgtgca gcgccgcgtc cgcttccacg tgctctggta cgtcaactcc
   137701 ttctggcgca cctgcggcct gacctacgac gacaacgagg ccgacctgta ccgcgcgctg
   137761 gacgcctacc gctcgcgcat cgcggtcgag tacgtgctca ttcgcgccgt gcgcgacgag
   137821 atccgcctgg tgctgcagca ccgccgcgcg ctgcgccagc tcttcgcctg ccacgtggtc
   137881 cgaaaaatgt cctggatcca cgtctgggag ctcttccgtc acgccctgga actctggata
   137941 gaccgggcgg acgagcgcag ctgcattatt aaggcgctca cgccgcggct gggccgcccc
   138001 gccagagccc cgacgcccga gcgcctggac cgcgacgcct cggccctcaa accgtacccg
   138061 tggctggcgg gtcgcggttc cctgcccgag gagcccgagc gcgtgtggta tgccgacgtg
   138121 gtgcgctgtg tccgcgcgca ggtcgatctc ggcgtcgagg tgcgcgtgcg tcgctgccgg
   138181 cgcacggggc tgtgggtcgc ccgcgaccgc cgcggacagc tgaggcgctg gccctcccag
   138241 gccgaggtct gcgtgctcta cgtcacgccc gagctccact tccactgggt gctgcccggc
   138301 ggcttcgccg tctcctcgcg cctctgtctc gatggcctgg ggcaacgggg tctgcgcgaa
   138361 cgattccagg tcggtgaggc agtttttaca agaggaatgc atctggcgac tggtctccaa
   138421 gggccagaag caccgcgagt atcgggcaat ctgctgcaag tcggcgatct ttagcaccca
   138481 ggacgacagc tcttgcatcc tatgccagct catcctgctg cgccgtaaca ggcacgagta
   138541 catcatctgc ctcaacgcca acggcaagta ccaggggcac tactcgtccc cgcgcgtgca
   138601 tcgccggcgg cgccacatct gccacctgcc gcccgtctac cagctgatca tcacgggccc
   138661 gctgggtccg gcgcacctcg acttcttgcc gcgcttcaac cacgtcgtca gcagcatgtc
   138721 gtgtcgcggc atctcgccgg acaccatgta cgaggtgtgc caggtagtct cggaagacga
   138781 agccaaacgc gtcgtcatca agggagacgg ggcggtgagc ctcaccggcg acaaggccgt
   138841 gagcctgggc ggcacgggcg cctggctggt ggtgcgtccg gagggttacg tgctctattt
   138901 ctacatcctc tgctacgacc tctacacctc gtgcggcaac cgccaggaga tgccctccat
   138961 ggcgcgcctg atggcggcgg ctacggcctg cggccagatg ggctgcacct tctgcgtgga
   139021 tcacggcggc cacgtggacc ccaccggcga gtacgccggc tcggtgtcgg accacggcgg
   139081 ctgcttctgt tacatcccct gcggacccat gacgcagtcc gccatccaca acccggagcc
   139141 cgccaccttc ttctgcgaag acgagaaggc ccagtttctc tgcacctgcg gctccaaaac
   139201 ggcgccgcag atcaccctgg cctcggggct ggactacgtg ttcggcgtga aggacgccga
   139261 ggggggttgg ttgcaggcca agcaggacgt gtgggatctg gtgaaggtgg aggagccggt
   139321 gtcgcgcatg ttggtctgct cctgccccgt gctgaaaaac ctggtgcact gagtaggagg
   139381 agaagagggt cggacagacg ggactcgaca gctttcggac tcagggacag aagaaaaata
   139441 aaatccacat catcttttta ttaggagaaa aggagaatca tgaaaaatac tcacgttcgt
   139501 gttgtagcag ctggcgaaga gcgccgtgct cttggccccg cggtggtcga tgctgatgac
   139561 gttgtccttg ttctccacca agtagtcgcg cgcgaaggtg tagcggcagc ggaactcgac
   139621 ctccttgagc acgaactgag acacgtgttt ctggtgcgcc acgtagccga tgctgatgcc
   139681 gatcatgtgc ttgagtagga aggagatgat ggggatgatg aaccaggtct tgccgtggcg
   139741 ccgcggcacc aggaacacgg tggccttctg cttgaagatc tcgatggagg tctgcgagag
   139801 gaagtcgatc tggaaggcgt ggatgaggta ctgcagcacg cgattggcca gcacggggat
   139861 cttggtcacg gctataaaaa agatgacgtg tatcaataaa ttcttttgaa acggctcgag
   139921 tcggatgggt ttggcgtcgc cctcggcggt ggcgaagccg ccgtcgagcc acttcttgaa
   139981 gtcggtcata aagctgttga tctgcacgaa ctgcgggtcg cggtacagct cggtcagcgc
   140041 gtccagcttc tggtaggagg cgcgctgctc ctcggggcac ggccggaagg ccagctcgtc
   140101 cagggcgctc ttgaggcgct cgtggaacac caactcgcgc ttctcctcgg gcgagtggta
   140161 gtcgcggtag cggccgcaga aggccatgag cggcaggaag gcctcgttgc acgagtgcgc
   140221 caggcccagc tcggggtgca tcatctggta gcgcttgcga cacagcgccg ccacgttggt
   140281 gaaggccgtg gagatgcagg aggtggggtg gttcttgcgc ttctgcagct cttcatagcg
   140341 ctcctggatc ttggcggccg agtcgccgtg cagcatgatg gcggctccct ccgcgtcgtc
   140401 gtcctcctcg tgccctcctt ctgtttctcg gaaacgcgcg tcacgggcag gcccgtcgac
   140461 gtcgcttcag gcgtcccacc gcgtcgatgc tgacgtggtt tccctgatct cttcctcttc
   140521 tacgtccgac tcctctccgc ccccgtcgcc tcctccttct tcctctttcg tttctcccgt
   140581 cttctccccg gcctccgtgc cgtccccgtc acccgtccgc gtggcttcgc cgcggttgag
   140641 gaaggcgccc gcgtcactca gcggggtctc gacgtcactc tgtgccgtgg agcggatggt
   140701 ggagctctcc acccaggcgc cgcccgagga tttcgcggcc ggcgagacgc tccgcttcga
   140761 ggaggccgta aatatggcgc tcgtggcctg cgaagccgtg tctccctacg accgcttccg
   140821 actgatcgag acgcccagcg agaatttcct cctggtgacg aacgtcatcc cgcgcgagtc
   140881 ctcgtcggcg gtcgaggcgc ccgcctccgt gccgggcgat gacgacgaag aaggaggagg
   140941 gggggaggat aactcttctt cctcgcgctt ctcggccttc cgtcacgacg tgctggagcg
   141001 cttcgcggtc tcggccgagg cgccgccgcc cccctgcgtg cgggattacg ccctgcgcaa
   141061 cgccgatcgc gtcacctacg acggccagct gatctacggc agttacctgc tgtaccgcaa
   141121 gagccacgta gagctggccc tctccagcaa caaggcccag cacgtggagg ccgtactgcg
   141181 ccaggtgtac accccgggcc tgctcgacca ccacaacgtc tgcgacgtgg aggccctcct
   141241 gtggctgctc tactgcggcc cgcgcagctt ctgcgcccgc gacacctgtt tcggccgcga
   141301 gaagaacggc tgccccttcc ccgccctgct acccaagctc ttttacgagc ccgtgcggga
   141361 ctatatgacg tacatgaacc tggccgagct gtacgtcttc gtctggtatc gcggttacga
   141421 gttccccgcc tccgcgacag gtgcaggtgc gggcggcgcc ccggagccct cttctgcttc
   141481 gtcttcttct gcggttccca cgggtgcggc ggcggtcggt gacgcggtgc ccgatgacga
   141541 cagcaacgga ggggaactgc acctgccttt aaagcccgtc tcgctggacc gcctcagaga
   141601 ggtgctgcag gtggtgcgaa gccgcttctc cgggcgcgag gtgcccacct ggcccgcctc
   141661 gtcccggacc tgcctgctct gcgccctcta cagccagaac cgcctctgtc tggacctcgc
   141721 gcgcgacgac gcgcgcaccg tcagctacag ccctatcgtc atccaggact gcgccgcggc
   141781 cgtcaccgac gtgaccctca gccacatctt gcccggtcag agcaccgtct cgctcttccc
   141841 cgtttatcac gtcggtaagt tgctggacgc tatctccttg accgacgccg ggctcatcac
   141901 gctgaatcta tgacgtcggc caacaagcag ctcttaaaag aggtgatgcg cctggacctc
   141961 gagcggcaac agcaccagtt cctgcgacgc gcctacggct cccggcaccg cctcaccagc
   142021 caccaggccc tcagtgtgat gcgcacggcc gtgcgcgagc agacgcacta cagccgcctg
   142081 accgtgcagc gcgtgggcgc ccacctgctg ggcgacgagc gtcaggagct gcagcgggag
   142141 ctggcccgcg ccaagcagct gcaacgcctc gacgtggacg gcgcgctgga ctctttaacc
   142201 gagttgaaag acacggtgga cgacgtcaac tgcgccttcg tcgattcggt ttcgtcaacg
   142261 tgcgacctgg agctggaggc ggacgacgcg gaaaacgcca cctaaggtct ccgcgcaagc
   142321 tcgccgtcgt cgacgccgct accgccgccg ccgctctcgc cctcctcgcc atggcctcgt
   142381 cgctgcgctc gcgggcccgc tcctcctcgg ccgactcggg ctcgggctgg gacccgccgc
   142441 cgctgcagcg gcccagccgc gcgcgtcgtc gcaactgggt gcgcgaggcc gccgccacgg
   142501 ccgccgcggc cgccgccgcc tcctccaacg tagcccagga ggccgcggcc ctggccgccc
   142561 tggccaacgt caccaccagc gtcggcacca gcgtcttcag gcacgcgtcg tcttcgggtc
   142621 gaaaccgcgt cgtctctgcc agcgcaacca ccgtcgtggc cgccgccacc acttcctcct
   142681 cttccctgag gagtgacggc ttgtcgcccg ccaggctcgc cgtgcccgcc gtggccgccc
   142741 ccgcctcccc gcctcccacg ccgctgcccg ccgacagcaa caaggagaac cgcggcctca
   142801 gcggtcggcg cagcgccgtc agcagcgacg gcggcagcag ctaccacgga ctccgctgcc
   142861 gcgagtcctc ggacatgtgg tccttcgagt acgaaggcga cgacggggtg accagcgtcc
   142921 gcggcggcgt cgtcggtgcc accaacggcg gtggtggcaa cagcctgggc ttcggcatcg
   142981 gcaccaacac cagcgtcctc ggcagcgtcc tgctcagcag tcgcagcagc ggcgatccct
   143041 tggagagcgg cgccatcagc cggcgacgtc ggcgttgcag cagcggcggt cagggtcagc
   143101 gggggcccct ggtctccctg gcccgcaccc ctctctgtcg caccggcggt cgcgccgtcc
   143161 gcgtcaagaa tcacgtcgcg gctagcacct tccgcgacct ggatggtggt ggtggcgccg
   143221 gtggcgatac gtcggattcg cagccgccgc cggaggatga ggacgacgag tcggccacca
   143281 ccgacggcga gggagtgggc gtcctcgacg atcccgtggg ggtcggaccc ggcgccgccg
   143341 cgaacgtcga gcctgagcac gacgacgtgc actgcacctg ctccaacgag cacgtcatca
   143401 ccacctccat ccgcggcctg acctgcgacc cgcgcatgtt cgagcgcctc gaccaccccg
   143461 agctctgcga ggtctcgctc tcgtacctcc tggtctacgt gcccaaggac gaggacttct
   143521 gccagaaggt ttgctacgcc gtggacctga gcgacgagag ctttcgcctg ggccagggct
   143581 ccttcggcga ggtctggccg ctcgaccgcc agcgcgtgct caagatcgcg cgcaagcaca
   143641 gcgagacggt gctaaccgtc tggatgtcgg gcctgatccg cacgcgcgcc gccggcgacg
   143701 agcagcagcc gccatcgctg gcgggcacgg gcgtctaccg cggactgctg acggccaccg
   143761 gctgctgcct gctgcacaac gtcacggtgc accggcgctt ccacacggac ctcttccacc
   143821 acgaccactg gaagctggcg tgcgtcgaca gctaccgccg cgccttctgc acgctggccg
   143881 acgccatcaa gttcctcaac caccgatgcc gcgtctgcca cttcgacatc acgcccatga
   143941 acgtgctcat cgacgtgaac ccgcgcaacc ccagcgagat cgtgcgcgcc gccctctgcg
   144001 actacagcct cagcgagccc tacccggact gcaacgaccg ctgcgtggcc gtattccagg
   144061 agacgggcac ggcgcgccgc atccccaact gctcgcaccg gctgcgcgag tgctaccacc
   144121 cggccttccg ccccatgccg ctgcagaagc tggtggtgtg caacccacac gcgcgcttcc
   144181 ccgtctccgg tctgcggcgc ttctgcatgg ccgagctggc ggcgctgggc aacgtgctgg
   144241 gcttctgcct catgcggctg ctggaccgcc gcggcctgga cgaggtgcgc ctgggctccg
   144301 aggcgttgct cttcaagcac gccggcgccg cctgccgcgc gctggagaac ggcaagctgc
   144361 agcagtgcgc cgacgcctgc ctgctcatca tgggcgcgca gatcagctac cacgcctgtc
   144421 tgctgggcga gcacggcgac tcgctgctgc cgcacgcgct gcggttcgtg gacaacaagg
   144481 tctcgtcgtg ccgggtgcgc gcctttcgcc gcttctacac cgagtgttcg catgtcatgc
   144541 tgcacgaata cgtcaggaag aacctcgagc gcctgttggc caccgcggac ggtctgtatt
   144601 tatacaacgc gtttcggcgc gccaccacca taacctgcga ggaggacctg gacgccgact
   144661 gtcggcagat gtttcccgag tgagacggta cggagtttgg ggagaaggga cccagaggag
   144721 attcccgaaa aaaagtcact ggatttagcc ccgagtcgat aataaaagaa gagagaggac
   144781 gacgacacgg agtgagcgta tatgttgtat gtgtagtgct tgctgcgaga ggagagagag
   144841 cgggacgccg ccgccatcat gtggggcgtc tcgaacctca actacgacga tgacgaggag
   144901 ctgacccggc tgctggcggt ctgggacgac gagcccctca gcctcttcct catgaacact
   144961 ttcctcctgc accaggaggg ctttcgcaac ctgcccttca cggtcctgcg cctgtcgtac
   145021 gcctaccgca tcttcgccaa gatgctgcgg gcccacggca tgccggtggc cgaggagttc
   145081 atgtcgcgcg tcgccgcgct ggctcgcgac gaagggctgc gcgacatcct gagccagcgg
   145141 catgccaccg aggcctcgcg cgccgacatc gccgacgcgc tggatcgcgt ggccgagcgg
   145201 cacgatgacc gtctgggcgg ctcggacgac tacctgtggc tcagccgcct gctggacctg
   145261 gcgcctaact accggcaggt ggagctcttt cagctgctgg agaaggagtc gcgcggccag
   145321 tcgcgcaact ccgtctggca cctgctgcgc ctcgacacgg tctcggccac caagttctac
   145381 gaggccttcg tgagcggctg cctgcagggc gcctcctcgg cctcggcggc cagctcgcgc
   145441 gccggcgtct cgccgggcat ccagttcggc ctgaagcacg agggcctggt taagacgctg
   145501 gtcgagtgcc acgtgatgca cgggcgcgag ccggtgcgcg acggcctggg cctgctcatc
   145561 gaccccacct cgggcttgct gggcgcctcg gtggacctgt gcttcggcgt gctcaagcag
   145621 gggggcactc gcacgctgca ggtggagccc tgcgcgcgcg tctacgagat caagtgtcgc
   145681 tacaagtacc tgcgcaagaa ggaggacccc ttcgtgcaga acgtgctgcg gcggcacgac
   145741 gcggcggccg tggcctcgct gctgcagtcg cacccggtgc cgggcgtgga gttccgcgcc
   145801 gagcgcgagg tgccctcggc ccgcgagttc ctgctctcgc acgacgcgga gctcttcaag
   145861 gccacgctca agcgcgcgcg gccgctcaag gcgcccgagc ccctgcgcga ctacctgagc
   145921 gacctgctct acctcaacaa gacggagcgc tcggaggtga tcgtcttcga cgccaaacac
   145981 ctggacgacg gcactattaa cgcgtctctg ggcccggcgg cgggcggcgc cgacgacgag
   146041 gccgccggcg gcgggagcag cggcggttcg caaacggcct tcgaggacga gaacacgccc
   146101 gagctgctgg gccgcctcaa catctatgag ctggcgcgct tcccgctgcc ggcttttgtc
   146161 aatccgcgcc accagtacta ctttcagatg ctcattcagc agtacgtgct gagccaatac
   146221 tatataaaga agcattcgga cccggagcgg atcgatttcc gcgacctgcc caccgtctat
   146281 ctggtgtcgg ccattttccg cgagcgcgag gagagcgagg tgggccgcga gttgctggcc
   146341 ggcggacggc ccttcaactg cgaccacatc cccctgctca tcatcgtcac ccccgtggtc
   146401 tttgacccgc agttcacgcg acatgccgtc tctaccgttc tagatcgttg gagccgcgat
   146461 ctctcccgca agaccaacct gccgatatgg gtgccgaact ctgcaaacga gtatgttgtg
   146521 agttcggtgc cccgtccggc gaccccctga gagacgtcat gggccgccgc gtcaacctgc
   146581 gcggctacga taacatgccc cacacctcct cgtccgagtc ggacctcgag gaggacgacg
   146641 acgtcgatta tccctcggcc gacccgcaga aacggcggct ccacccgggt ccctccggcg
   146701 gcggcagcgt tctcagtcaa aaaaaaaagc acgcttctca gcagaacgtg tatgagcacc
   146761 cctatcacga gcccgtcgtc gtcttcaagg gccccggcca cgacgacggc gaggaggacg
   146821 gcaacgaagc cgaccgcagc tccctgagca cggtgcgctc gtccttccgt caggacaaca
   146881 agaagaaaaa gaagaccaag aaaaagaaaa ccacgtcgca gcaatcctcc atcatgcagg
   146941 agacggacga tgatccggac ctggacgacg agcgctccgc ctgtctgggg ggcgcctcgt
   147001 cctcgcctcc gcccctcccg cccagaggag gaagccagac gacggcgggc agcggtagtc
   147061 gccgcttgcc gcgaccagcc acgcccatgc cctcgaaaaa gatcaagagc cggtcgggta
   147121 gcgagagcac gacctcttcc agggtttcta tgtcttcttc ctgctattga cctcataaac
   147181 tgtcaggctt tcgctctgcg accccggggg agggagtcgc atcatcatct gaagggacag
   147241 ttaaaaactg acgtgactcg gctcccccgc ttttgtgtat ttttttgtaa accgttgagc
   147301 ttccaggtac taattttaca gatcttaata tatatcacac gcttttatga gaccagagat
   147361 tatgctgttt aataaaaaaa ctttgtacaa gccacacaca cacaactgtt ccactcgagt
   147421 ctttttttgt ttgtgtaggg aagaggaggg ggtggaatgg tgatacccac cacgacgcgc
   147481 taggcgccct cggactcttc gtcctcgtcc gattcgggca tggcggcctc gttgtgtttc
   147541 agggaggcga tctcctcctc ggacgtggtt ttcagagcct ggtacttgaa caggctgcgc
   147601 gcgcggaagt agcggatggc gcgacaggcc gtgaaggtgg cccagatgag gaacacggcc
   147661 ccgaagcacc agctgatgac tggcagatag ttatcaccta ccagctgctc gtatttgata
   147721 atggggtaga tgaggccgca gagtccgaag aaggtgccca ggtggtaccc gaactgcacc
   147781 ttcacgtact ggaagaacac cgactcgatc atcagaaagt acacgatcga gatgacggcg
   147841 tacaccacga acacggccag caccatgtga cccgtgcgca cgaagaagtt attgccgaag
   147901 ccgtagcaca ggcccatggc caccaccacg gtgttgaagc ccagcgccac ctgcaccagg
   147961 ttgacgatca tcgtgcggaa ctgcacggtg ccgtgcagcc gggggtgcag gcgcgagaag
   148021 tggaacagcg tgcgcttgta gctctggtag tgcgtcacca tgctgatgtt gaagacggtg
   148081 aggcagaaga agtgcaccac gctcatgaag gcgatcatgc tggggaggcg gaacgacatg
   148141 gtcagcgtca gcagctggaa cgtgtccatg cacaggataa agaggaaggc cgtcaggctg
   148201 tcgcccatgt acgagatgtc gcgcgtcgac tggttcagga ccgtgctctg gtcccggcgc
   148261 cacgctatct ttacccagca caccaggtag tacaccgtca ccgccaggaa caccagctgc
   148321 ataaaaaccg cgtagcacac cagctgcacc gagtccagaa acagcgtcgg cgtatggaga
   148381 tgcatgacgt tgaaggccga catgttgatc ttcttgaagt ccacgacgtg gtagtacacg
   148441 cacgggtagc ccaggtcggg aaagttgctc agcaccaggt gcacgctcac gttcacgaag
   148501 gtcagcacca tgaagacgat ggaggcaccc caggtgcgcg tgttgacgcg gtccacgtgc
   148561 gagggagcca tggtgcgggc ggccgcgccg gcggctccag gggtggccgg tgcgtgctga
   148621 tgacgaaaag cccgcgggtc gttaaatact actatggagg cccatgccgc ggctgcgcct
   148681 cctcccgcgc cttccccgag gacgcggttt gaacgcgtcg acgcgaccgg ccaaaagacc
   148741 gcgcggcgcc cgtcgggccc tcacagcgct cgtcgcgcgg ccgggcggcg aaaaacggcc
   148801 ccgagctcgg cggggatggc cgccaaccac tacacgctcg tcggggccag ctgccacctc
   148861 agctggtacg gcatcctcga ggcctccgtg cccatcgtgc agtgcctctt catggatctg
   148921 ggtgccctcg gcggtcgcgc cgaggagccg cggctgcgga cgttcatcgt gcgcggcgac
   148981 cgcctgccct cggccgaggt gcgtgccgtg caccgcgcca gctacgccag cctggcctcg
   149041 gccgtggccg acgccgagga gcgccgccgc ggcatcgagc accgcagcgc cgtgctggcg
   149101 cgtgtgctgc tggagggcag cgccatcatc cgcgtgctgg cgcgcacctt cacgcccgtc
   149161 cagatccaga ccgaccccag cggcgtggag attctcgagg ccgtgcccgc gctgggcttc
   149221 gacgcggccg cgctctcgca cgccctcagc ctctaccacg tcgccaagct ggtggtcatc
   149281 ggctcctacc cggagatcca cgacgccgtg gccacctcgt cgtccgtctc ggcgcgcgtc
   149341 gccaccggcg gccacgagga ctacgccacc caggcccaca agaagctgcg gcgcggctac
   149401 tacgcctacg acgtggccat gtcgttccgc gtcggcgccc acaagtacgt gctggagcgc
   149461 gacgacgcgg ccgccgtggt ctcacgcctc ttcgaggtgc gcgaggtctg cttcctgcgc
   149521 acctgtctgc gcctcgtcac ccccgtgggc ttcgtggccg tggccgtcac ggacgagcag
   149581 tgctgtctgc tgctcaagtc ggcctggacc cacctctacg acgcgctctt tcgcggcttc
   149641 gccggacaga cgccgctgcg cgactacctg ggacccgacc tcttcgagtc gggcggcgcg
   149701 cgctccttct tcttccccgg tttcccgccc gtgcccatct acgtggtcaa cgggctgcac
   149761 gccctcatgc gcgaaacggc gctggacgcc gccggcgagg tgctctcctg gtgcgggctg
   149821 cccgacatcg tgggccccgc cgggaagctg gaggtggagc cctgtgagct ctcgctcggc
   149881 gtgcccgacg acgagtggca ggtcttctgc ggcgagggcg gccgcgcggt acgcctcaac
   149941 gccacggcgt tccgcgaacg gccggccgtg accgacctgc tgcagctgca acagcagcat
   150001 cggcgttcgc cgcctcctcc cgcccacacc acttcttcct cttccatcgc ccgcgcccac
   150061 ccctcctccg acgaggacga taacgcgccc tcctcgtcgt ccccctcccc gtccccctcg
   150121 gccgtggtca gcagcagcac gggcggcgcg cacccgccgc acgacgacgc caccttcacc
   150181 gtgcacgtgc gcgacgccac gctgcaccgg gtggtcatcg tcgacctggt cgagtgcgtg
   150241 ctggccaagt gcatccgtgg acgcgacttc aacccctacg tgcgctacag taaccgactc
   150301 cacactcacg cggtttgcga aaggtttatt gaaaacttgc gctaccgctc ccggcgggcc
   150361 ttctggcagg tccacagcct gctgggctac atctccgagc acgtcacgtc ggcctgcacc
   150421 gcggccggcc tctcgtgggt gctgtcgcgg ggccatcgcg agttctacct ctacgacgga
   150481 cgctcgggac acggccccgt ctcggccgag gtctgcgtgc ggaccgtggt cgactgctac
   150541 tggcgaaagc ttttcggcgg cgacgagccc ggacccgtct gtcgcgtgca ggagagcgcg
   150601 cccggggtcc tcctggtctg gggcggcgag cgcctggtgg ggcccttcag cttttacggc
   150661 gccggcgggg ccctgctagg agcgggagcc gtggggtccg gcggtggtgg tgcgggtggt
   150721 ggcggcggcg gcggcgcggc tcctcctcct cactatcacg tccccgtggg ctgttgcggc
   150781 ggctgctgcg caggcggggg cgtgcgcgac gaaggcggct ctccggcggc ggcgccgctg
   150841 ctgctgggct gctgctgcgc cggcggcgac tggctctcgg ccgtgggcca cgtcctgggc
   150901 cggctgcccg gactgctccg cgagcgcgtc ggcgtcccgg agctggaggc cgtctaccgc
   150961 gagatcctct ttcgcttcgt agcccggcgc aacgacgtgg atttctggct gttgcagttc
   151021 cagccgggcg agaacgaggt gcggccgcac gccggcgtca tcgactgcgc gcccttccac
   151081 ggcgtgtggg ccgagcgcgg tcagatcatc gtgcagtcgc gcgacgcggc gctggcggcc
   151141 gacatcggct acggcgtcta cgtggagaaa gccttcgcta tgctcacggc ctgcatcgag
   151201 gtctgcgcgc aggacatact ctcgtcttcg gccgcgccgg ctgccgtcac cgcccccgtg
   151261 cccacgtctt ccacccgctc tcctctgctg tcctccgttc ttcctcctcc tgctgtcctc
   151321 tctccttcct ctgtgccgtc ctgctcctcg gccgcgacgg tcaccaccac ggtgaccgcg
   151381 gcgccttctt catcttcttc cgcggcctgg gacggcgacg acgaggagcg cgacgagtgg
   151441 gcccgcagcc tgggttccga cgcgcgcaag gcggccaggc gggtggcgtc cgagggcctg
   151501 cgcttctttc gcctcaacgc gtgacgacga caacaacgag cacacagcga cgctactacg
   151561 acgactaagc ccaagacgaa caacgtgcgc gtgcgtaccg tgcggcgaca ggtgacgata
   151621 gcgtgtcgac gtccatgcag aataaaattg cgtcaaagct cacagtgtgt gacgtggttt
   151681 ctgtgtgtgc tcttcctctt cttccctctg acgcgcgggc gtctcgtgtc accgcgtcag
   151741 cacgcccgat ggggaaatct tgggagggcc cggcaggttg gggaagttgg cgttgagcac
   151801 gtccagcagg gccaggccca cggcccagcc gtccagggtc ttgcggtccg tcagcttcag
   151861 gctgaagacg tggtcctcgt cctggcgggt gatgcgaaag aagaagcgcg tgacgatctc
   151921 caggcagctg tggcgcgcct gcaggtacag catgaaggtg gccggcacgt gttccaccac
   151981 gtccgcgtcc ttctcctcga agaacaggta cagggcgctg cagatcagtc gccgggcgct
   152041 gtgctgcagc agtttcccga agctgtcgcg cacgttcatc atccgcaggt acgagagcag
   152101 gtcgaacagg cactgacgcg acaggttgca gttctctacg cacgagagga tggtgcacag
   152161 cgagaagtgc atcaggttgt cgggcttcac caggccgcag cggtgcttca cccgcaggtc
   152221 cgtcagcttc agctgcgtga tggcgtcctc ggtctccagc agaaacacgg tggagtagcc
   152281 cacgaagctg gtcccgtgca gcagttcggc gcggtactcg ctcatgctca gcatcggcga
   152341 ctggaccgtc tgcacccaca gccggtcgtc cttcaccgtg aagtccatca cgcgcggcac
   152401 catgatcatc acgttgtgct tagtgaagtc cgtacggacc tccagcacgc cgcggatcat
   152461 cagggactcc atttcgaaat cgatcgactc gttcgggccc gcgccgacgc tgctctgggg
   152521 ccggccgggg cggcgcgccc tctactctag tcatctggcg gtgccgcgcc ttctcgcggt
   152581 tgcagatgag ctcgacgtac tgacgaaact tgctatcgtc ataggcggcg gccacgatct
   152641 ccccgaagga gaggtgcaga taggcctcgg ggatggggtc cagggcgctc agccccagca
   152701 cgctgctcag gtacggcagc gtcacgcgct ccaccgtgta gttggagtac acgatggcct
   152761 cctcggcgcc ctggttggtc accaggcggc gcaggcggaa cgtgcgaaag tactcgttct
   152821 cccacagctg cgtcagcagc cgctccagcg gctcggtgct cggcacgtac tgcgagaaga
   152881 agctgttggc caccagccgg ttgtcctcca cgggcagcgc gcggaacggc gtcgcctcct
   152941 gcgccttgcg caccgcctcg gtcaccggca ggtggtacag ctcggcgtcg cgcgccccca
   153001 gattcaccga gtcctcgcgc cgcgaggcgt agcgtgtcag caggtcgcgc agctcgtgca
   153061 cgcggtgctc ccaggtctgg ttcagcgtgc gcaagtcctg gatttcgtcc acctgcgcct
   153121 cgatctgctc ctccaggcac ttgatcacct gcttcttaaa cacgtcgcgg atgtcgcgct
   153181 cctggcccag gccgcccgag accgacgagg cggcccccag gcctcctccg ccgccggggc
   153241 ccgggccggg gcccaccacg ccgccgggcg cgcgcgacgg cagcaggcgg ctttggtcca
   153301 ccagcgaggg cgtcaggtcc tgcaggaacg actccacgct gtcctcgatg ccgatgcgcg
   153361 atttgctgtc cgacacgttc agcaggaact tcatgatgga cttcttggcg tcgctaccgc
   153421 ggtcgtgctt ctccatcatc tccaccatct tcttgcagtt cagctcgtgc cggctcatgg
   153481 tcacggcctt cacggggaac gtgttcagca gctggcagat cttctggtgc cggcacagcc
   153541 cgtcgtagcg caggatctcc tcgtgcaggt gcgccaccgg cgtggtcagc agcagccggt
   153601 cgcgctcgta ggccagcggc tcgcaggcca cgtacacgcg gatgcccttg ccgcgcagct
   153661 gcgcctccag gcgctcgctg cgcaccttct tgaacacgcg cacctcgggc ccgttggcca
   153721 cgcgcacggc gcacagccgc tccaccacct gcagcagcag cgccaggttg gcgctcagca
   153781 gctcctgcgc cagcgggtgc gtctcggtgg agcgctgcac ggccgcgcgc acgaactgcg
   153841 cccgctccaa cacctcgcgc tccttgggac gcgcgtccac cagcggcacg atgcccaccg
   153901 tggcccacca atccacgtac agcccgtact cgtcgttatc cgcgtactga tataagatct
   153961 cgcgcagcgt gcccagcacg cccgtttcca cgctctgacg gatggacgcg ctccagacca
   154021 gcaggtactg ctccagatcc tcgtcgtcca gcgcgcggta ggggaacagc gccgcgtgca
   154081 gcttccactc ctcggccacc cgccgcgccg tcatggtgtc gaacagcgtc ttgcacacgc
   154141 cgtagagcag ctgcttgcgc agcacgcacg ggtcgcgcag cacctggtgc atgctcttgc
   154201 cgcggcaggc gcccataaag ccgtgcagca gccgcagaaa gctcatcgtc tggcccgtgg
   154261 ggaagatgtc gatcaccgcc tcgtcgtcgc cgccgcggcc cgccagatac gacgacgcgc
   154321 tgatcctcaa cctgtcgtcg gccgccaaga tcgagcggat cgtcgacaag gtcaagtccc
   154381 tctcgcgcga gcgcttcgcc gccgaggact tctcgttcca gtggttccgc tccatcagtc
   154441 gcgtggagcg gggcggcacg gcgtccgggg ccgacgcggg aagagtaggc aagagcgaac
   154501 cctctacttc ttctgtccct cgcccgacct ctgtcgcgtc ctcggtcgcc gctgccgcca
   154561 atcaggaggc gggcacgcgc gtcccccgcg tcgaccgctg gcccttcttc cccttccgca
   154621 cgctgttggt caccggcacc gccggcgccg gcaagacctc cagcatccag gtgctggcgg
   154681 ccaacctcaa ctgcgtgatc accggcacca cggtgatcgc cgcgcagaac ctcagcgcga
   154741 ttctcaaccg cacgcgctcg gcgcaggtta agaccatcta ccgcgttttc ggcttcgtca
   154801 gcaagcacgt gccgctggcc gaggccggca gcgagacgct ggagcgctac cgcgtgtgcg
   154861 acgcgcgcga ggagaacacc atccagcggc tgcagatcaa cgatctgctg gcctactggc
   154921 cggtcatcgc cgacatcgtg gaaaaatact taaatatgtg ggagcgcaag gcctcgctgg
   154981 acgatgtctc cgagttgtgc gagagcaaca tcatcgtcat cgacgagtgc ggcctcatgc
   155041 tgcgctacat gctgcaggtg gtggtgttct tttactactt ttacaacgcc ctgtgcgaca
   155101 cgcgcctcta ccgcgagcgc ctggtgccct gcatcatctg cgtgggctcc ccgacgcaga
   155161 ccgaagccct ggagagccgt tacgaccact acacgcagaa caagagcgtg cgtaaaggca
   155221 tcgacgtgct ctcggccctc atccagaatg aggtgctcat gaactactgc gacgtggcct
   155281 ccaactggat catgttcatc aacaacaagc gctgcaccga cctcgacttc ggcgacctgc
   155341 tcaagtacat ggagttcggc atcccgctca aggacgagca cgtcgcctac gtggaccgct
   155401 tcgtgcggcc ccccagttcc atccgcaacc cctcgtacgc ctctgagatg acgcggctgt
   155461 tcctctcgca cgccgaggtg cagctctact tcaaacgtct gcacgaccag atccgcctca
   155521 gcgagaaaca ccgtctcttc gacctgcccg tctattgcgt ggtcaacgag cgcgcctacc
   155581 aggagctgtg cgagctggcc gacccgctgg gcgagtcgca gcagcccgtc gaggtctggt
   155641 tccgccagaa cctggcgcgg atcatcaact attcgcagtt cgtcgaccac aatctctcca
   155701 acgagattgt caaggagcgc ctgcgaccgg cgcaggaggt ggtgcagcag caacgagagc
   155761 agcagcagga ggtggcgacc gctgttctcg gcggcggtgg tagcagaagc gccgtgctgg
   155821 gtggcggcgg aggtctggac gatgtcatcg ccgccgaggg aggctacgtg ccgcccgccg
   155881 ctgccgccgc cgatggggga gtttcgccgt accgcgagac gctgctcacg ctgcgcatca
   155941 cctacatcaa gggcagctcg gtgggggtca actccaaggt gcgggcctgc gtcatcggtt
   156001 accagggcac ggtgtcgcgc ttcgtggaga tcctgcagaa ggacaccttc atcgagcgca
   156061 cgccctgcga gcaggccggc tacgcctact cgctggtctc gggtctgctc ttctcggcca
   156121 tgtacttttt ctacgtctcc ccctacacca ccgaggaggc gctgcgcgag ctggcccgta
   156181 tcgagctgcc cgacgtgccc tccctctgct tcggcggtgc caacaacgtc gccgccgccg
   156241 cgcccgagca agacgacgac ggcagtgccc gcgtctcctt ctcgcccgtc agaaaccccg
   156301 tcgtctcgga cgattccgac gacggtggcg aggcggagga gacccacgac atcccctgca
   156361 tggccgagga cgacctggcc gtcaccgacg ccgagctggt cgaccacacc gacctctacg
   156421 tcgacccctt cttccacaag tactccaagc cccccagcgt ctcgctgctc tctttcgagg
   156481 agacggtgca catctacacc accttccgtg acatctttct caagcgctac cgtctcctgc
   156541 agcgcctgac cgagggccgc ttcgccaccc tgccgctggt cacctacaac cgccgtaacg
   156601 tggtgctcaa gcccaactgt cagatcagct cgcagaccgg ctccttcgtg ggcatgctct
   156661 cgtacgtctc gcccgtgcag acctacacgc tcgaaggcta cacctgtgac aacgtgctca
   156721 gcctgcccag cgaccgccat cgcatccacc ccgaggtggt gcagcgcggc ctctcgcgcc
   156781 tggtgctgcg cgacgccctg ggcttcctct tcgtgctcga cgtcaacgtc tcgcgcttcg
   156841 tcgagtcggc tcagggcaag agcctgcacg tgtgcaccac tatcgactac ggcctgacct
   156901 cgcgcacggc catgaccatc gccaagagcc agggcctctc gctcgagaag gtggccgtgg
   156961 acttcgggga tcaccccaag agcctcaaga tgagccacat ctacgtggcc atgtcgcggg
   157021 tcaccgaccc cgagcacctc atgatgaacg tcaaccccct gcggctgccg tacgagaaga
   157081 acacggccat caccccgtac atttgtcgcg cgctcaagga caaacgcacc acgttgattt
   157141 tttgagaaag agatcgcgac ggtctcctcc gtactttatt gagcaggaaa aaaaaacacc
   157201 cccgttccct ccgcttacgg tgtgcttctt cgccagtcgt cttctcctgg tgaggtcgtc
   157261 ctccgtagac tgtgccgttc agtgggtccg cgtcgtcacc gtcactgtct ctttttccgt
   157321 ttcttcgtcc gtgtccgtgc cgcacctgca agagagaagc ccgggtggga gcgactccag
   157381 tcccgccgtc atacgccgcc gcgaggtccg accaagagca agagacccgt cgcctttccg
   157441 gggcaacggc ggccgcgtac ggggggaggc gggattggac gccgctccgt tcgatcgtca
   157501 ttctgctcca caaatttctg agtctgtttt tctttttgaa caatacgcac tggtaatatc
   157561 cgtgatcccg tgtggaagag agaggatata ataaatcgtg tgtatctcaa aaaatttatt
   157621 tgccaacagc tatgtatgta atttctctca tgtagcagaa tagagacctt ttcgtctatt
   157681 ttttcgtatt ttgtttccct aacttattag ttttgtaatc gggtttttgg aattcttttc
   157741 agaacatcct ccgcgcgagt gcgtgcggga ggccgtacgc tgctgtttcg acgttggtct
   157801 atagagtgta cgtgtgtatc ttctttgtga tttcgcatca tctgcatgcg cgcacgcgct
   157861 cgtcttcgag atcgagcaga aagtgatgtg gtggtacatg tatcaagatt tccttgacaa
   157921 aagaggtttt tatttttggt ttgttttata aaggtgagag gagaaaggta tgaggagatg
   157981 ttcgatgatc gttacagtta tgctgtaagg aagcttttat cgtgcgtcct gtgtatcacg
   158041 cattcgaaac ctatcgatag gcagatatta gctaattgga ctttgcccat attggttgtt
   158101 gtcattcgtg gcctgaggct gggcgacgac ggcgctggta gcgacgccgc cgcccgcggc
   158161 gatttgtgta tatagcgtgc ggtgtgataa tcgtgtcgag cgaaaacatc atcgacgtct
   158221 tttttttggt ttcactatct tatcaagcga tggaactttc ttcggtacgg gttcttgtta
   158281 tggaagcttg tgttttcgaa cattatgatt ctttttttag gtaggcgaag aagggcctat
   158341 cgtctttttt tttcctacaa aggacagata tcaatcttct aaaaagaaac ttatcatggt
   158401 aaattcagaa tcctatggtg tcttattgtt ttatctctac aaaaaaaatc gtcaacatta
   158461 tggtctaaca aaaaaaatca tacgacttat cattaggttt cctgacgata tatatgatcc
   158521 ttataacctg gctactatct cgacaaaata taccatcaaa aacaatgatt acatgggtgt
   158581 tggataaaaa aacaacaata tccttactta cagtcatctt cttcatgagt ttaatgaagt
   158641 ataatatcgg tcatctatca atttatctgc tatgttttct taccctttag gaattatcta
   158701 tcggatctat gacgattaac gtacccgcct gcgaggcgaa actctgagaa gtctaccgag
   158761 tcgagttaca agtcactaaa aataaactac tcattcttca tcattttaca cgagctacgc
   158821 gtctactcac taaggcttac ctaatcgtta gtcttatcgt cgtgttagta tgctaatatt
   158881 cctattcagc ttcaattttt cttaagcaaa acacataaaa agagactacg tacaggggat
   158941 tatatctatt cttctaagct atatatatac acaaaaatgt ttcttaacca aaagctacac
   159001 ctcccgacgc agggtatcgt ctctagcgga gggggagagg agacagaaca aaaaaagtaa
   159061 ccctaagatt actctaacta ataataaaca gaacttaccc actaaggact taccgagact
   159121 atattcacca aaatcaacgt aataaaagtg tttataaaaa ttatccagaa cctacttact
   159181 tcttaatgtt tctaactttt ggggtggaaa aaacccaact atcatacttt tgttttcgtt
   159241 ttctgacaca aagtttttat cagcttacag agaaaaaaat aaaaagcgag acttaaaaac
   159301 atgatttttc gatgatattc ggtagttacg atccaaagat tcaaatataa acttcttatt
   159361 gactaaggat ggttgttatc gttgaaccat tcgtattatt catggttgcg gtgactaatt
   159421 atggagaaaa atgtgattgt tagctaggtg agacttacag ctatccatcc gtttctagtt
   159481 tttgcttcgt gattacggta tggtggtgat cgattctggt caacaacttt tgatgttgtc
   159541 gtttcaaggc ttaacaatgt ccttaacgct acatgatgta ttattcttat catcatcgtt
   159601 cctcctagaa ggggggtggt gtatgtatgt actaaggtga tagtagttca tcgtaattac
   159661 agtagtagta ggagtaatgg tagtagtata gtagtattcc taacatcatg actattcaga
   159721 ctatggcttc atctatcttc atctaagatc tctataacgg ttcctaacga gaggagatat
   159781 ggaaaaactt atcatcagca taacaaaaaa aagctatcat cattatcggt actatctata
   159841 atctctatat catattgtgt tgctatccta aagaagtgaa tcagggtcta taaaaagaag
   159901 gtgtgtacac gttgtcttgt ctaaacgctt aacggttact ggggggttgg acggagtcgc
   159961 gaacgactcc cgagttcgtc acggaccggc cgtgaggcgc tgcgcggagg cgcgagcgta
   160021 acggttgctt ctcctcatcg tcgtcatcgg cctcctccgt tcgtcttctt cggcgaacga
   160081 ggaagaggag gcgccgccgc gatgagcgtt ctcttgttct cttttcgtct ttgtactttc
   160141 tatcttatca aggtggtggt gttgtttgtt ggtggtgatt gctttggatg atttctcgtg
   160201 ccgtggcgtg agatcatcct cggaatgagg agataaggga aggaggagga gtccaaggag
   160261 atccccgctc ccctccatgc tgttgttctt ttacttttta tcatcatcat gttgtttgtg
   160321 gttggttttt cttcattctt ttgtttccat tctttgatat actatgattt caacttgaaa
   160381 aagaaaaatg tccgtctcca cctctcgtga aaggcgcgcg cgcttctccc gggttgcctg
   160441 gtggtagccg tcgtcgtcgt actcgtcgtc gctgccgcct ccccggggtc atcgttgtgg
   160501 ttgtcgtcgt tatcgtcgtc gtcctcctct tcctcgtcgt cgtggctctc tgcggctcgc
   160561 gttcgcgttc cccggtgacg aaacccgcgc acaccgcaga acgccgaagg cgcgacggca
   160621 cggcagagga tgatgtggga ggagaggcga ggagacggac acagcagacc gcggcgggag
   160681 gagggggcgg cagcctcctc gtacgcggag acagagacgc ggcgcgatac tagtggtggt
   160741 cgtggtttct tttttgggtt gtttggatgc tcgattatat cctgtttatg gggttcttat
   160801 catcatctac tcggtcgtag aaggacctac tacgacccta tagctatcta tactatatac
   160861 atcttatcat ctaggctcgg ttttcaaggt cagcctgtgt atattttcgt tcttattatt
   160921 ctggttttcc tttcgcgcgt gccgccggcg gcacgcgggc gcgggtcttc gtctacttct
   160981 cgtcgttatt gctttgaaga attgctaggc gttcgatgat cgttgttaac aagtctggct
   161041 tgattttttc gtcgggggtt gcatcttccg tgaaagtaaa gtgacactac tatggaaaga
   161101 agtggtaacc atattatctg ttggtttagg agaaaaaaat cttcttcgaa cgagaatcat
   161161 catcccgact gacagatcta aaacaacgta cgggtcttgt ggttttcgta catttgttct
   161221 tcttttgctg ctaaagtact gaattaacag aattgcttct ccgtaactat attcgtagta
   161281 tgattttcgc agattcagaa aaattcaaac acagttctca caacacacac aacgacagat
   161341 caaaaccatc cgtgatggcg tcgaaactaa aaagaaggaa gacagacgga cacgcggtat
   161401 gtagtatgat gggtcctgac gacagaaata gtgggtctgt ggcttttgat tcgtgtacat
   161461 tcgtgtacga ctcattcgtt tcgtgcgtgt cgagattcat cttcctgcga tgatgtaggg
   161521 tcctgggtgt aaagtaggat ttcgagtatc tcttttagca aaatcgaggg ttgttgtcat
   161581 gacgatctct atgattttac aataaacaag tgtgtgtctc tataaagtga agaatgttac
   161641 gtggttagag atgatcggcg atcgtcgcgc tgcttgctgc tcttcctggg aaagagaaga
   161701 agaaccgaga gaaaagccgg ggcagctcgg acctttagga ctgttcttct tgcttttatt
   161761 tctcatctaa gagcttcgtt tagtgcaact ttaaattatc atcatcatta tatcatatca
   161821 tcattacaag gagtagaaag ctgaaatgaa tctatgaagg tgctattctt ctcttatttt
   161881 tttcagtcta tagaaaaatt gttgttctct aggagtgtta ttttcattat tcttgttttg
   161941 ttgaaacaat acatggacga aaaaaaaaga ttcttcctta aggcagtaga taccagattc
   162001 tccgacgtta ccgtcgtcat cgtccgcaca gacggttcat tttctttcga gagagtatct
   162061 gctgagattg tccgtggtgt atctaagtcg ctattcttgt tgttagtagt tttgcacaca
   162121 gtttattcag tatattttct tcttgccatg atttcgtcca cccttttttc gacgattact
   162181 acaaaaatct ctgaagaaga gagaggatag atcgcggcgg gggagaagac ctcaaggcaa
   162241 aggaaagcaa tttttgtttt gccatcaagt ggtgacgata acccgtcaga ttgataattg
   162301 gttcctacag aaactatcta accgcagaag aaaaaactac agaagaaaaa aaataaagga
   162361 ccacctacct ggggcgagcc gcgcagtcgg tgcctctccg cttcccgcga cgctcaccgc
   162421 tctctctctc tctgttctct ccccagcctc tgcaccgtca cgccgggagt ccgcggaatc
   162481 cgcgtcgcgt gtccggtcgg cccgtccgag gtaagtcacg tcgcgcgccg ggccgcgttc
   162541 ccagccgcgc cgaagaggat gtcccgaaaa ccccgtcgtt tccttggctc ccacgcgctt
   162601 tcggtttcca gtccgcctcg gcggtgttcc tcctccggct ttaataaaac gtactgttta
   162661 accacgttgc gtcgtgacgt tgtttgtggg tgttgctagg cgggtagaaa agatgatgta
   162721 taaatagagt ctgcgacggg cttcagcgct ctgccggctg cggtggcact cgctcgacag
   162781 cctccgacga gcgccgcgcc cgctccgcac gccgtttcgc catggatccg cagactaccg
   162841 tcgtgcgaaa gtattggaac ttcacgaatc ctaaccgcat cctgcaccag agcgtcaacc
   162901 actcgttcga cgtgcgccag ttcatcttcg acaccgcacg cgtggtggac tgcgtggacg
   162961 gcgaaggcaa ggtcatgcat ctcaccaagg gctggctctg cgcgaccatc gtgcagaacg
   163021 gcgagcccgc ggccggctcc aagacccagc agggcttcat gtccatcgat atcacgggtg
   163081 acggggacct caaggagaac ctgttcgtgc gcgggggcat cgtctccaac aagtccgtct
   163141 cctcagtggt gggcacgggt ggccccaacg agagcgcgct gctcaccatg atctgcgaga
   163201 acggcagtct gcaggtcacc tacgtgcggc actacgtgaa gagccacgcc gaggccggcc
   163261 cgtcctcggg cgccagcgcc acgaccaccg ccgcctcctc gggcatctgt ctgccctcgt
   163321 ccctgagcgg tggtggcagc aataacagcg gcagcggaca cggtggtggc ggcggcagcg
   163381 gcagtagctc cggcggcctg ggactcgcgg acgaacatca gcgtcgggct cggcaagaac
   163441 agcgtcacga ggaacgtcgc aaaaagtcgt cgtctagcgg cggcaatccg gatcccgcta
   163501 acggtatgct gcgggatccc cgcctcatga accgccagaa ggagcgccgg cccgaaaacg
   163561 acggtgagtc cctggcctcg cgacacggtg tttggagatg atgaggatga tgagacgtgg
   163621 atgatgagcg catgactgag gatgatgaga ccgggggcga aagcgaatgt ggtgaaagga
   163681 ggagaagaga gacgaacgaa agccgccctc ttctacctcc gtctgatgcg ctgtgtgtcc
   163741 cccttccccc cgtgtgtgcc ctgtcgtccc ccgtaggctg ctctccgctc agggacgcta
   163801 agagacaaaa gatgatggcc acgcagcctt ctcagcatca ccaccaccac gaatccaaga
   163861 gcggcgccaa cggcggccac gaggccgaat cctgcgtcgg gatgagcggc gccggcggca
   163921 acagcggcgc tcacggcggc ggcaacaacg gtagcggcgc caccaccgcc ggcctcaacc
   163981 gcatgctgcc cctggacggc ggcgtcacgt ccgaagccgt ggctttcctc aactactccg
   164041 ccaacaacgc gacggaggca ggtgccgacg gtgcgttact cgggtgcggc ggcagcggca
   164101 acgaaagagg cgaggaggag tctcggccgc ggacgccgaa gatggcggtc gccgggcctt
   164161 ctcctcgtcc tcttcgggcc gagccggtcc ctggaggagg agctggggaa ttggtggtgg
   164221 cctcggccac ggcgacggtc gcctcggagg tcgtcgtcat gcctgcttct tctaactgcc
   164281 gtgtccctcc tccgaattcg caggaatccg ctgtccccca gcgtcctcgc agtccgcgtt
   164341 ttgatgacat tatacaatca ttgaccaaaa tgctcaatga ttgtaaggag aaaagattgt
   164401 gcgatctccc cctggtttcc agaatcgtgc cggaggcgcg gaccgccgct cctggacagc
   164461 caccgcagca gcagccacaa caacagcagc agcagtcaca gccgccacgc gtcccggcga
   164521 cagctcctac cgccacagcg acctccagcg acggtaaccc caacgacaac ggtcgccagc
   164581 accaccacac cgccgctggt gctagcagcg ccaccgcggc cgcggccgtc acggtcgccg
   164641 ctgccgccgc cgcagccgtc accgtcgcct ccgcagctgt cgccgccacc tccgctgccg
   164701 gacccggact cgcagcagcg gcagcgactc ttcctctcgc caccggtgct ggcgagacag
   164761 taaccgccac gccaccggcc gccgccactc ataccaccac cgcgaccgcc tcccgacccg
   164821 tgtgtcaaat caaaccctac gtggtgaacc ccgtgacgac gaggccggcg gctgacgaag
   164881 aagacgacgc ggtgcggcct accaccagcg cgggaggggg gcatcgcggt cgccgggcga
   164941 accatagtga cgcggcgggc acgggtcgtc ggggacgatc ccggagcgcc cgcgggggag
   165001 gaggaaccgg cggccggcgc cagacttctt cctcctcgac gagaaggtcg cggaggagaa
   165061 acgcgcgccg tgatgacgac gacgatgagg atgaccaacc gggcccctcc tccggcggct
   165121 cgcgtcgccg gagagggccc tctttcatgg aggacggact ggagatcatc gatcccagcg
   165181 aggaggccgc gatcgccgcg gcttccatcg cggccttctt tgatgactga actcgggccc
   165241 gtatcccgcc cctccccagg agagagaaaa gagacaaaaa acaggacgct ggttttgggc
   165301 tttttttgag agactctctc ggcactacct cgccaccacc gtggaaaaag aggaggtgct
   165361 tgtatatata ttgtggtcgc ggtcactggt ttgtatataa aataaaaaga gatgacgcta
   165421 gtcgcctcag aacacgcaca ccacggtctc gctctcgtct ctctggctgt tcttcctctt
   165481 ctcctgtctc cgtcttccgt tccgctcagg agtccaggcg ccagtcgatg gtctcctggt
   165541 agtgcgtgtc caggtacgcg ttggccagca cgaagtggtc gttgcccacg aacgacttgc
   165601 tggtgttctt gggcgagggg tggcaggcct tgagcaccag gtggcgtcga cggtcaatca
   165661 ggtactcgca gctctgcgcc tcggcgcccc acagcatgaa caccagatgc tctcggagct
   165721 ctgacagcct acggatcaca cggccactca gcgtctgcca gcctaagtga cggtgagatc
   165781 caggctgtcc gtgcaccacg gtgaacacgg tgttgagcag cagcacgccg cgctggcacc
   165841 atgcgtccag gcatccccag gtcggccgcc gaaagccgtc caccgtgcgg gccacctcgc
   165901 ggaacacgtt gttgagggag ggcggcggcg gcttgcccat catcgtgccg aaggccagcc
   165961 cgctggcgct gccgtcgcag taggggtcct ggcccacgat cactacgcgc acccgctcgg
   166021 gcgagcacag gaagctccag cggtgcacgt gctcgggcgg cgggtacacc accccgcgct
   166081 gccgggccga ctccaccgcc gccaccgtct cgcgcagcag cgccgtgtcg tgctcgggca
   166141 ggctgaggaa gcgcacccag tcggcgctca gacaaaacac gcgagcctgc tcgtcggggt
   166201 tcagcatgca gcctttatta tcagcaatgt tagccagcat ccactcccgc agggccatag
   166261 cgggagcggg ccggcaggtt cacgcgggcc tgcttcaggg cggccggcag gtcggcgtag
   166321 tatttatcca ggcgctgcag cagagggggg ttcagcccgt gacgcaggca gaactccttc
   166381 accaggttgt acagctggta gaagagcgtg atgccgcccg gcgagcgggc cgtgctcacg
   166441 ggcacgcgca cggcgcggct ggtccgcgtg gcctcgttgc gtacggccag cagggcgttg
   166501 aagtagaagg gcggcaccag ctcgaagccc aggacgtgct cgctgaacac ggtgcgcacg
   166561 tacttgagct gcgtcaagtc gtagccgcgg cacaggtcgt ccacgcacgt gtagatcgag
   166621 ggcgagccgt cgccgcactg gccgtagccg cgcagcagcg ccatccagcg gggcgccgcg
   166681 tccgagttga tgagcgtcag tagggcccgc agctgcgacg gattgttgta cagcatgagc
   166741 agcgactcca ggaacccgtc gtccaccgtc acggcgccga cggcctgctg ctgctgtccc
   166801 tgtagcagct gttgctggtg ccgtagcgac gggtagcgga tgagctgcga cagcatcccg
   166861 tctcggtgcg tagcgttgac cagcggccac agccagctat catccttggc ggggaagacc
   166921 tcgcccgcca gacagcggcg cgtgagctcg ggacaggcgg ggtcggacga tgccgccgcc
   166981 gctgctgctg cgacgatcca ggcgacgacg gtgaggatac gcaggcggtg gcgcggcggg
   167041 cgcaggtcgt acatcaagtc cgcgggcgcg cggggtaggt gaactgccgc aggtggagca
   167101 gaaagctgga ggttaggtcc ccgagtccca aaacgttata tattccagcc accaggttcg
   167161 cggtcagggc ggagttggcg tagaaggtcc ggttgccggc gacgatgacg gccagtccgt
   167221 ggtcacactt ggtcaggttg cggggcacga agtcgactcg atcgatatcg ggccagccgg
   167281 ggactgagga gcctccctgg ggacttcgct tagagtactc gcaggtgctg atgttgatgg
   167341 cgtcactgcg gttacactga gcctgcagat agaaagggaa caagagagac tcctttcctt
   167401 ctttctgcgt ctccttgtcg tcgtcatcct cttcgtcgtc ttcgtcctcg aacaccacct
   167461 ccgtctgcga cggatcctcg tcgcccacca catcctccgg gtcgaggagg agctcggcct
   167521 cgtagaagac gatcgacagc tgctgggtac agatatcgag cgacgcgggc acgctagtgg
   167581 gggcgcttcg gctgctgtcc tccccatcct ccgtggacca ccaccccgtg gtcagatccg
   167641 agagggaagg cctgacggtc gtcgggccgg atagagaaga gttctcaaag tcggcggtgg
   167701 tgacgacaga cggcgataga gcggacgtgt cggtaatgac ggcgctcgtc gtcacgccgc
   167761 tgctgttgcc gctcgtggtg gcgttggtcg tcgtcgtccc attcgcgggg gtcttctggg
   167821 aaacagtgga cgaggagagg agtgacgtgc tcgcggttgc ggtgacgacg ctcgtggagg
   167881 aggcggcggt agcagcggta gtggtagacc gggtcgtacc ggtcgtgaca atcgtcgtgg
   167941 cgctggtgtt ggaaccggtg ctattttctc cgtcagccag caccaccgcg catgtcagcc
   168001 agagcaggag cggccaggcc ccccgcggcc gcttcttcat gaggtcggca gacgaaagcc
   168061 ggtgaattcg ttgtagagcg gcaggtgggg cgccgcgatc gaggggtacg tcaggaggct
   168121 gacgttgata ttaaatacgt ctggctgctt ttcgaccacc gaggcgcaca gggtgacggc
   168181 gtcgaacagg tctttcttgg tggcgcccga gacccacatc tggtagacgc ccgtctcgtg
   168241 gtaggaggta gagcgcggca ccaccggtcg gatgccctcc aacacgcgcc cggggtcctg
   168301 gtggaagaac ttgaaggtgg ccacggcctg cggcgtatgc ggcatagtct gcgtgatgag
   168361 ctgctggccc gccagcacgg tgatgttgtg cagcttgagc agcgcgctct tgagcgcctg
   168421 gaacgcgttg ccgcacgagg cgctgatctg gatctgcacg gccgtagagt cgtgcacacg
   168481 catgaggcgc gccacctcct cgaagatgtg cttgtacttg ctggcgaaga gcggcgcgta
   168541 gcggcagtcg gcgggcagga tgtaggtggc gttgccgccg ttggtggcta gggcgggcgg
   168601 cagggccgcg gcggcgggcg tgaagagcgt gatggggcgc tggtggctgg tcaggtcgat
   168661 catgggcggc gagacggagg cggaggacgg cgacgccagc aggctggcgg ccagcgcggc
   168721 ggcggcgctg gcgggctgcg ggtaaggtgg cggctgaccc agcggcggca tggacatggg
   168781 ctgctgggcg tgcgccatct gctgttgctg ctgcgccacg gtcatcgagg gcatgccgac
   168841 ggcgccggag gtccctggtg gcaggccgtc ctcggtcagg tgaatctcca ccgccgccgg
   168901 tatgttatcg gcggtcagca cggcctggtg gtccgcctcc tgtcggaagc cggagaggaa
   168961 ctcggcgtga tccatggtca gagtgtggta gtaaccgagc gcgggctgag ttatattgaa
   169021 gacggtcagc ttagagcgca gtttcacgtc cctggcggac ttgcgaatga gcgacgtccc
   169081 gtaggggtag acgtgatgcg aggagggcgc aggcagggcc gccgctgtcg ccgtcgctcc
   169141 cgctgctgtc gccgacgcgc gtcggtcgcg ggaggcgggc gacggggccg gcacgatctt
   169201 gacgtgcgtg acgtcctggt cgtccggggg gatgcgcaag agacccttct gcggcacgac
   169261 cacgatggtg cggtgcgtct ttctcttgtt agcgggggcc agcgacttgg agatgcgggg
   169321 ggaaccgtag acgatcttga tgttggagta catgacatga cccgggaggt ggacgggcgg
   169381 ggacggagga gacaacaatc ccagaaagag gaccgagtgg gtaggggacg atttctgagt
   169441 gcctctctgg tgctcaccac tgcttgaagt aaggcaccgg gtacttcttc tcttcgacct
   169501 cttccagttt tttataggac cagtcgcgtc ggcgcgccag catgtaagtc acgtagatga
   169561 ggacgaccac catgaagacc aggaacgcca gcacgccgta ggccagcagg cggtcctcga
   169621 acagcgggtc gccgtggacg aacaggtagg tggtggtgaa gttcttgttg gagatgtgta
   169681 cgctcagccg cacggaggag tgcgagccgt tgagatggaa gagaaactgc cgcagcagct
   169741 ccccgttctc cgtcacgttg ctaatactgc acgggagaat ggtcttcccg ccgtggtgga
   169801 ggtgtacggt gctgttgtgg tcgtagaggc tgccgttcaa cagacagtgc gtgtgattct
   169861 tcagcagcac gcggatctgc atagtcgtgg cgttcaggtg cgtcccgtag acggcgtaga
   169921 tggggtaagt gaagaaattc cacgaggtgt gcacggtacg ccagaggctg atgaagctgc
   169981 agttgtattc tacggtagtt cgaggtacgg gtcccaccac ggacagggcc tggccggtgt
   170041 tattgaagtc catctgatat ccacctgtga aaagacacat aaattgttga gttatcgggg
   170101 ccgacgggtt tacctgacgt ggttgggtag gtactcacct gaggtcttga cttccttggc
   170161 gttgagggaa ccgaattcgg taaagttacc ctggcagttg ggtcgctggt aacaggtgat
   170221 cgccatgagg ttggcgttcc cggtcgcgtt ctccagtttg atcttacagg tggtgttgaa
   170281 caacttgtag tcgtagctgt acgcggactc gcaggacacg gagtacttgt cgaagatata
   170341 ctcggtggtc gacttcggag cggtggtgcc ggtggaggta gtggcacgag gggtcgtcga
   170401 cttagcggtg gtgatgacag tcgtcgcctt ggaggtactg atggcagcag tcgtcgcctc
   170461 cgaggtaggc ttaccggtgg gagtcgaggt agcgtttacc gaaccgttgt tggaagacgt
   170521 ggcggcagcg gtggtactcg ggatcacgct cgttgtaacg gtactgttag tggttaccga
   170581 cgtggtgacg ggcacgctag ttgagctcgc ggtagtgttc ttgtcccctc gcgccccagt
   170641 catgtcgccg actagcgcgg cgatcgcgaa gatcgtcacg aggggagaca tgacggcgtg
   170701 tgacggggac ggggggcagg agggtttatg tacacagcgc gtcacctatg acgcctaaat
   170761 ttccagctcc agacgaaaga ggcgttaata ataagcatca cgaatactag ctgcgacacg
   170821 atgacgatca tgactagttt tttgttagac cttctaaagt actcgggatt gtctatgagt
   170881 tcctgttccg tgaccctatg gaaggagatt tcggtggcat tatcggtctg gttggccatg
   170941 gaatgcacct cgaacgtctt ggcgccccac gtcccgttgg atccccaaca agtgacgccg
   171001 gcattgaggt aggttccgta ctcagccctc agagtcacgt ttagatagtg gtggtagtct
   171061 ttcttctcat tatcagcagt atagttaacc ttgccagcta cgatcgtggt gttgcgtttg
   171121 gtgctgacca tgatccccga agccaaaaaa ggtgattgaa gggctgtagt gttacacaga
   171181 atagtcaggt tagtatcatt cttatacagg taagagatgt tcacccccgg ctcgcccgtc
   171241 cgatcatgca cttgtgccac cgccgcctcc ccgcccgccg ttaccgcgta cctcagggcc
   171301 gccgccaccg acaccaggac caccgtcacc cgaacacgct gcatagttac ccgtccgtcg
   171361 ctgccgggaa caaatgacgt gcgccgctga cgggctatga tttatagccc cgggcgcgtc
   171421 tgtcgcaatc cagtttccac agagctgcgg tcacgatgct cagcgagagg atcaggcaca
   171481 tggcgtacag caaacctaag tccgggtcga tgcggcacgt gcggataccc tctagggtgg
   171541 tcagccgggt gaaacacagg agtttctcct cgttctgctc ccggtccacc agcaggaggc
   171601 tcacggtgcg attgaggagc aggggggtga ctagggaaac cacgtgcggg cgcacgcagg
   171661 acttgcagtg acggacgctg acactgtgga gacccctctc ttcgtgacca ctcttctgtt
   171721 cccctccttc ctcctcatcc tcaggggaga aaacgggcac cctggtctcc ccgtctctca
   171781 gagaccacca cagcctgcgg tccaacttgg gaaggtagca cgagatcttc accatacccg
   171841 tgttggggga gcagatgtac accgccccgc tgccacccac cgtcatccac aataacaccg
   171901 tgcacaccaa gtaccaccac gccaccatca tgacacgggt cactctcggt ttacaaaagt
   171961 aaaacactct gtgacgcttt tatttaatag cgttctctat cacacatgat gatacacact
   172021 cggggacaag gagggggagt acagatcatg agtagataca gagaataata atacagtgca
   172081 cagtgccaaa accagtgttg tcattgtcta tgtacaagag tccggccacc actagaggag
   172141 ggaacgtgct ccatccctta ctgagacttg ttcctcaggt cctcgatggc cgcctcgatg
   172201 gccatgctca gggtgtctaa gtcctcggtg gtctcggcgg gctcctcgaa ctgccccacg
   172261 gcgtaagcct tggcggccga ctcgtaaatg ggcagcatga aactgctctg gttggtggag
   172321 aaaatgcgca gcatcacctg ctttgggaac ttctgcatca ggggcaggca catgttcagg
   172381 gcgcccagga agtccacggg ggtggcaccg tgtatgatca tattgcggta gtccgaggag
   172441 cgggggcaca gctggtgggt gtgggtctcc ttcatgtccc acacagcctt gacgccgctg
   172501 gcgcaggcct cggccgtcct gtggcacacg tcgggcgggt gggtcacggg caccgtgtgt
   172561 tccatcagga agggcgtgga cagggacagg ttgtacatgc tgcccagccg gcatctcacg
   172621 gcgtccacct cgctcttcac ctcgtggttg cgagtgtaga tgagctggat gcccttattg
   172681 ttcacctgca tggagttgca cgacttgatg gcctcctcca gcacctggtg gatgctgggg
   172741 atgttgaagg gcaggttctt gtactccagc gagcgagtgg tgttacggaa catgcggtcc
   172801 acgtcctcgg tcctcacgcg cccccgcttg gtctgcgcgc tgggggtgga gaacggggtg
   172861 ttgcggtcct tcatgatgtt cctcacccgt tcgttgtcca gctcggagat gcgcttgctc
   172921 ttcttcttgc ggggcccggc attctggctg ccaccggggg cgccgcggac cacgccgccc
   172981 gtggcggtga ggctcacgca gctgggggcc gacttggtct cctcggactc gctctcggag
   173041 tctgaggccg agctgcagga ggaggaagac gaggaagagc tgtcctcgtc cttctgggag
   173101 gaggagggag ggtgcacctc catctgcacc tgctgacggt gtaggagggg gttcatccgg
   173161 gccgccttct gggtcgcggg gctcacttga ggggagcagc cgcgagagga ggaggaagaa
   173221 gagcccgaag aagaggaaga ggaggaagca gcagaagact ggacctgccg cggttgtgac
   173281 tcagactgct tctgaggcac ttcctcaccc tcttcctcct cgctatcgga gatcacgata
   173341 caagaggtgg gctcgatagt cgtgtctcgg tattggatgg tgaagtcggg gtcgggcttg
   173401 atctcccgct tgatcatggg catcatgatg ggcgtgggag gcacgggcgg tttaataata
   173461 accttgaagg gccgctgggt cttacggggt ttcttacgag gactgacgag gtcgggagtg
   173521 acggacctct cgggaaggag gacgggagga gatggagtgc tgggaggagc ggctccgcaa
   173581 acaccacccg tggagggggc gctgctggtg gtgcaagtat tggtggtggg ggtgacaccg
   173641 gcggtagtgg cgtcgatacc ggcctgattg acagcctggg cgaggatgtc aatacctgag
   173701 gggaccaaga agacacggga gacttagtag agttaacaag agtgtgacaa cgtttattga
   173761 acaggtgacg tggtgttaca gagtataaca tagagtatat atcaatatct gtagtgacat
   173821 aggatccctc ctgactatga ctaactagca gctaactaga cagagtgaca gctcactgat
   173881 cggccttgct acgggtcacc atggggtggg tgcgcttgcc agaggcaggc tgctgctcct
   173941 cctctacctc ctcgcccgag tcagtgtcct cgtccttgac ctccaccagc tcggcgtggt
   174001 gcacctcccc ctcagactct ggctcagact tgacagaaac agagtcatca gcctccccct
   174061 cttcttcctg agtctcctcc tcaacctctg cttggctttc ctccccctca tctgcctcct
   174121 cgtcactggt ctcggccaca gtcaccgtgc ccagagggat gtcactctcg gagggaacgg
   174181 gagagtcggg gggagagatg ggagaggaga cggcggtggc ccgcacgtgg gctgcgatcg
   174241 cctcgtcctc atctgactcc tcagcaatgg cccggaggtc ctccacacta ggggagcaga
   174301 ccctcagggg gtcgcagccc aggaggtact gagcaaagac ccgcatgcag atctcctgga
   174361 tgcgacgcgt catggtgctc accaagtcct ctttggtgat ctggggttgg cgagcgatca
   174421 tgacgctact ctcctccagg atgtaacaag acaacacccg acagaactca gtcagcagcg
   174481 agatggcccc atacatagtc atcatggagg cgtcactggt gaccttgtac tcattgccca
   174541 tggtctccac acaggtagtg aggatgtcca tgaagatgtt atcaatgtgc aagagtacct
   174601 tgtcccgctc ctcgtccaga gttttcatga tcctctgggc gtggcacttg acctcctcgg
   174661 gagaacactg atggaaggac tgcagggccg cgatggccgc gctggttcca ttagtggtct
   174721 tggggaaggc ggagttctta gtaaagaact ccacgtgctt aagagctata taggtcatct
   174781 ttctattcag ctcctccttc ttagcctggg ccttggcctt gagcgcgttc cctagcttag
   174841 aggcggcgtt cttagccacg tcatgcaggt ccttcagaca ctgcagccac aggtccctac
   174901 tctcctctgt cactacatag ttctcataca tgttctgcat ggtgaccccg atacacttca
   174961 tatcctcgaa gggctcgttc accttatcta agatatctaa agcagtttgc aaacaacccc
   175021 ccatgttatt aaacgccgcc gtgaacttct catccatctg ggtatacttg gtcagcatgt
   175081 gtgtcttgac tttctgtctc acaatatcga cgcggacctt aatctgctta actgtggagg
   175141 ataacagaga tagctgtcat gagtcactaa gttccacagc tgtctctcca cccccagcct
   175201 gacacatgca tgaaccaccc cgaggttaat aagctcatcc tatcatctct tttcacatgc
   175261 agagactgtg tggttagcaa gacacagaac atcatgccta ctcaccaagt tcttgcagaa
   175321 tgtccttccc ggggttctca tcacactcct tggtgacatc ttcaaaggac ttcaggtcat
   175381 cttcagacac atcggggaac agagggtctc ccaggttcag ctggctgttg acctccttct
   175441 ggatcatgga agtcaggaag gcacatgcct tggacacggg ggtctcgggc ctaagcacgt
   175501 gaacacagac aggactgata agtttatggg acagacacag agaaagttcc cctcctctgt
   175561 ttgctttcca cccccgtgac atgcatgaac aagcccggga ctcaccttgg gatcttgctg
   175621 gaggggccct catcagggtt ggcagagtcc atctttctct ttccagatga tgactccatc
   175681 tctctggtga agtgccgcgt gtggtctcta cctgcaaaca tccatgaaga cagtgtggtt
   175741 gagcctggtg tacttatgtc tccctctgct ggcggcagtg acgactgagc gacaactacc
   175801 ctccaccgct gttaactatc acaacaccac gggagtaacg agctccctta ccttttcttc
   175861 tcagctgtca gggacttcat catctgtctc ttcttccctg gccttaagtc tccagacagc
   175921 agagagtccg tggacccatg tagggtcccc gggctcgttg ttagaggcat accccacagc
   175981 ctcggccctg ggcggcatgg taatagtggt ggggatcgtg atctgcctga gtctggcctc
   176041 gacaattagc agccgagagg tgcccagcga cgatgaagaa caagaagagc tgctggggac
   176101 ctggcccgag gagccggagg aggacagact aaccacactc ccgtggccgg gggtacccga
   176161 gatcgccgtg gagatcccct gttagccccg gacggtgttt gtggggtcta agaataaaag
   176221 agccatcctt aaaaacaaac agagtccgcg tgtcagtctc tgggagttgg aaagggggtc
   176281 taagcagagt ccgacaccga tagattggct ataggccaag aggggcggca tggcagaggg
   176341 ccatagtatt gatcagatat aggaaacacc gtcaccaata gggggcagtc ccaatcaata
   176401 gctccaccta tatgttaagc tataccatca ccctatagta tgagtaagcg gaagcgccct
   176461 ggtccaaagc caagataatg catagcatgc tatagatagt atatagccac gcctatatct
   176521 ataggcagta cttacgtcac tattggcacg ctgtatccgc gttccaatgc accgttcccg
   176581 gctacggagg ctggctgggt cccggttcct tctatggagc tccaaacagc gtggacggtg
   176641 gctccaagcg aagtgacggt tcactaaacg ggctctgctt atatagaccg cccatagggc
   176701 acgcctaccg cccattgacg tgtaatgtgc gtcaatgggg cggggtttat gactcatatt
   176761 ggaaattccc attcattttg gtgccagaac ggatgcccat tgacgtcaat ggggcgggat
   176821 tatggaaagt cccattagtc atacgtactg ggcgtactgc ccgttgtatt agtcattgga
   176881 aatccccatt agtaatacgt tgatgtactg ccaataggga aattcccata gaaaaacaat
   176941 aggatgatgc aattggcgta cagccaggcg ggccatttac cgtcattgac gtcaataggg
   177001 gcgtggtgaa cggtaaatgg cccacttggc agtacattct atggctcata tccgttcccc
   177061 gcccattgac gtcaatggaa agtcccacca ttgacgtcaa tgggcggggg tcgtggggcg
   177121 gtcagccaag tgggccattt accgatattg acgtcaatat gcggatctcc atatatagac
   177181 attgaactat tgacctatta attgacacta atcaatatgt ggctattagc caatatataa
   177241 ataaaaacat ggcgtcgata tatggcatgc ggccatatat cgatgtatat gatccataac
   177301 attatatcga tgtatataat ccataacatt atatcgccta cgtcatatcg ttggcatggg
   177361 gccaatgata tcgcggccct atcgtcgata tcgtcccatg tcgccggtcg cttatgtcgg
   177421 aaccgcgata gacgcgacag gccgtatcgc ccgtgtcgtc taagtcgtat atcgccaacg
   177481 gcggcgtacg atagggctca tatcgccaga tatcgcggtt tgaaaatatc gcatttggaa
   177541 aaaacggcga tatgacgtat gcgaaaaacg cgatcggcga tatacgcggc gggccgcttc
   177601 cccgtaaact cgactacccg ttatcgctat ctccgtccgc gatatccccg actatcgtat
   177661 gtatcgcgcg gcgccgacga cataagtcca gaaacgcgga gatctctcat acacagaagc
   177721 gccgcgacga gttttttatt attatatctt tattcacagc gacaagacac ggcaacagtg
   177781 ttaatggtag cggtcggtta ttggttttct attgcagcat gtagcccagc tctgcgttgc
   177841 acacgtccag tctccggcgg gccatcacgc tcttcaggta gctgttcagg tcggtgatcc
   177901 gcccgggttt ctcgtattcc aggctgatcc agcggtacgg tacgctgccc gtggcgccca
   177961 agatgtactg gggctgttct tccttgacct tagcgcagcg cagcttaccg tctgattcca
   178021 agtacagcct gcgggtacaa aaaaaggaca tgcatatcca taactttctc tgtcccgcgc
   178081 cccgtaaact gttaagttat cctccttccc gaaagcgagg cacttacggg ttgtggttgc
   178141 acgccgtcag cttatcgtgt accacctgcc gggtcagaga gcgggccatg cccatgatga
   178201 taccgcggat ctccgccgtc ttttgggggg tgtagcacac ctcgccctca gggcatcgta
   178261 gcctggagat atcatcacag cgatttgtgt atgtgttcca tcaggataga gaagacgcag
   178321 acgaggatcc gcacatacaa gcaccgcagg acgaacacgc agatacctac gagacggtgt
   178381 aaggggtgca catcttgaag ttgtagcagt tcccgggggg ggtaggcgat gttcaccatc
   178441 tcgcagcatg attccgcgcg cgcgaacgag cgggacgggt tcggccacat catatacagc
   178501 aacgtcaagg acagcagcgg gcccggagac atgacgacga cggcggtttc caaaaatccc
   178561 cgtgcgcgcg cggcgggctc agacgaggag attggggtgc gtgcagtagc tgtaggtctg
   178621 gttgttggcc tgggtgaacg tcaaccgcgt ctgaaaggcc acgctgtagt cccgaaacac
   178681 gtgagcccag gtctccagct tcatgatgca catctcgtac cgcgtgccgt cgttgatgac
   178741 gaaacgcagc agcttggtct gcttcgggac catgtgcgag ccgaagacct tggcgtcgtc
   178801 cgtgcggatt tgcacgttgc cgtcgttggc ggtcgatgcc gtcttggcga aacgctggaa
   178861 caccgggtgg tcgcggccgc tcaggtacca ggtgaccttc ttcacccatg gcgagggccg
   178921 ctcaatcagg gtctgtccgt ctcggttgta gagcaggacc agggtctcgt tgttgcagga
   178981 cgggcccccg ggcacctcgt ggtatctcgt gaactcgctc aggcggcgcg ggggcgacgg
   179041 gaaagtcagc gggcagtaga gcgaggccgc ctgttgcgtc ttgagatacg ccgtgaacgc
   179101 cgaccacgat gacggcgacg aggcttcctg gagcgtcagc tgcgaccacg aagacgcggc
   179161 ggtggatttc ggcggtgacc tatcttcgtc acattctgcg gacgtcagcg gcaggaacga
   179221 gaggaaaaac gcacacgaga gcagaagcgt cagcgggtcg cgtgcccgtc gtcggtgaca
   179281 gtagcgacga cagcagcgta ggtgcatgac ctccgccgcg gttttactgg ggaaagagcc
   179341 gcacgctgaa ttccagcatg cggtagtgcg gtcccagaaa gccggaggcg ctgaacgtgg
   179401 ttctcttgtt ggtcccgccg cgggccttct ggcgcctgaa ctcgccggcc agcagcgtta
   179461 cctccgttac gttgatcctg cgaacaaacc ccgattggtt cgcgcgcacg tcgttcgggt
   179521 gccctctttt cgtcctcccc tttcccgaaa ccgtacgcgt cgctcggctc acctcttgag
   179581 cgtcttaaag ttatccaaac cgtggctcac gtcgtagtgg tactccacca acgtgtccac
   179641 cagccgcttg acgtactcct gacgggtacg ctccggcagc gccggggaac acgtgtccca
   179701 gtagtcccac gggcgcgcaa agtcgtcccg ctcggcttcc tccctgcgac actggcccca
   179761 caccgcgacg ctcagacaca aaacagacag aaacacacgg tacaaccaca tgttgcacac
   179821 tgaaggtcaa ctttattgtt acacagggaa gaatatggac gtgggtggtg gtggtttcac
   179881 gggactcgga caggtgaccg cttgttaatc gtactcgggt tccttgaggg tgacgggtgt
   179941 agtggtggct ttgatgagtt tgggaatttg ccaattggcg tgggtgggtt cctccatctc
   180001 ggaggcggtg agttcgtcgt acacggtcat gtagtaacgg atgtgatcgt cgtcgtccga
   180061 atgagattcg atggtcatgg gcgaaccctt gccgtagttg gggttgacga acgaggtgtc
   180121 tagcgtaccg tcctttttga agtagatgac gttctggggg tctttgttca tgctctcgcg
   180181 ggccgccgtc gtggcatcct cgtcgaaatc gttgtccagc ggctggtaga aatgggaaga
   180241 ggaggcggcg gggattctcc cgcggcgact gccgccgccg ttcttgccca acagcgtctg
   180301 ggagccgtcg tcgtcgtcca ggtccaggag cagcgccacc tcgtcgtccg tgaagccgta
   180361 gaggcgtccg ggcttgcgac aggagacgta gagcacgcag aaggccacca ccaggaaact
   180421 gaggatggaa ctgccgatga cgcagtacac gacgatagtc atgatccatt ctaccttttt
   180481 ctgggtggaa ttatcgtagg ccgtggtgat gctatcgttg tggtttctgc tagtggccgt
   180541 cgtgacggtg ctgctcgtgt tggtggtact gggcgccgga gtactgctgg tggtgctggc
   180601 ggccgcgata ctggtcgtac cgtgattcaa cgtgaggtat agcgtgaaaa aagccaaaca
   180661 taccgtgagg gtagtgttgg tgccgttgcc cagagagccc gtggggtgtc gtctcatcgt
   180721 caccaccgtc tccgcggcgt accggggtgg cgcgagatgt atcttatagc gccgtcagcc
   180781 tcgagaccgc agcttcccct ttctccttcc atctaacgtg cgcgcgttct cacgccgcgg
   180841 ctcgctaccg gggcgacgac atccaccagg ttaccaaaac gcgaacccac aagatgccca
   180901 tcaccgttat cagcagcgca ttcagatact gcacgacgaa tctgtcgatg gtcgccagcc
   180961 atccggcggc ttttgggtcc tcgcgcagtc tcttggcccg ttcgaaggcc tctttgggaa
   181021 acgtgtattg cacgtagccg cgggtcaggc gggcgttgtg gcgatagacg gagaagtcca
   181081 gcgagaggtg ggagcccacc ttgtactgcg gccgctcgat ggtggcgcgg tgccgtagtc
   181141 cgcggggctc ctggatctcc acctgcagct gtatgttgtc gtaccggtag gtctcactgc
   181201 gtcgcaccgt ccagttaagg tggtagtcgc gctcgccgtt accgctgatc acgaagctgc
   181261 tcaccaggtc cggcccgaag gccagatccg gcgtgtcgaa ttgcgccacc aggcgacccg
   181321 agtccaggtt ctccaggatc tgggtctccg tctccagata gagggcgaag cgcacgaagt
   181381 ccacccgggg ctccaggaac tgcgatggcc gatcgccgtc gttgaccacg taggccacgt
   181441 agagaccggc gttttcgatc acggcgtcca gctgcagccg ggaagagaag ctcaggccgc
   181501 ccgcgggcca gggcgccgtc tggttctgta gctgcagcgt gattgtcgcg cccggatcgg
   181561 acagcctgta gcgccagacc gtgtccgacg gaggtgacca ggaagatgtc aggttgctgg
   181621 tccagaaagg tgtgcatttc atgctgtccc agtcggcgca gacggcccat cccagctcgg
   181681 tgaaggacca gggtacggag gagaaggtgt gcgcgaagac tagcgggccg ccgcgaccgc
   181741 tcagtagtcg gacctgtacg tagttgagga gctggctgcc gtgcgcccta aagacatgct
   181801 cgctgaggga agtcaacagg aagcacatta gccagaagcg gggcatggtg cgcgggggag
   181861 atcggagaga gacggcagct ttatcggcat gacgttttcc cctcccttta cagcacacac
   181921 gtcacgagga gcgtaccgca gatcaccagg gagaaggccc acagcgcccg gtagtcgcga
   181981 tcctcgtgcg tcagggcggg gtcgtctccg tagccttcgt cgtccccctc ctctagcggc
   182041 tgattcgcca cgcacgaccc ctcggcgagc tcgccgatga cgttcgtggt ataccaggtc
   182101 agggctccca acgcgcccag ggctacgatg cggtaaaata gagacatgcc ttttttcccc
   182161 ggtgtctctc tgtttccctt tcagaacatc ctcaggccgt atttgatcct gttcagggtg
   182221 atcacccgtt tccagagata agtcttgtag gcgtggggta cgggccagcc gagaaattga
   182281 atcccggtgt ctatcacggt ataaacttcc tgttccgcgt cgaacacgac gcggaagaag
   182341 aggcggttaa actcgtgacg gacggccggc gcgtggggat tcagacactt ggtgctcttg
   182401 tcttttaaga ccgccaaaac ctgccggcga gcgcatgtct cgctagccgt gattggcttg
   182461 aggtactgcg tgcccgcggg gatggtgttc agcaagatgt ggtttgcgca tagacattgc
   182521 cggtcgtcct cgaattcaag ggaatgggtg ggacatatac agcataaaaa aataaatata
   182581 gtgcataaag ggaatcgtac cctagtgtaa agctgacgtg acaagttttg aaacaccatg
   182641 ttgtcacgtt ccgcagtatt tcgctatcct tacaggatag ctactatgtg ttccttcttg
   182701 taaggtctcc agtcaggtga gtgtttatgg aaaatgcata cccgatttcc attgcggtat
   182761 gtaaagtgat gccatgtact taatctaaat cgcttataaa atttattagg atattcaata
   182821 catacgggtc gtgacctttc ggaaagatat gcaatggctt ctgttcgtcc gcattctacc
   182881 ccaggtggat aaacatagat ccaactattc ggtattggat aaggccaacg cctgtctagg
   182941 cattgacagt gttgttctct tgtgacagca tcacaagtac tgattgtaat atgtacgatt
   183001 attattgata ataaaaactt cataacggat tatctatgtg catggagtgt cctacatatc
   183061 aaaataaatg gttttactga aggatacaat tgttcatgtt gtttcttggt aaatttgatt
   183121 atactgtaac gtttatgcag gggtatcatg tacgaacagg caattggtaa ccattcggtt
   183181 gattaaaatt agtgggttta tctgtgtgtt tactcaatat cagtggtgtt ttttgggtgg
   183241 cgttaacgat aacggagaac cagcgatatc cctgttcaca ttctgtaaga aactgcttac
   183301 tgatttcatg atgacgtcct aggcatactt tttggttata attaggaggt aggtgaacta
   183361 tcagttccat attaggacat cggtaactgg acgaaataca ttccacccac tggtgacgtt
   183421 tacgaggaaa ccagtgctcg ggactcatat ttttacctga acaataacaa cgcatttccg
   183481 tagcgatgtt tacacatatc caggtagcaa ggaggccaat catgaagccc cacgttgctc
   183541 gcatgatagc tccgttccct tgttactcgg cgtccgtaaa ttcgtgagaa cttggattcc
   183601 cggaattggg tcctaaactg cgtacatgac tcctcgtttc ccggtagtta cctcccattt
   183661 cacgcaaaaa cacttatcat accgcgctcg gacaggtgtc cgagcgtcta ttttgccgtc
   183721 cacccaggtg ttttaccgca aacctaatcc actacatacc acaccataca caaaacgggc
   183781 tgcgtgcgac accattttat taaaacggga accacacttt cacaccagct ctaccaacac
   183841 ggctcggacc tttctctttt gcagaccgct ctcaagcgtc acctccaccc accgcggatt
   183901 ccccctcgcg tccctcgtgt ctcttatctc cctcgtcgtt ttccccctcg tcgccgctgc
   183961 tactgctgcg acggtcccga aatccgtccg gatcgcaggt cggaaatgtc tccgacacga
   184021 tccacgcgcc tttcacccag tccgactggt ccagtctcgc caacacgtta ctcggcatca
   184081 gctgcagagc cacggccgtc acggcgctgt accggtgcaa caccagggac ttggtctgcg
   184141 acgtagccat cagtacggcg taggccccgt agtccgcctg ataggccgcg tggtgggtta
   184201 gacgttccca ccccgaggtg ccgtcgcgag ccctcgcgca cagcagctgg acggcgttct
   184261 gatgtctgta gtggaccatg gcgctcggac cgctgatgaa cgagtaataa tgcgcggccg
   184321 agacggcgtg ttgatcgtgc atgggcgagc gacgacaaca ctacctgcgg cgtcgtcctc
   184381 catgcttcgt cctctcacct tcttatgtag tgacacctcc tctctcacgc tcttggaccg
   184441 catttgcgca ctcagtcctt ctctctcctt tccataaagt gcttctctat ggtcagtgca
   184501 ggatacgtat actttttcta tcgtcacagc gacctgtaaa tcagcgcgct cagcggacag
   184561 tagttctgac acctgtcgct acgataggcg gtcaccaagt acaggatcag cagcacgata
   184621 cccaccagaa agatcaacac tgacagccag gccagcgtcg tccgattact cttgtttcct
   184681 tcctctttcc ccacgtacac cacactctcg tttcgatgcc ggtggtgatg ctgacgaccg
   184741 gtctctcctt tctcctcctt gtcttcgcgc ggcgtcacgg tgtaatgcgg cgcgcataca
   184801 gtatcgtgcg tgcgcgtaca gacctgcgcc gtcaccggct tgtgacccgt acacttcgta
   184861 caatttgtgc agtttttccc cgatacgctg aaggtcccgt tcggacacga ctcgcagacc
   184921 gtacccgtca gtggcgtgca cggctttttc atctgatacc cgtcgctgca cttcgggcag
   184981 cattcccctc ccatcctcac ctcatcttcc ttgcatctga ttcccgctac tcgcgccgct
   185041 gcgactgccg accccaggca cagcagcgtc cacagaggcc tcataccccg ctggcacccc
   185101 cgttgccgcc gccgtcggag ggtcggcgac cgcgcatggt agcggtccca tcttgggcgc
   185161 gatttgcaat tcggacaccg tggcgtaaat ataggacata gatcggtaca gatacaccgt
   185221 cacctgatca ccccctatac tatctatgga cgtcaagaaa gttcctcgcc cgatctataa
   185281 ccgtgactgg tcggtagata tctcctaccg tagtacaggc cgcccgccac cgcaactgtg
   185341 gtgattacgg gcaccgtata gatgatacta gcaaccgcgg cttcctcgtt tacttgcata
   185401 tccgatgatg cgtcctcccc ttctattatt ttttcttcca acctgtgctc tgtcatcttg
   185461 tttgatcctt cgtggaatac tcgacaagta tagttctgag cggctgtctg cttaggaaac
   185521 gcaaaagttc cccaggcaga gcaagtgtag ttcatattag gtcctataaa aaacgaggca
   185581 gcgttcatat ggtgggttcc gttgctacct gtgatcgata cttcacaggg ccgaaatacg
   185641 gacacgcgac atatagtgtg actcgtattt attcgtctaa atataacatc atctggcaga
   185701 agaacagtgt gttgtgcttt tccactgtag tgacggagcc accaagggca gtctgttcgc
   185761 agatagtttt gtatatctgt tgtatccact gtggaggcgt cgaatttcct ttcagcgata
   185821 ctagcacttt catttaatgt tttccaccag gtggaagaat tcatggataa aaaatcggta
   185881 ccattgacgc ctatagcgta gtaatcacta tgtgtgccgt tgttcatgat actgcaggcg
   185941 tgatattttt gtaatgtcag tcttggataa gggttccatt gttcaggttc tgatagattg
   186001 aaatatttat agaggatctt tgtatttatg gaatctctcc taagaaagct ggatacttta
   186061 cgctcttcac cgtctttgta agttcgatta gcaacaaatg tttcaaacca cgtttgagtc
   186121 ccttctgtga tgacgtgtgg tgcttcttga cgcagattgg acgtatacga cccgttatat
   186181 cgaacaaaca ggctatcgtt caaaaaacca tatacgtaac ctatataaga gtagccatgt
   186241 acatcatatt tcagataata tgtgtacgtg agtgaatact ctttggtaaa cggtataaaa
   186301 tatcccacca agcaaagaat tagcatcttt ccctgttttt catattctat tcgccgtcgc
   186361 atcacctttt gacacatccg ctcataaatc atcttcgaaa caccccaccc caaattataa
   186421 cgctcacgcg taaaatattt tctattcata ctttattttg cacacatcaa aatcaggacc
   186481 aagtgaaagc accctccctt cccttctcac gtcttcatcc tcctatgtcc cggatactca
   186541 tcgtactgcg gcaggcgtcg ataaccatcg ccccgtcggc ccaagcagcg gcggcagcag
   186601 tgcaggtaga tcaggtagca cacgaacccc acgctgaaaa aaccccagaa acccagaaag
   186661 ctcgccacgc cccgagtggc ccagggcgag agccccgtcg ggatctcggg cggtgtcgcc
   186721 agcgggggct ccgtgggagg cagggccggc acgaacttcg cctgcttgtc tccagaacgg
   186781 tagcagccgc ccggcagtcg gtactgccgg accaccggcc agcagcggtc gggctgctcc
   186841 tccggttgac acaggggccc ccagcactcc tcgtcctctc cttcgccggc atcgatgtta
   186901 atctccgttc cgtcacctat cgacgccggc tcgatgtaga accggttgcg ccggaacccc
   186961 atctgcgacg accaaccgca gtccacatgt ttcaggcgcc acggcgtggg cgaccagatc
   187021 tgacggtcct gcgaatggcg gcccagcggc ggcgtgcagc acggctcgtc ggcccagctc
   187081 agcgtctcca gatgcgtgag gacgacgaag cgctgcagga cgagcgcgtg actgtcgttg
   187141 cgcagcaggc actcgtacac gccggccgag gacgccgtcg cgcggaaagt cagcgagaac
   187201 agatgagcca cgtgcaggtc ggtgaagttg taactgacgc ctccgcggag acgcgactcc
   187261 gtcagcttct cctcgagggg gacgactacc tcccctccgc gcgagagatt gaagaccagc
   187321 tcgacgctac gctcggttgg aggcgacaga cagaacgtag ccctgatgac cgccagaggc
   187381 cactggtgga tcatgaccgt gcacgggacc gtgactcgct ccccttcggc caccagcatg
   187441 ggtgccggcg acacgatctc gtagttctcg gcccgcgttt ctttcggcag cccggtggga
   187501 gcggccgcgt cggacaacag cgcaccggct cgcgaggact tttcgggctc gagcagcagc
   187561 atcccgacga cggtgagcag cggcaacagc ctccgcacct tgccgacctg ccgacgcgcc
   187621 atcccctgct cgccgcggcc tgctcctgct cggtctgtcg gcccctccgc cgccgcgccg
   187681 gcgtggtggt cacgacgatc cgacgagacg gctcctccgg gacgaccgat aatgagcggc
   187741 ccgtcctcct tcaggtcttt ttcgccaagt ccgcgggggc ttcgccggcg gtcgcttcgc
   187801 ccgcggactc cccggcgagc tcaccggagg gttcaccgac ggcgtcgccg acctcctcgc
   187861 cgccgtcccc gacgtggttc aagaccatcg cgcaggacct tctgcgtcgc cagcggtacg
   187921 tgacttgtct catcgccacg tccagcgact gaacggcgcc cgatcaaaga agaacgccgc
   187981 cgtcacagcg tctggtacgg ctgcacgaag tcgtggctgt tgcgcagggc gttgcggacg
   188041 gccttcctca ccgcctgttg catggcggtc accacctcgg gcggcacggg cggcgggggc
   188101 aggtcgatca gcagctcgcg agagtcctgg tcgcgttcgg cgtacgacgg actgcacggc
   188161 tggaagaccg aggaccagtc gtcgatgctg tcgatctcca ccgccgtctc ctcgcaggcg
   188221 tcggacatca gccggtgcag cgggttgtcg atgccgcggt agagccgctc gtctcccgat
   188281 cccctggcgt gacgatggga cccgacggag gacacactgg tggagcggct ggcaccgccg
   188341 acgctgccgg tgccgctgct gccgctctct gaagcgtgcc gcgagggccg acgcaggatc
   188401 acccggtcct gccactcgtc gaagcggtcg cagcagcggt tgagccagcc gcacttgatg
   188461 atgaagcgac ggaaggcgtc gttgttccag acgtagagga tgaagaacag caggagcatg
   188521 ctagcgatga agccgaagac cacgagggcc gtgagggcgt tggaagagct gctctgcgac
   188581 gcggttgtag cagtggacag cgtcgtgcta ctcgtactgc tggcagtagt catggccgac
   188641 acgcggactg tgcaccagct cagccgaggt ctcaggggag acctcgcttc aacgccggtt
   188701 atttatttcc aacgtgatca tacacgtcac ttaggaccga ttgacgtgcc cgcttctcta
   188761 ttcccctttt taaccacgtc aacggctcac gcgctcacac gtcgttagct gcgtggatag
   188821 gtgaccttgt cctgcgtcaa cggaatcgcg ggcggacccg cggtaccgtc gctgacgggc
   188881 gggggatacg cgggtcccgt ggcgcccatt ggtaacgtgg gaggggggaa gacggggtta
   188941 tcgtaagtgt accggccccg cgtcatctgc cgctgctgct cgtctgggtc cccgccacaa
   189001 cagtccggga ataacttacg aaagcaatac caaacacaca gtatacaagt aaatataaaa
   189061 aataacgata aaaaaccaca tccacccaga agtcctgcaa taatttgttg ttgattcaga
   189121 ccattgttat tagtgtcatt agcattcgaa catccagtgc ccgtagtagc agtgctacta
   189181 gtgctctgtg acgagttact cgaggtaccc gtcgtggttt cggaagccaa agctgccgat
   189241 acggcagatg ataacgccac caaagtcact gtcaccgtca tattaggtgc ggtataattt
   189301 tcgcaatttg agatacctgc aggcggagta agtggagtac cggggtaggt caacgtatga
   189361 cttcgaagtc ctatacatgt gctagaaaac aaagaacatt gtgtaggggg ggatattccc
   189421 tgaactgtat atccgtagta tagagtacga ttgcacttct tgactgtgtg atttgtagta
   189481 atgtttaatt gatggtcgtt acctgtatta tgtaacagca ccgtggcagg gaaggtgtcg
   189541 ttgacggcgc aaaatacatc gtgtgattga ttagcctttg tgttgacata gattgtgccg
   189601 atcggtgcga tagatgtacg caaggtaatg ttcatctttt gtccatcgaa tttgaaacaa
   189661 tcgtgtattc ctgtgcagtt gaggccgcat ctccttaacg tcatggtagc tgttgtatca
   189721 gatctgctat gctcaacttt accaaaaggg taattagcac gatcttgggg agtatgatta
   189781 taataagaca ttgtagtttc tgacaaagat cggttagaac aagaagtata catgagaccc
   189841 atggtgatat tatcggtcac ttcagtgaat tcgcatttta tatcaatata tttcccaatc
   189901 actaatgttt cgttcttcac cttccatata catttagtaa cgttagcgtg gatcttgggt
   189961 ccttgtgtgt aagaattagc gaggctcatg tctaatattt cccaagctaa taataaagag
   190021 ctagccagtc tcaattctgt catccagaat gcttttattc agcagatcac acatatacac
   190081 aaacagcttt atctacatct agtcctccac ctccgccacc gcgatttatc atcatcgtcg
   190141 cgggccgccg agccgttcct cagggacccg tccaccttct caaaaagccg ccgtcaccgc
   190201 tcccaccacc ggggacaccg ctgccatcac cgtcgccgat cgaccaggac cgccgcgcgg
   190261 tcttcacgta cgttctggcc cgctgctgcg ccgacgacat gcctctatgc aggttctagg
   190321 gtaatacgac accagacggg aaaaaattta cttctcccgt cttttttcct cgtcctccgt
   190381 tcaggtctgg tggacggtgg caaccgtgat aaactgcgtc gtcgacccca tcacgggctg
   190441 cagcagatcc ccgtcgtaga acatatccac gtctccgcct gcgatactgc cgcgaacccc
   190501 gcggcccatt ggtaccatct ccaccgccgc cgacacgctg tggcacgcgc cgggcagcat
   190561 ctccgtctcc tccgacgtcg atacagccca cgacgagaac cgcgagtccg cggagcgcgt
   190621 cgacggcgag tagtagccgc agttaagcgg ctcccagttc acgtagatct cgtcgtttcg
   190681 ccccgggaaa cggtacttgg cgtccgattc gcgccgtacc ggcccgaaac ctaacggcat
   190741 gtccgtgaag cgccgctcgt actcgccgta catctggcag cagttcacca gccagcggta
   190801 actccacacc agccgcagta gcgtcagggt gtccctccag tggtacaaga tgtacaccag
   190861 caaccccgag atcagtaaca ccaaaaggca cacgacgggt agccacacgc tcgtggggat
   190921 atctcccatg gctctttttt attaattagt taaccacaat aagatataca cgagtcggtc
   190981 gttcacaagc agcactctgt acacctcccc tttcctcctt gtcctcgctg gacgacccgg
   191041 ctccctcgac ccacccgccg ctcgtcctcc tcttcttttg tagacagcgt ccccggggaa
   191101 gctgccgccc cctctccttt cttacgtagc gggcgacggt aggggagacg acggatgatg
   191161 ggcacttact tgcaccgcca cctggacggc cgtctgcacg gcgcactgca cggcgcccag
   191221 ccattcgggc ggcagcgtct gctggccgac gctcagttct gttcccgcgg cgaccgtggt
   191281 ggcggcggcg ggctgcgtct cgtccaccag ttctatcgtg tccatctggc aggctgacgg
   191341 cgacagcgcc gcgctcgccc ggcccctctc cagatcctgt tcctcgtctc cctcgtcctc
   191401 gtcgccgtgt cctccgcgtc cccagcgccg gtgacgcctt cctcggcact cgtcggggaa
   191461 gcggcagccg cagaacaggt tgtgcagcat gtctctccag tcgttctcgt gatagtatct
   191521 caagtaagcg atcagggcgc cgacggccaa taccataagt gtgagcagaa gcgcgcagac
   191581 ggcgtggagg accaggctca tgggatagtg tcccttatct tcctcctgtc tctctccctc
   191641 tcctttgcgt ttctcgtccg cttcctcacc cggccaccac acgcgcagac ggcattccca
   191701 gagacgtcga atgcgaccgg ggcgctcgac gcgctggcat ttatgctttc caacgtcaag
   191761 cgcccacgtc atttcacacc cgcccctttc tccactgtcg ttagtgactt ctgctgtttg
   191821 ctgtgcgcgg cgaagcgagc gagagcttgg ggtgtgtgag ttgcgatgag gtcgccgagg
   191881 acggcgaggc gtctgcgtgt taaacggctg tacgcggggt gtgatgtgct tttaaaaaac
   191941 tggctctaag tagtctttct ctgctgtccg gtcgcctgcc cgaccttgcc gtcttcgtct
   192001 ctctcacgtc tgcatggact cggcgtcccg cagcacgttc ctcagcgcct cgtctaagat
   192061 gttgtcgatg tccgtccaac tgggcggcgg cgccacgtcc ttcacggaca ccggctgaca
   192121 catggtcccc ggggccctgg gcagcgtcga cgaacaagac gacgaggaca acgaggcttt
   192181 cctcccgcgc gtcagcgtcg agcagccgtt catcgtcgtc aggttctgca ccgccggcgt
   192241 gcgcggcaga cgcggcgtcc gcggcggttt gtgaggcgtc ggcttgtgct gcagcgtcgc
   192301 cggcgtctcc acctctcccg gcctcgtcgg ctccgtcggc gtccgcggat ccacgtaggt
   192361 ctgcggtgtc agcgccggtc gcggccacac cggtttgggt ttcgtcggcg gaccctgttt
   192421 cttgcgaccc ggcgccgcgg gagggtggcc gttagccgtc accttcacca gcggcgtctc
   192481 cacgccgttc gtcggcaccg tccgcggtag cggcgtcggc ggcaccgtgg gtaccgtcag
   192541 atgggtgctc ggtgctcgca cgggcggcgt tgggggacgc gacttcagca gctgacggtg
   192601 ctgttccagc gcctcgccga gactcgaggg agacgaagga gaggggcatg gcggcggcgc
   192661 cggtttccag gacggcggtc ggctgatcac cgtgtccacg ctggtactgc tcgaatctga
   192721 cgacgtcgaa gacgtgtcgt cgtcctctct cccgtcttct ccctctctcc cttcccccgc
   192781 ggaacgcagg ctgctcggcg tcgacggaac ggtcaccacc acgtcgggga tctcgtaacg
   192841 cgacggcggg aactcgggct tgggcgtctt gggctcgccg atgtacacgg aggtgcacag
   192901 gtcgtcgcgc tcgtcccgcg atagcggtgg ttttttcttt ttctgcggcg tccgcgggcc
   192961 gtccatcagc tcgatctcca ccggcacggg cttgcccttg tcggatcgct ggcagcagcc
   193021 gcagaagccc ggcggcgcgt ccgtggacga gaagcgacgc cgcgacttgt gcttccgagc
   193081 gcgacggcgg ttgacgatca gcagcgcgaa ggccgtcagg gccatcagga cggcgaagcc
   193141 cactaggaac aagctgccct ccagcatgct cgcgaccctc cttcacccgt cctggactgc
   193201 aaaaccccgt actggaactg accgcggcac ggccatttat tgtcatggtt agccagaaac
   193261 gtcacgaatt ggcaaggagt tagtctattg tttgcgaaaa gcggtgaagc ggacgcgtgc
   193321 gaagtcggaa gtgcagaggg gaggctcatg gcgggggcgt ctgctgctgc tgttgcgcag
   193381 ctgccgccag agccgccgtc acggccgcct ggacgatggc ggccaagtcg ggcgggagcg
   193441 cctggggtac cccggatacg gtcggctgcg gagcgggtgc cgggacgggc gtcggagtcg
   193501 gcgcgggggt ggtgggcacg gtgggggtgg tcgccttcgt tcccatgtcg ccgctcgtct
   193561 tttccttttc cgacgtgctc ttggacgcgg gtttctcggt ggacttggat ttgctcctac
   193621 cgccggcctt gggctttttg ggtttctcgg gcttctccgg cttcgtctcg ggttttgtgt
   193681 tggggttggg gatctccacc ttgacctcgc acagcggctg agacgacgga tcggacggac
   193741 cttcgccggg atcctcgggc ggtttggcca ccacctcgca gatcacccgg tcgcggtttt
   193801 cgccctcttg gtcggtgtgt tgcccgcgct gaaacctgac cacgtcgtac agcgacccgg
   193861 acgtgcactt gctagagcac cagaacaccc acttgcaggt gaaaaagtcg acgtagactt
   193921 ctcgagccag ttgcggaaaa cggataacat agatgatcag gtagatgaat aacaaaccgg
   193981 tcagtaccag ggacacaatg ccgggcgtgg taccgttaga ggccgcgata ctccatatgg
   194041 ctaaactccc agcgacggtt agcacgctaa aagttatgat attgccccag atgcattcac
   194101 aagcgggtgt gcagatcgtc tcgcaacgcc ccatggttac aaaaaacctt aatctccctg
   194161 tcgttcccta tctaatctgt tctgtcgtac gatccccagg ctatttattt cccaccggcg
   194221 tcatacccat gggcatgttc accgatctgc cctccgtttc gctctacact tgcagttcca
   194281 gcaccccgag agtccctacg tccagggtgg ttagttcctc gacgctcgaa gagagcgttc
   194341 gcatctccac ctcggcgggc ggttccatcg cccgggttag gggttctgtc tcgcctctca
   194401 gacagcaacc gcatacgctc tcccgacaga aagccgccag gtcccgcctg aagtaccaca
   194461 ggtacgcgtt caccactatc gtgatgatca agctggtcag cacgaccacg atagagatgg
   194521 ggatccaatg ttccataatg tcgctatagt cgtccgacat atcctcgtcg cgctaccgat
   194581 agtcgcgact cgctgttata cgcttcgccc gtcgccgctt cctggcccgc gcgccccacg
   194641 caccccgcgc ccctcacagc cgcgtcgtgt agcattcgcc ctcgtccgac gacgcgccct
   194701 cctcgcacaa gatggccgtc atagattcgc tgcgatcgaa ctgtctgccg cgtcgggcgc
   194761 ctcgtcgaaa tagcttgggc cgctgcccat cggtgatctc gtcgtagtag taaaagctga
   194821 tcagcgcgca cgacaccagc accgtgcagc ccatcaccac tcccacgcag atggccagga
   194881 tggtcagcgt ctccatcatc gcggccgact cctctacctc ctccgtttaa aacccgccca
   194941 aataatagcc ggcccgcgcg ctttctcttc ccttcttcct cacgtcgctg ccgccatgtg
   195001 gcccttcacg gtgctgctgg ccgttaccta cctactgggc ctcacctttt ggctggagct
   195061 cttctgcctc ttctccacgg ccctcttcga ccgcgagatc gcctgggcga tctttgtgcg
   195121 catgctggtg ctcggcgtcg tcttggacgc cggcgctagc gtctctcaca ctttcattcg
   195181 ctgtctagcc tacgaacgcg ctttcgccgt gccagtggcc ttcgcctccc cctagaaacc
   195241 accatgtcgt cccgtccgcc gcttcctgac gcggtctcgc gctacaaaac ccggcctgac
   195301 ccgcgtcccg cagacgcccc gccaataaac acacgcacga catgagggcc tggatcgaga
   195361 ttttacttag cgtcgtcacc atagccttgc tcctgggcgt cttcctaagc atcttagctt
   195421 ggtattttat cagttaacct gcgtgactgc gatttcgaaa cgacggatga cgccgtctat
   195481 aaagctcact ccctatctcc gtccacgccc agtcctctcg gcggagcgca acagaggtcg
   195541 gagctccaca ggaaaagtcc aacttcccat ccagcaacac gccacggcga ggccatgacc
   195601 gcgccgacgg cgggcaccgg ctacctggtg aaaacccagg agcgaaaaga atggtggccc
   195661 gacaactcgc tcaagcgctg gtggatcggt atcctcgtga tcatcatcat cggcgtgtcg
   195721 ctggtggcgt tcatgatgtt catgcagaag cacggtgcca gtggcagtac cagcagcggt
   195781 taaccgacgc tacagctcca ggttgcgcag ccggcccgcc agctggtcgc gttgctgcag
   195841 ctccgaggcc agggagtcgc accaccactt acgcgtgcgg tcccagtagg tacgtagcag
   195901 cgcccgcagc gtgtcgtaaa acgcctccac cgtctccagc gtatgcgcca cctcacgcag
   195961 gacgcgcgtt gcctggcacg agcggcgcgg ctctcgaccc ctttcctcct tccccttcgc
   196021 tctacttctt tttcctccct ccccgcctct ggcgtcagcg ctgtcgcctc gctctcggga
   196081 ctgcccatcc ccagcgtcag cctttttagg gctcacgctg ctcgcgggca ctcggacata
   196141 gccgtcctgc gtgggccaca ggctctggca gcggttgtcc tttcctgtca ccagccccag
   196201 gagctgtggc gtgtcgccct ccggccatcc gctcagcgtt tgtcggccta gggccagcac
   196261 cggccgcctt ccgcggtccg tctcggcgtc cagcagcacg aaatgcggcg cgcggtatag
   196321 atccgccggc ccgtttcgtc cgctgctggc gctgccgttc tcatgtggct cctgtctcct
   196381 ctcgtgcgtg gtcttttgcg aatcgccgac ccggctcgtc tcattctctg gctgacttgg
   196441 cgcctggcgc ggtttctgtg gttccgggta cccgcggtga gtctcgttcc tccccccgtg
   196501 ttccgattcc cctgcgccgc ctgacgacgg cggctgcagc tcgatttcca gcgcgtgcag
   196561 gtagtgcgtg gcgttgtact cgcatcgccg agccgccgtc acgatgggcg ggcagcggca
   196621 cagacagtcg ctgtcgcccg ggtcggccgg ctgccgcgcg aacctccgct ggcactcggc
   196681 ccgttccgcc tcctcaggct cgtgtctctc gtcccgcagc ggccacagca acccgcccag
   196741 ctcccggggg agaaagccga cccacagcat gacctccccg acgcccgacc tgctcgccaa
   196801 cagcggggta cgcagacgga atacgttgaa gcggactttc tctgcgctct cgcggagtac
   196861 cgacggcgcc agctgctgct cgacgacggc gtcggaggag gagcagcgac ggccgacttc
   196921 accggcggcg acggtggtgg cggcggcgcc tgcaccgtct gctgccccgg ccggcgcgac
   196981 cgcgggcgcg gtaaacggga ccgtagcagt catcgacgtc gccggagacg ctgaagacgg
   197041 tttgacccag cgtctctgca cgtccacctc cagcaacggc accgcgggtg aggccggggc
   197101 ggaaggcggg tcgtcgttcg taacgacgtc gtcctcccct tcttcaccgc ctcgtctccc
   197161 catcacctct gtctttatcg tctccccacc tgcaggtgtc gccagtgaag ccgtcgtcag
   197221 tgcacctcct ctcgttagcg agaagggcgg cgagactact accggctgca aggtcgtcga
   197281 gcaggaggag cgcgagagcc ccaagaacct ctggtgtacg gccttcagag aagccatctg
   197341 ggacgtggcc ctgctggaag ttccgcgctg ggcctggcag ggctggaggc ggtggcggtc
   197401 ccagcgcggg acttcttcct tccccgtctc tttcctcgcc ccctccgttt tgcccccgtc
   197461 cccccagtca gcggccgcct ctgtcgcggc gtctctcggc tcggccgtct ctttctctga
   197521 tctggtcggc caggccctgg gcgaggtcat cggctccttc gtggcgtaca tcgttttgga
   197581 gaggctctgg ctcgccgccc gggactgggt gtctggccac gacgccgaaa gcgaagaggc
   197641 catggccagg cggcgccagc gcatgctctg gcggatgttc acgcgcggcg ggccggacgg
   197701 cgcggagcag tgttcgttcc ggggaacggt tgtcgaggag tcggcggacg agagcggcgg
   197761 cgagctcctg agctcgggag ctggcgctgc tactcgccct tccccgctgc ccggtaacgc
   197821 gtgacagtaa tagtaggccg cgaacgtgtt gcggcacgtc ccagtctcct gccatagcgg
   197881 tgagatctcg ttgctagtcg ggaagaacgc tgtcaacgcc caccaccacc acaacatccc
   197941 cgctagctcc ggtggacgcc gggccattgg tttctcccgc tgtatatcgt ttcccgaccc
   198001 cgtgtactgc tgtgtggtgt acgatcgtct ttttggctgt gaagtccctc aataaatact
   198061 agtgaactca ttgcctccgg ctgtctcgtc atgtttgtcg ttcccctctg ttgcatctga
   198121 atcccacttt ggtatcacct tagtagtact tttgcgagac acctcagtcg gtgtccgacg
   198181 ccggcagttc ccggggtagc atacgccaca gttgcgttcg gggaccgtgg ccgctgccga
   198241 gcgtgagtac gagataccga cgccaaggtt gggacggccg gatgcgttgt ggggggcgtc
   198301 tgacggtgct gccccctccc aaagaactcc ctccgccctc ttcgtcctcc tcgtcttcgt
   198361 cccacccgtg cagcagacgt acgcctacac cgcggctgct gacgtgttcc cagcggcccg
   198421 taccgtcacg ctgtcgcgct atcaatagct ggctgacgcc gcagcgatag ccgtcccagc
   198481 ggcaccagca gtcatcgggg tgactggagt tccctggggg tgggggatgg gcggctaaac
   198541 ctgtgacggg ccgtgagtca gggttcggac tagtggataa ttccctagag acccctacgg
   198601 tgacgctcac ggtggcttcc gttgtggtga cggtggcggc catgttgtat gcgtcatagc
   198661 gtagtggtca gtgtgttttg cagtatacga ggaagtgagt taaaggagtt gattgaaagt
   198721 ggagagatta cagtacgttg ttccagtcta tgcctgtgtc gtgttcgttg ttaattcgcc
   198781 accattcact gagtttccaa aagattgttt ttccttgaaa ttgttccggt cggtcttttg
   198841 ggttagtaat gttggggcgc caatcatatg gcacttgtaa gccatagcct agagtgacac
   198901 tatatttagg agggtgtttt tgggtttgtt gccaggtgac tttgtagcat cctagtcgag
   198961 tactatttgt aacaagtgtg gcttttttgt ggagacagtg tcctcctccg tgtagtgtaa
   199021 aaaaatagcg ggtgtgggac aacggttttg gtggtcgaat ttacacaacc atggactgtt
   199081 tggagtggct tttttgtgta ttttgtcacg tgtgttacaa acacatttgt tgaggttggg
   199141 gactgcgtgt gtaagtatga ggatagtgtt gaaaaatagt gtgaaggtgt tgacgagcat
   199201 accgtatctc cctgacgtag acggtgtatg ttgcaacgag tcctaaacag taatggtgtg
   199261 ttgtacggtt ttggtatgtt gcggctgaat ggtgtgttga acggcgaagt tgcatatgta
   199321 ggatgtacac aaaggcagga atacacgaga gtttccattt ccataagcgt ttttattgct
   199381 gttctgttag gaaagcgaac gttaccggtg aagattatgg ccaacccaat tcccatactc
   199441 cgtcgagtcc gtggtagatg taatgtccgt attcttcagg tatctgtcgg aaccagtcga
   199501 gtatagttcg ttgaatcaag gctttgggat gaaatctagg tccgggttgc cagtagtagg
   199561 ggatgtcttc gcgtggtccg aggagtatag tgttgtcgtt gcgatgtttg agtttgaagc
   199621 atgctcgtcg atgtattttg gcaagttttg tggaggcatt gaggcagatg cctattccgg
   199681 tgtcgttata cagcagagct tctttaacgt tgcatgtcgt atgcggtgga atgatgcaga
   199741 gccacgtgtt gctgggttgc gttcttctgg ttgagttttt gtgaggacac aggcattcag
   199801 aagtcgttgc tgttcgtgtc gcgaagctag ttttgagtcg taattgcagc aggcagagca
   199861 gcagcagagt cgcgtaggcc agtagtcgcg gcgtagcatt cgttgaagtg gtagtggtag
   199921 tcgttgttgc gtgtagatct gttgtatgtc gttgaaggtg ttgaggaggt gtgcgtagtg
   199981 tgttggtgag tgcttttatg tgtggaggtg tgttgtaatg gtgttgagat tgtgaaagta
   200041 tagcccccct cctccgcgtc cccccggggc ccgtcctttc tcctccttgc agtgcgttca
   200101 ttgtccgttc attgtccgtt cattctccgc agtgcattcc cctcagctcc ttccccccag
   200161 ttcattcccc tcaccttcag tctccttcca gttcgttctc ggactcacag ctggcatacg
   200221 gtgtgactca acgctggcag agcctgtgac gcaacgctgc ctcaccggct ggcttaccgc
   200281 cggcttggcc tcgccagcac acagctgcag tcacagccgc gcgccagcac acactcacct
   200341 tcgttccaca gcacgccgcc cacatcgttt gccctcctta cccgctgtca ccaccacagt
   200401 ctcatccgga aacttgccct accaccctag tctatccgcg cagcgagtgt ggcgcgtgtt
   200461 tgccgtggcc gggatcggtg agtcacggaa ccggtttccg cggcggcgtg cggcgggccg
   200521 gccggtcgga cgtgtttcgg gccggcgggt cgtcgcgggg actggtttgg cgtgcgtacg
   200581 tacgtgtttc tgcacggctc cggccgccgc ttcggcctcc ctgcacgccc gcggcaagcg
   200641 acacgcgcaa ccttgcgcca atttagtgcc cccccgccaa aaacaccccc ccaccccccg
   200701 ggacccgcag cggaggccgg atcggagtgt gtgcgtccac cggtctggcg tccccaggcg
   200761 tgcaaacggc caaccaagcg tgagctgccg gaggcggcgc ctgcgaccgc tgcccgcctc
   200821 acgcgggaac aacactgggt ataaaatctg ccttcggagc tcacacacgc acgcctgcgc
   200881 ttctcgccgt ttgcctctga aaactacgtg ctccgcgagg gccgagagaa cacgcggttt
   200941 tcaggggtga cgcgcgtgca ctctaacgag actattagga accataatcg ccgtccgcga
   201001 tccacaccga ctttccgctg aagccgttcc cgttgcggac tccgatccgc ccttccccac
   201061 ttcaattcct cacgacgctc tctgtaggca acgtacgctc aggccgacgc catgagccag
   201121 cgctttccgc gcccgccggg acgaccgcac gcccacccca acgtgcacaa ccccaccacg
   201181 tgcaagcccc acgccggagg ccaagcaggc gccatcggcg gaggaccgcc cggcgccccg
   201241 ccgagcctca acttctggaa cagcccggag cggttcctgc tggcgcagat ccccgtggaa
   201301 cggagaacgt tgacggagct ggaataccaa gccatgggca ccatctggcg cacggcgttc
   201361 atggctaaca ccaccagccg agccatgcgc aagtgggcgc aacgagaggc cggcggtctg
   201421 ctcccgctgg gccggccgta cggcttctac gcgcgcatca cgccgcgcag ccagatggcc
   201481 ggcgtcgggg ccaccgacct gcgccagctc tcgccgcgcg acccctggat cgtgctggtg
   201541 gccaccatcg tccacgaggc ggcgacggga cacgaaccgc tgccgtcccc gggagccacg
   201601 gcgccgccta cgggactgga cggcctgtgc caacaggacc agctgtacct ggccctgggc
   201661 gtcaactttc gggtgttcat ctacgacctg cagcgcaaca cgctgaccct agccgcccgc
   201721 gacgccgacg aatggttccg ctacggcgcc ggcgacgtgg cgcggctgta tcggtccaac
   201781 cggctggggc tgaacgcgcc gcgggccacc gctgtccccg agcccgcgct gctgcggacg
   201841 ctgaccaaga gcgacgacgt gaacgaactg ggccgcgagc tgcgccgccg gtggcagcac
   201901 acgggcatcc cgctgcagac gcccggacga ctgcgccaac cctgggtgat cctgggctcc
   201961 tggcaggagc tggaaaacta cgagccgttc gcctcggcgc cacacccgcc gtcgctgctg
   202021 acggccgtgc agcgccacat ccaccagcgc ctgtgctgcg ggtggctgtt tctgggcgtc
   202081 gtgctgccca gtcgctggct aacgatctac tgccgccacg acacagaggc ggggacgccg
   202141 caggaaaacc cgagcgtgtc ggctgatacc gggaacgatg cctcgtcctc agccaggctc
   202201 tcttcctcgg aacacggcgc cgcgaccagg tccgggggtc cggcgaatgc agccacgacg
   202261 tctcctcagc atggcggacg acagaccggg acggggcccg gcgcctctaa taccgcagct
   202321 ggcgcaggta ccgggacggg cttgtcttcg gggatggcgc cgagccagac cgcaggacgc
   202381 ggaaacggac ccgcgggaca cccagccggc gcgcctctaa taacgcatac ggcgaacacc
   202441 cagggacacg gcgtcgcgcc ccacaactcg tccgctgcta cctgtgccgt gtccccacct
   202501 ctgtcgagct ccgccggccc gacttctgct gctggaactg ctgccggtgc tacctcctct
   202561 ggtcaacgtc ccacggccgc cgacctgctc cagcagcagc aactgcaaca gttgcagcaa
   202621 ccgcccgttc ggggaacgga cggccggccc tacgcccagg ccctgctagt gctggacgag
   202681 ctgggtgccg tcttcggcta ctgcccccag gacggccacc tctacccgct ggccgacgag
   202741 ctctcgcacc tgctgcgcgc cggcctcctg gggctgctga ccctgggccg cgtctccgcc
   202801 ccgcccgccg aggccgccct gcgcctcctg cccgacctcg accgcgagca ctgggagcgg
   202861 ccccgctggg acgccctgca cctacaccct aaagcgtcac catggacgca agaccccgaa
   202921 aaggtgttta actttttgac gcggcagggg cgcggggacc ccgtgtggaa cagatgggac
   202981 tttctcatga gggactcaga agctgtggaa atctttatcg acgaactggt ggtccaacga
   203041 caggcgcagc tgccggagaa gtacataggt ttttaccaaa ttcgcaagtt gccgcaggaa
   203101 ctcaaaagac ccaaaaagaa caaacacgcc catccgcttc cgatgtacga cgagctaacc
   203161 gaaccgctca gtccgcaggc cagcctgtgt aacgccctcc ggacggacga cgagagctgg
   203221 tgtccgcaaa gtaccgttca cgatgagctg gcctggatgg atctcgacga atcacgctgg
   203281 gagccgggga ccagccgcac agacgatata aagcagcgcc gcctggccaa aggcactctg
   203341 cgagccggag ccgagatcga tcgtcccatg cccgtcgtgc cggcagaatg ccaccaccag
   203401 atgttcaccg ccggaggcca ccaggtaatc ccactgtgcg gatccgaacc cgaggacgac
   203461 gatgaagagc acatctacga ggagattccg ccgcgacccc cgctgcccac ccccaggacg
   203521 tcgctgatgt ccgcgggccc gaaaacgccg gggggcagac cgcgtccaca cacgcctccg
   203581 cagaaaccgc cgcggtcgcc tcaggtcccg gccacgcctc ccaggccgtc gcacaaggcc
   203641 cgggcgcccc cgccgcctcg aacaccgcag tcgccgacca gtcccggcgg atacgtgcgt
   203701 cctccgcgac cgcccccacc cagaggagac gtgcagacgg aggcgcagct gtgtcacaag
   203761 atgggggcca tgaatctcga ccaccagtac ccacagactc ctctccggtc tccacccccg
   203821 aggccgccta accgcggtcc cccggctcct cctcccagaa acaagaagaa acaacagcag
   203881 catccctccc acactcatgt tccgcgtcac gtccgccagt agcgacggca gcagcagccg
   203941 gggcgacact gtcgcacggt tcgaagtagt ccacccgcac tagtcaggag tagctgtcgg
   204001 ccgccgacga ggactcctgt cggtcctgac tccgccgcga cgccctcgtc gcggatgtcg
   204061 ccgccgagca cccgctccgc tgcgacgacc agcgtcgggc ccatgacggc agtttgagtc
   204121 tccggacacg aagcctcttc caccacggct gcctgacgcc ctcgctcaaa tccggacacg
   204181 acaccgccga ggcgtaggac gacatggacg acgagctcat gcccgagtcc gccgtccgcg
   204241 agcggctccg cagcgcgtgg ccctgccagt cgccgcagtc gcaccacacg tcgtgggcca
   204301 cgtgcacctg gtggcgccac tgcgcctcca cctgctcggg ccaggcgccg gagcccggcc
   204361 tcagctcggc cgagaccccc acgtactcta cgtgcgcctt ccagtccatg caggcgcacc
   204421 acaagtcgtg cgagtcgtcg gccacccgcc gccaggccag ttcgcgcatg gggaggctgg
   204481 agacggcgct cgacatgacc ggcatgccga cgaccggcgg gtgaccgcag tccgacgcca
   204541 tggtcgaccc ctcagcgtcg tcctccggtc cttcgtcgcg gcccaggagc gagcgcaact
   204601 cgtctccgcg gccctccgac cgcgaaatcc acgccccgcg ctgccgccag cagcacggaa
   204661 agcagcacgc gaagccgcgc cacgccagcc cgagccccta aagtcgcatg tccccacgcc
   204721 ccgactgagg gtgcgcccca cccggcctcg tttttctgct tacgggggtc gtctcggacg
   204781 tccccccaca agggccgtag ctttcaataa aatcaacgtg aaccacagac acttgtcccg
   204841 ttttccacac acgggggttt attcacaggg gaaggggaag actcagcaca taaaaaaccg
   204901 catccacttg agagacatct cgaggttcac cgtcacgtac acgataaaga tcaccagggc
   204961 ggtgacgctc aatgcgtaga acaggacggc caaagccacg tgccggtaag accggtggac
   205021 catcccgtac tgcatgttcc acatgtaggc attggaggtg tagtccaccc ggatctcggg
   205081 cacgcaggtc aaccacacta cgtccccgtt gaggaccagg cgcaccacca gtctctgaat
   205141 gagaggcagc acgttcgcgt actgcacgcg ccaaatcaaa ttctcgcccg cgatgaactc
   205201 tacatcctcg gcgcgcaccg ccaggttctc gcccacgccg ccgtagtcgg ccttcgggtc
   205261 gaagacaaag gtggtcaggt tgcccgacac actgccccta ccgaacatct gcccgttctc
   205321 tatgtggcat cggttctcgt cgatggtgaa ccagggccgg gtggccgtgg acttccaagg
   205381 cttgtagctg gtgatctcgg tatgagggtc cggaggcccg tccagggccg gcaggcggat
   205441 caggggaccc atcgaagccc agagtttcac cagtgacatc cacatcccgt tcatgatccc
   205501 gatccctcca cctccaaaca actccgtcgg gctctgggaa taacagcgtg gagtctgtac
   205561 gctgttttcc aagatatagc ctaagaccct gtgacgtgac taagcaccct cccattttct
   205621 ctaacttttc ctgatttttc cctcatacac ttataggttc tcccatccaa ccccccagtc
   205681 aagacacaga caccagggtt cgatttcacg aataaaccgg tttattgtga gtctctcgga
   205741 gagagttcaa gtcttctcag gatcagtgac ggatttccag cgtcctttca atagatatgt
   205801 cagttcaagt gtctcttagc agcaatagca ccgacagtct gtctctcggg aggcgcgaca
   205861 cctcaaaaga aacgcatatg gaggctcatg cccacggtca ggtaggccag catgaacatg
   205921 gacaggacgt agacgcacac ggttctcatg aacagacccc agttatcgtc ccgcatggcc
   205981 cgctggaagt accaaccgac ggtccagctg ctgtagtcca tctggacctg gggatcgcac
   206041 gaggcccatt tcttcggctc gccccagccg ctggacaata agacgtctac ggtatccacg
   206101 tcgaaaggca ccgcgatacc ttccacgttc cattcgaagt aggtctcggc cttctggctc
   206161 cactgcgact cggtcacttc caggttatct ctgtaggaac gggactggat gccgaactgc
   206221 acgaagtgtc ttttggtgaa attacccgag atcttccccc gaaagtacac tttacccatg
   206281 tgcagacgac attcgttctc ctccacgagg aagtgtgtag ggaggccggt cagctgctgc
   206341 gcgatgctga gaacgggccg gggaaaggcc tccgagaagc ccaggagcag ggcggccagg
   206401 gccgcgagca cgatcaccag cttcatggtc gtccggtctg actgtttctg gtcttccacc
   206461 ctccggtttg accactgcag gagctgtgtc tcgctcaaaa gcggcgtgga gactgaacgt
   206521 tgtttctgaa tatatacccc tgcttgtgac gttgatttcc cctacgtagg ggaaaagtga
   206581 cgtgccaaaa gaggcgtgtc gggactttcc agacggggat ttcacacggg actttccaac
   206641 ggggcgtggt gtagcgattg acgtgggcgg gggattgccc catcggtggc gtcaacgagc
   206701 gaggggaaaa acgcaagttc tcccgcggtt tataaacgta gagagtgacg cccgtggccc
   206761 gcccccgtga caggacgata gggcgacggg gcacgacagg ccccggctat cgcgacatgt
   206821 cggcgaccca cggtcgggtg gacgtgtcgc gacatggacg tgcaggggga tgttatgtcg
   206881 cgatagtgac gatacaacag ccccgtacac ctccccgtcg cgatacgtgc gggcggcggg
   206941 ctcctatcgc gcgatatcgc cgactgccgc cgactatcgc cgattatcgt cgagtatcgc
   207001 gacataaaac agacgcgggg agatgagcgt gctatcgcga cgcgtttttt attctcagga
   207061 gccgcaacgt cgggaactcc gctccagctg ctcgccgcgc acgccgcaca gcagcaccat
   207121 ggtgaagatc accgcgttga ccatgcagaa caggtagatg ctgacggcga tgagcccgtg
   207181 gcgttccacg aagcgaatga cgccccaggc gggtccttcg cagacgcagt tgctcatgag
   207241 caacagcagt cggtggctgg gccgcaggcc ggaggcgttg cagggcagga gacggctgac
   207301 ctgtcggcag ttgatgagtc cctccgggtg tcggtattcc tcctcttctc cctcccgagc
   207361 cttgttccca taagattcca gggccgtctg aatccagcgg gatgtgagcc gctcggcggc
   207421 atcgtcctcc ggttcctctc ctcccgtgcg gtcacagtct tccgtgccgt tacggcactc
   207481 cgagactccg atcctcttct tcggcacgca ggtttgccgc cgatgaaaca gggatagcag
   207541 gtcttcgggg ggcgcgtccc tcgggtcggc gcggccggcc gacaccgaga acagcgcgag
   207601 ccccagcagc ttcaaaagtc ctaggtaccg catggtcggt agccagggag agcggcggct
   207661 ggcggcgtgt gtgagtgacg gtgattatat acattttcta cggtgccgcc cagcgggtgg
   207721 tgccagcagt gacgtgggtg agaccaaggc agtgagcgtt ttcgtcacgt ttgtcatgcg
   207781 acgctagcgg aacatgataa gcctgacgag aaggttcgtg ttctttgaca gagccacggg
   207841 aacggtttta ttttttgttt tttcatgata tcgggagggg gcatcgcgag ggagatgacg
   207901 gcgagcccta cgcggaaagg cgaaggcttt cgccactcct atcttgaaag cgtgtcattc
   207961 tttatgatag gcgtgacgat gtctccgcct ctcccccgga cgacggctac agctcgcggt
   208021 cgaagccgtc gcccgacaga tagtcgaaga tgagcgcgag accgtacagg tagtagtcga
   208081 cgtagtatag ggcgtatctc atacacagac accacatgct cacaaagagc aggacgcgac
   208141 accacatggt accctataga cacactgata cagaatctga caatttattg gcatttagcg
   208201 gcgtaaaaca aggaattccg ccggacgctc ccggcgtatc tggccttgat gcccctccgc
   208261 aacatctcga ataccttgac ccagaacagc ggtgtggcgc agagcgctaa ggtgatcaga
   208321 taagcccaaa tcatcacgta gaagcaaagt gaaataaagc gtccctcgtg gctcagacgg
   208381 taactgtcgt attcgtaaaa cgagaattgg gggatccaag gtagctctac cgtaggggtg
   208441 caactatagt attcctgcga aaactttacg gggaagactc gcaagctgac gtggctaacc
   208501 gtgagagata cggggtgctt gatctcgacg ctgagagact gttccgttac cgtggcctta
   208561 tggggaatga actcgtacga tccgtcgctg tcggtcaata tgatctccga taaaatgctg
   208621 gggtaaaact gcccttcgag atgccagatg ccggtcatgt taccgccgta gatagtgcag
   208681 ctgacggtgt gggagagtat catgttgttt ttgggatacg gccgcataaa tttcttaaac
   208741 tcaagcctcc ccgcaatgag gtcagactcc caggcttcac tgttcatgaa atccagcgct
   208801 atctcacggc gactgagttt gcggcggcca tagccagtca ccgcggtgag gcagagaagg
   208861 aaaacgtgca gttgggtcca catatcggct accgttccta atacaaaata agcgattaag
   208921 ccgtaaattt aggcgtccgg aagccatagt ccgacgagag acgacaccga gacaccactt
   208981 tttttataaa ttacgtgtat tcacaagacg tataaaaaag cacagatata cacggactca
   209041 atacaaaggc ttgacagggt gacacttttg ggggacacag gcgtgatatc tcatgtaatg
   209101 ataacgggag agttcgtaca ccatcttggc gaagacgtac cccaacatca agacggccaa
   209161 gagttgcagt cccagcacaa accccaattc ccagtgacgg tactcgtagt gcaatctctg
   209221 caggttgtcc atagaagtcc catagttcag ataacgtatg tggtagcggg gttcgcacca
   209281 cagaggtttg cagcgcatac agggaatgat gttcaggatc agatagtcca gttcgggagg
   209341 cacccgttgg gtcagacgaa aggtagccga atcgcggctc acctcgcgcc ggggagcctc
   209401 cagatgaccc caccgtcggc cgcggtggcc ctgccagctg accctgccga gtaagccgtc
   209461 ttcggggaag aacgagcccc ggacgcgcca ttcggcctcc agtacaccgt ccctgacgac
   209521 gcagtccgct tcgtaagtgt ccaccttatt tctgtacaga aaggcgtgcc gctgcgagct
   209581 gaacccctca tagtcgtcct ccccgtagtc gtcttcggcg gcgcacaggg caccccaaac
   209641 gcacagcagt acggcgaagc accacacgag acagggtacc cccataagtc cagaatcacc
   209701 ggttcttttc tgtttcctcg tggggggtca cggtgaccgt cgccgctgcc gcggttatgc
   209761 gcccggcggg gtggcggcga cggtggcggc gggtccgggg gcgcacgtag cggaggtaaa
   209821 cacaacaggc taactggatg ccgaacgtga acaacgccac gtgtttcaga aactgcacca
   209881 acaccacata ggccaagagc acgtaacgct gctccacgaa caggcgctcc aggtccgagg
   209941 aggtcgtgcg cagcggcagc cacggcagcc ggagtaccgg ctggcagtgg agcgagctcc
   210001 ggttacaggt gctgcagggg taaacgttca acatcacgta agagatccga gcgtccactt
   210061 gcggcagctc tacctcgtag cgccgagtcc cgtcagtctc tatccggggc tcgtctacct
   210121 ggaagtggct ggcgctacgt tcgttccccc aggtaccgta gacccgggga aagggttcgg
   210181 agaagttgcc gcggacggcc cagacggcca ccagcgtccc gtgttgaacg taacattcgg
   210241 acacggagct ctgcacacgg taacgagaca cattgtcccc gaccgggtga gggtacgggg
   210301 gcagacggac agactgagag gagtagggtg aggacgtggg acaggtacga tcagacgcgg
   210361 actcgtctcc ggacacacga aaagacgtct cccgagaccg tcccgagagc acacttactg
   210421 cgatcacaca gcaatgccag ataagagact gcgactcctt cagctgcata gcgcggacgg
   210481 gccttctgtg gccggcgcgt ccgtaccgtg cccacttata gcgtttcaac gtgacgcgac
   210541 tatcacatga ggggactttc cgccgtcatg actgacgtgg gattgagcaa ggccactgac
   210601 gggggggacc tcgtacgtca gtgtgttcgt ctgtccccgt cagggcctac gcaggttctg
   210661 tcgccgcaac ctacgtttat atccacgtag cttataccac atgacctatc atacgatttc
   210721 ccggaatctt gtcacttacg ggaaagcaca ttacctcttg agtaaacaac gccagtgaca
   210781 tcatggaaca gttttattag cggccggtat ccacgcccgt cagcagcaat agagacctcg
   210841 tgatcacata ggaaccgcag aagatcccca catagacgcg gagcatggcc caatagtccc
   210901 cctgatacca catgtgcacc aagtccatca ccagtcccat caccgtcccg gaatcgtagg
   210961 ccgtggcggg gcacatgaac agttccccgc gtgggttggg ggacatctct agggacacgg
   211021 aacagttctg ttccgacagc ggtccgtggc gctcgtcccc tccctccgtc cagaccaccg
   211081 gcgtagggcc cagggtgtac gtcgcctcgg tggccgtcgc caggcccttg acggccacgg
   211141 gtcgtcggtc gtcgtcgccc aggtgcaaca gcgccacggc cttctgcgtc ccgggcgtga
   211201 acagtccgtg catctgcagc gtgcccgaca agacatgatt cttgatcaca cagctgcagg
   211261 tgaaatggct gacctcgttc gtcgctcgcg gcgacgacga tccttcctgc ctgtccgtcg
   211321 cgccgaggct cagcagccag gcgccgagga cgcagcggat catcctccag tcgcccatgg
   211381 tgtttttcgg aggcgccgcg ctcggtctcg tcctctgagg agtcccggac cgagaaacaa
   211441 tggttataag ctccgccatg tctctgtcac atgtggtccc agatgagcca cggcctatcg
   211501 tggtacggcc aagtctgcac gcacgttccc caaaacacct ggatcgccat cacacacatc
   211561 agcgtgtact gaaacgactt cacgaacatc acgtagtagg ccgtcaggcg ccggctctcg
   211621 tgcagcagcc ggcgcacatc gtgaaacgag ctccacaggg gcaaccaggg taccgcggcc
   211681 gcgggttcgc actccgtcca gtgcgcgtgg cagcggtaac agggctgaaa ataaaagaat
   211741 acgcgccgta ggtcgacacg cacgggataa ccgtacagcc agtagcgccg cacgctcgcg
   211801 gcggtgtccc cggagacgtc ctgcagcggg atgtcttcgc tgacaccgcc gtcgtaccga
   211861 tagtacgcct tcggtaccgg gcctttggcg gagaagttgc cgcggaggat ccacagggcc
   211921 tccagcttgc cgccgtggcg gatcacgcac tggacgccag agtgctccac tgcgtagccc
   211981 gagatgtccg gccagggagg aaagcccgga accgtgtccg tcgtcgtttt ttttgcggtc
   212041 cgggggaccg tctcgttcgc gtacggcagc gaccacgatc gcggacagac atcctccccc
   212101 cggaccgcgc tacacagggt gatccagagc agtcccagcc tcatcgtgcc ggacgtttcc
   212161 aatcttccct gtctgatccc gaaagctgct aggttctctt ataaccgtat gccctagctg
   212221 acgtgggtac tcggggccgt gtgccaagtg gcatgagagg gcgcggggcg catagagaaa
   212281 cgacacagga ttgagctcat cacagcgatc tttattaggg ctgtcgaaaa agcagccttt
   212341 gcgccgtgcg gttcaacgac tcggcgtagg tcgggaacca gaggtgcgag gttaggggca
   212401 ccaaggtcag cagaaacatg atcacctggt ccatgtacag gatggtggcg gtgcgcagca
   212461 gcccgccgtc cgcgtagtcg gtggccggcg gtaggtagag gatcatcagc gtgtcgcgga
   212521 tcatcaggac ctgaagggcg tagacgagcc cgacggtcac gcccatcacc acccgctggt
   212581 gcaccgccca aggctggatg gcgacgaaga gccacagcag cggtaccgcc aggctcagca
   212641 ggcccatgat ggccaggcgt cgcgacacgt gccacgccat caaccaggcc aggcccgtgg
   212701 cccacacgca catggccgac gagaccacgt aggcctggat gatgaggctc ttgtcgaaac
   212761 acaggcccac gacggccagg gggagggtgg tgagagcggt gtaaaccatg atcatcagca
   212821 gggagccggg ttttcggttg ttctgcatcc attgtccgta ctggcggagc atgcagggta
   212881 tcagcatgcc ccagacgggc agcgtatccc gcaggtagac cttttcgatc cgccagggta
   212941 ccagcatgca gaggatggtg gccaccaacg tggcgctgct catgaaggtg acgatgccgt
   213001 agaggcgcac gatccagaga aaatgctgga tgcccttcca cgtctgttca tcggaggggt
   213061 tgaagatcct ggggggcagc ggtatggtcg tcgtcgtgga cgcgggcgac gggggtgtcg
   213121 gtggactcga ggacggcgcg gtcttctccc cttcctctct ttcctctttt ttccgaggct
   213181 ctgaggattt atctttgccc agcggctcgc cctggtgaaa ctggatctgt accatggcgc
   213241 cgggcgagcc ggccgagcgg gccggagtag gtttcttcct ccgcgctcgg cggacggcaa
   213301 gttttatata gaggaggaga cgcggctcga cgcgctgggt gtggcgtggt gcggccgcag
   213361 cgaactgaag acgttggtcc agggcaggtg ccagaggttg gggctcagga cgatgagcgt
   213421 gatcttgaac atggtgatga ggcccacgta gatgagcagc gagccgcgga ccacgtcgga
   213481 ggcgggtagt tcgtcgcgaa tgtaacgcgt gccgtagaag gtgacggaca tcatgatgaa
   213541 gaggatggcg ccgtagccgt agaggataac gcgctggtgt cgaaagaccg tctggtcgcc
   213601 gatgacccag agcgtgatga agaagacgct ggtcagcacc cgcgagcaga tggtctccca
   213661 gcgacgggcc ttgaaggcgt cgcacgtcat gacggcgccg gtgcacgcca tccacagggt
   213721 gatgaccagc acatagtcgg tgaggatggc gggcagctcg gagcaccagg tgtagatgag
   213781 cgtgctgacc gacagcagcg ccacgtagca gccggcgatg accaggctgt tggggtggcg
   213841 gtcgccgcgc agcaggatga aacaccagag cagggtgggg acgaagacca gcagcatggg
   213901 agaggattcc ttctggcaga gattgtgggc ctcggggatg cccagccaga cggcgccgca
   213961 gaaggccgtg gtggcggcca cgtagaagat ggccagcgcg tagacgcgca tgtggacgcc
   214021 gaaacggcgc agccacatca cggtgcggtg tagtcgcagc agttcggccc agtctcgctg
   214081 cagggcgtcc atggcaccca agagtgagga gaagagcgag tcgcgagcgt gtctggagcg
   214141 cggtgcgacc aagagtctta taaggcagag acgcgggtgg gcgccggctc gggccgtgct
   214201 atctaccggg tgtcgccgaa accgacggtg acacgacggc gctcagggtg gcgttagacc
   214261 ggtggccgga caggtaactg aacatgaggt cccagcgcgc cgaccacatc acgggcgtca
   214321 ggaccagcag ggtggtgtgg tagatgagca tctccgtgga gtagagcagc agggagccgc
   214381 ggatggcttg gtcgacgggc agttcggtgg caacgtgccg cacgtcctga aagaggacgg
   214441 ccaggatgca gcccacgaag accgtgtaga ggcacagcag catcttgtgc atcagctggt
   214501 aggaggaggc caggatgccc atcaccacgg tgagcagcgt ggtggtgaag agcgcatcgc
   214561 gccagagagc gcgcaggcgg tgctcccagg ccacgccgtt gcaggccacg aacagcgccc
   214621 aggtgagaat ggcgctagag acggcgtggg tgacggtgct gcagaagttg atgacggcgg
   214681 cgctgaagga gaggaaggcc acgtagaggc ctaagaccag ggcgttgctg ggatgcttgt
   214741 agtcggtgcc ctccaagatg cccagcacca gcaccggggt gcagctgagc agcaggggcg
   214801 aggggtcctc ctggcaccgg tacgagagct gcgggtagcc cagccagacc agcgtgctga
   214861 agagcaccgt gatggccgtc tccagcagca gcagtccgta gacgcggaag accacgacgt
   214921 tgcgttgcag ccagaagacc gcgtcgtctg tctgggcttc ggtcagcgcc gccgtctcct
   214981 cttcctcctc tcccccctcc cgctcgccgc cgtcctcttc accgccgtcg ggcgccgggc
   215041 gcggcgacgg cggttccatg ctgtttgctg cccggcgaga gcctatccgc gagttctcag
   215101 gactcgctca cgggaaagta ggtttgcaaa aaggtgcgga gcgtgaggat tcttaatacc
   215161 atgagcaggc taaagaccag gttgaggaag actttggcgg cggccagggg ggtgcgagcc
   215221 agcggcgtct cgtaacgcac cgccagagcc gtctcgtgaa agtgcgacag ggccaggcag
   215281 gcgattagga cgctgatgcc cgagatgact tttaagtacc acgagccttc gcggagcgag
   215341 atgacgatca gggccgccac gaaggccagc gtcaccagga cgtggaccag cacgatctgc
   215401 cgcctgatgt cgtggtcacg cgccagcagc gccagcccgg tgaaggtagc gaagcccgtc
   215461 agggtgaaga gcgaggccgc caacagctgg aagggcgaga tgcagaggca ggccaccgcc
   215521 agcggcggca ggttgatgag cgtgtagaag agcagcaccg acaccttggg tgggtgggac
   215581 ttctcggcgc agtagaggca gaggacggcc aggaagggca ccaggaaggt gaggctgggc
   215641 gagccctccg tgaagcagag ccgcgggtgc tggcgccagg ccgagggagc cacgaaggcg
   215701 aaggccagga gcagggacaa cgtgccggcc acctggaaga cgaccgcccc gtaggtgtac
   215761 acggtcacgc gaaactggta cacccaggcc agggaccgcg ccgtcaaccg ggctcggagc
   215821 ctgggaggga gatacacggc cgtcttgtcg gtgaggacgg ggctccgcat ggtcgcggcg
   215881 ggagcagcga aagcgcgacc agaacgccgt accgcctcct atataccgag aaggcgatca
   215941 cagagagatg ctaagcggca gcaaggagcc cgacgacgcg ttgccgctga agggcgcgaa
   216001 cgtcaccatg acgggcagcg aggagccgga ggaaaaggac ggcagcgata acaggctctg
   216061 gatgagatcg gtacaggttc tgaccctcag caggatgaag aagatgaaga ctacgctgct
   216121 gaacatctgt accgacgtcc atcccgcgtc ccgcggcatg gtgaggtagc gcaccatgag
   216181 gacctgctgc gagaggtggc cggcgaagat gatgcccatg gtggtgtaga agcccaccag
   216241 caagcgcagg gcccagggcc agtcgcgggt aaagacgatg aggaggtcga cgaggaagac
   216301 cgcgaaccac acggtgttga tgagcatgaa ctggttgagc gcggcgcgga ggccgcggca
   216361 gaggaaggcc acctgggcgc acaggaaggt gaccaccagc gccaggacga aggcgctgag
   216421 caccggcgcg gggtcctcct ggcacacgca gacgaggcct acgagcggga ggtggacgag
   216481 gaggccgccg agtagtagcg ccagctcgtg gagcggacga cgttggcggg ggtgatgtcg
   216541 ggaaagaggc cgctcgtagc gccagtagat ccagcacgcg ctggccaggc agagcagaag
   216601 ggctgcctcg ggcgtccacg ggactccgca agggaaaccc ggatacgctc gcagcacctt
   216661 cgcggggaag accagagcga agccgcccag ggcagatacc gcgaacgcga tctggaagag
   216721 caggaggccg acgacgcgtg agaggacctc gaatcgctcg agccagcaca gtgcagcggc
   216781 cagggacgct tcatatcgct cctgttcctc gtcgctctcg ctcgacggag acagcagcag
   216841 tcgacggtag gcgggcgcgc cgacgccggg aaagcgaaga ctccgcatct ccgcggtggt
   216901 cgcggcgacg ttataggcac gaacgccctc cgaacgtctc tggcggcccg gattggcgga
   216961 gaggggatga ggcgacgggc tcaggatatg gtttatttcc cccctcccgt gatcacgcca
   217021 ggagccgcgt caggttacgc cggatggcgc gcaggaggtc gcagcccgcg gcggacgact
   217081 gttccaggcc cgtggagcgg gacatccagg ccatccaggc caccagcttg tcgtgcgagt
   217141 cctgcgtggt gaagaggatg agcagcagca ggtagagata ggcgaagttc tcgtagagac
   217201 acagcgccag caggtcggcc tcccgccacg agacgtcgaa gagacgggag gtgtcgaagg
   217261 ccgtcacggc caacataaag cccagcgccg tgacgtagta gcccaggaac agtcggccgc
   217321 ccagcgacat gggttggacg tagatgccca tgagcagtac ggccaccgac agtaagtaca
   217381 gcgatacgat gacctgccaa cgacgacggt ccatgccgcc caggcaggcc acggcggtgc
   217441 agatcgcgaa gaggatgcag gccagcaccc ccgcgcccac caccatgacg gacgaggagc
   217501 aggcgctggc caccaccacc gacagggtgg tgaccacgct gtagatcgtc agcacggtgg
   217561 cggacggcgg ccggtcctcg tacttgctgt gtaacacggc caggcacacc gtgggcaccg
   217621 ccaggctgag cggcggcatg aagccggtgc agcacaggaa cacggtgctc tccaggtgcg
   217681 ggaaggccag caccatgccc agacacagca ggaacgtgca ggtggcctgc atggccacgg
   217741 tgctgtagac ccgcgtgcag accaggaagc ggtgcacgtc gctcgccgtc atggcggaga
   217801 tcatcaggac cccgggtccg ccccggacca gcaggggcgt ctcggccgcc atctcctcgg
   217861 cgtggtcggg gggcatggcg ggatccgggg gtttccacgg gcgctcatgt ttttcctttc
   217921 tggaaaccgt ttatacactg tgccgtcccg gccccccgcc cggccacgga cgcagacacc
   217981 acagacgcgg gtggagagcg ggtccacaac acatcatata catttttatt aaaagcgagt
   218041 gaaaagtaag ggtacgagtg tgtcgtctct cggggggggg ggggggttgt tcggttctca
   218101 atgcaatctc aggacgtcta gccaggtgat ttggccgtgg tggtccttgg cgtactgctg
   218161 cagccacagg tgaccgctga agatggccac gctcatgttg agcatgcaca tagcgatggc
   218221 gtacatgatg acgctgatga agaccccgtt cttgggcggc ggcggcgtcc gcaggtagat
   218281 gaggtccacc gtctcgaagc acagcgaggc ggcggcgccg gtgacgatga gggcgtagag
   218341 cccgctgtag atcttgctga cccagatcac gggcgaaaag tacagcagca ggtagtaggt
   218401 gacgacgacc caggcgtagc aggtgccgat gagcttccaa cgggtgttgt tgagaccgcc
   218461 caggtaggac aggccggtgc agaggacgaa gaagagcacg gtgagggcga aggccaggcc
   218521 tatgacgctc ctctcaccgc agaaacccgt ggccacggtg gtgccggtgt tcatcaccag
   218581 gcaggccacc gtgagccagg cgtgccgcgt gaagcgcggg cggtactcgg ccacgccgcg
   218641 cagcatggcc agcgacagcg gcggcaccac ggaggacatg gccggcacca cgccgtgggc
   218701 gcagtggccc cggacgtcgg gaaaggcgaa ccaggccagc aggcagaccg tgaaggtgca
   218761 ggagagctgc caggcgaggc cgtggtagac cccgaccagc atcctgaagc gcgtcagcca
   218821 gtgaaagagg tacggttcgg ccgccagcgc gcggcggtaa gcggccacgg ccggcggcgc
   218881 ctcgtccctc tccaccgtct cccggtaaga gggcggcggc gaaggcggag gagacggcgg
   218941 cggcggcggg cgagaagcgg cgtcgggacg gtcccccatg ctgcgttcgc gggctcggtc
   219001 taagatgggc gcggaaaaca gtccgtctta tcggcgtcgg ggtgccgacg tgcgttcttg
   219061 acgtcatgtc agcggcgaaa ccgaacgagt cccgccgcgc tcgcccacta gctccagccc
   219121 gaggccgccc gccagggtct cgactgcgtc agcaggctgt agatgctcat gaacaaagcc
   219181 acattttcca catacagtcg gatggcggtc ggaaaactct ccgggaaaga actccgaaag
   219241 atggtcaggg acaggtcgtg gatcaccgcc acggacaggc acgccacggc gcccaggtgc
   219301 atgagcagcg agacctgttc gggcatcgtc accagccaca tgagcagcgc cgtagcgcag
   219361 agcagagaca ggcagggtac cagcaggcgc cgcagcgtgt tccagtggcg gctgagcccc
   219421 aggcccatga tggcggtcgc caggcagcag agttgcagga cccaggtcag cagcgccggg
   219481 tagagcaggg cccgcagggg ctggcacatg agcgggccca tgaaggccag cgtgttgggc
   219541 aggcagtagc ccaacatgag tatcagcttg tccttgtagg ccgccagctg cacgccgtga
   219601 agcgcgaaga gacaggcgac gggcacgacg aggccgagta gctgccagag ggccgtatcc
   219661 cagcgctcgc acagctcggt cagctgcggc acgagcgacc atagcagcgc gctgagcagc
   219721 acggtgacgg tcagctggaa gttgacgatg accgccacgc gcagccagac cgcgaagcgc
   219781 tccagatacg gggccagctc ctcgagggtc cattccaagg gcaggttatg gagcatgcta
   219841 gaagcagtct ttttctgctc cctccgaacg cgtctcggcg gagtgaccat cgaaacagcc
   219901 ccggggggcc cgcgcggacg gagcattttt atagggattg tgacgtgcgc ggagggaccg
   219961 cgccgtcgcg ggaccagtct gtgtctctgt cgcctacgtc gcctttgcga cagcggtgga
   220021 tctcgccgtg gcgttacccg cctccaggcc ctccgagacc cggatccagt gcgggcccga
   220081 gagcatgagg atcagcatga ggaacagggc catcacgtcc aggtacagac agatggcgta
   220141 tcggatacat cggtgcggct gacaataaaa gatcaccgat aacgtgtcgt aggccaggat
   220201 gcccaggaaa aagctgatgg agaaggcgct cagcgtcatg atcagcttct gcatccagtt
   220261 ctcgtggccc gacagcgcca acgccaggaa ggacagcacc agcagcgcgt acacgcagct
   220321 gatgcaccgc cagcggtacg ggtcgcgtcc gcccagaaag gccaggcccg tgaaggtgat
   220381 gaacagcgcc acggtcatca cgtaggcgcc caccagcgcg cggctctccg agcacatctg
   220441 gaagatggcc gccgtcaggc tgttggccag caggtagatg aacatcaccg tcacgttgct
   220501 ggggtgctcg ttgcccagcg tataggccac gaacatgcac acgatgggga ccagcacggt
   220561 caggaagaac gagtagttct ccacgcaaaa attgcgattc tgcgggaagc ccagccagaa
   220621 gacgctgccc aggccgaagg tgaaggccag ctgaaagacg agcacggcgt acacccgcag
   220681 ccacacggtg aacctcttga accactccag ggcttccacc cgggagagca gcagcgtggt
   220741 ggcctcctgg tgctgcatgg cgccggcgag atccaccgca ctccgctgag cgtaccggcg
   220801 acggcttatg aaaacagccg tccgaacgcg ctaactctta tacacaagcg cgcgagttcc
   220861 cgacgatgac gtcgcgacgc ggaccgtcgt cgccgtcgtc tcggcacgtt actacgacac
   220921 gaaattctgc gtcgcgcccg tcgtcggtcg gtttacgggc atgaagtaca gcacggagac
   220981 gaacaggtac atcagatcca tgtacagata cagggcgccc tggatgtagc tctcgtactc
   221041 gatatcgtgc aggatgtcct gcgtgtcgca caccacggag gtcacgatca ccgccagccc
   221101 ggccaccatc accacgatct cgcccacctc ctcgggaaac agggagaaca ccaggaacag
   221161 cagcaggatc agcgccgacg cggccgtcag cagggagcgc tgcagctcca cgtcgcgggc
   221221 gaacgtgtag gtggccagcg tcaggaagca gaacagcacc accgtggcga tcatggcgta
   221281 gatgaccgag cggtggctga agtggaagcc cgacgccgtc accgccacgc tggtcagcag
   221341 cgtgtaggtc agcaggagcc acacgttctt gggaaagttg ggctcggccc agcgcagcag
   221401 ccccaggcac acgatggaga tcatcaggca ggacagcgtc agtcgcacgc tgggaaacag
   221461 gtgttccagc ttgtgaggga acaccagcca gcagaagccg cacacgctca tcaggatcag
   221521 gctctgcacc cacatcaaga tgtagatgcg tagcagaaac accgagcggg ccacctgcac
   221581 ctggccgcgc agcgacatgg tcccgccgcg cctcccccct ttctcaccct ccgtacccac
   221641 gtcccgtcta aatacattga cgacgaatga gacacgcgac acacagaccg gacactcacg
   221701 tgacgtgttc caagctagca aagcggtgta ggttttatta aaaaaagtta cccggagtcg
   221761 tcccccctcc ctccctctct tcagtcgtcc atctcgttgg acatctgatc gggctcgggg
   221821 atgaccacct gttttagggt atgcccgcaa tcgtgcatgg ccttagctcg ccgcccgcgg
   221881 tgtagccagg cctctctttc ggtggtcggg aggcactccg actggtacac cggcggcccg
   221941 ccacccgcgt cgtctccctc cccgtccccc tcctcctcac ggcccagctg ggaggacggg
   222001 atctccgttt catcgtcttc ctcggcgggc atgggctccg tcggcggggc gggcgtgtct
   222061 ccctcgtcgc gcggcgcgtc ctcgaccccc tcctcgttgt cgctggggta gggcgtgtgg
   222121 ggcggattgc cggcgcgcgg cgccaccctt cggggctgcc gcggcgcctc gtcctcgtcg
   222181 ctgctcagct gacacgacag ctccacgccg cactcgttgt agggcatgtg cggcgtgggc
   222241 gggaagcact tggccacgcg aaagcagcgc tggccctcca ccgcctgcgt ggtctcgtcg
   222301 ttgtcctccc acagcccgcc ctgcagcgcc ggcagcgtct cgaggcgctg cgccgggaag
   222361 aatgagctct gatgatggtc ctgcagcgcc cccgtggcca gcaggtccgt gcggccccac
   222421 gccacgttgt tattaggcac cttgtcctga ccgcggctgg gccgcaggaa ccagtcgagc
   222481 gcgctctcca gctgcgcgcg cgtgatggtg cccagagccc cgtgccagcg tagcatgttc
   222541 tttttcagcg tgtggtggca cacgggcagc tcctccaggc gacactcgcc gcgcagcccg
   222601 cggtcgaagc ggcacaggcc gcgcgtcttg agcaggccgc acttgagaaa catgtgaaag
   222661 ttgtccgcca gccggtacag gtccgagtcc tcgatcttga ggaagtagac cacgccgaac
   222721 tggtccaaca gcaccacgcc gctgggcacg aagggtccat aggccaggta gtagcccatc
   222781 atgcccacca cgtaccactc gcagcagagg cgctggcgga tgaaaacgcg cagctcgcgg
   222841 aactccgcgg ccgacatgtg atcgaagggc cggcaggcgc gcagcgcctc cacgctgccc
   222901 agcatgagca gcggctcgac ctcggtgcgg ccgggcgtgc ggatcaccag gttgaggccg
   222961 ctcatctcgc gcgccgtctg ggctacggcc acggcgtcgg tggggtcggc gcagaggaac
   223021 ttctgcacgt ggtagcgcgg ctcggtggtg gaaaacggcg tctgcgggtg gcgatacacg
   223081 tactcgcacc acagcaggcc gttcttggcg aagaccttga ggtcgctggc tacctcgtac
   223141 agcccgtccg tctcccagtc gtagacgtag acggtgccgt gcttacccat catcagcacg
   223201 cagggcacct cctgcgccca cttggtatgg cggtgggggt cgtcgtccgc cggtcgcacg
   223261 gccagcacgc cgacggcctc caggtcatcg tcacagcaca gatactcgga ggccagcgaa
   223321 cgtgcgtaga tctgcgggat ggcggccgtc tcgcgcagca ccaggagcca gttggccggg
   223381 ttacgcaggg ccaccgtggt gccccggtgc tggcgtacgt agctccgcag cgcgtcgggg
   223441 tcgtattgac gcaggtagag cccctgcagc agcgagagcg tgcgctggta gatggtgttg
   223501 cgaaactgaa agacaccata gtcgcagcgg atggcgtcct cgcagcgctc gtcgcgctgc
   223561 cgcagatagg tgccccaggc ctcggcggcg gccttggtca gcagcgacat cgcggcgccc
   223621 cgacgcgggc cgtgtggcgc cccggcgcgg cgtcaaagct taatataggg agcggtccct
   223681 ctcgagtctg ggccgccgcg ccggcgtcac ggcccgggag gtggggcgga tcggcgactt
   223741 ctcacacaaa gtgttcccga aagtcgaagc tcttgaccca ctccggagat aaatccgtat
   223801 tcaggtgaat acggcgcgcc tccacctcgg cctccgagac ctcggcctcc gtctggtagg
   223861 cgtccacgat gcgcctgccc agctgccagc gctgcgcctc ggcctcgcgc cgctgctgga
   223921 accactcgtc cacgtccttg aggtcgaaca cggtgtcctc ctcgaggtcg aagcccaaat
   223981 cctcccactc gtcgtcctcg ctgtcggcgc cgttaccgcc gtgggccgcc agacgacggg
   224041 cctgcgccgc cgccaccgcg ggcgcctgct gtccctgcgg ctgctgctgc ggctgtccct
   224101 cgggtaccac gttgtcgggc tccataggct cttcctcgtc ttcatcgtcc gcctcctcgt
   224161 cctccacctc ctccagatgg ccgtacactt cgatgtagcg gtcgttgtca ggcaccacgt
   224221 gattgtcctc ctcctgcggc agcggcgggc ccggcggtcg gggcgggcgc cgtcgcccct
   224281 gggactcttc gtcaccctcc tcgtcctccg gcgggcgcgc gcgccggcgg tcgccgaact
   224341 cgccgcgcat cacgcgcgtc tgccacatgg tgaaggcgtc ccagccgtcc caggtgttga
   224401 gcatctcggc ccgaaagcgg tcgccgcgac agagccagcg gtactgacgc ccgtagtcgc
   224461 ggtccacacc gctgtcgaac atggtgaaat gcaggcgcgc gccctcaccc aggtgcacgc
   224521 agggtccgtt gcgctccagc cgagccgagc gccgcagccc gtgctcgtag cgtcgccgca
   224581 cgtagacctt catgaggccg gcccggaaca gctcgtgtag atcgtcggcc agccggtaca
   224641 cctcgccggc caggcgctgc gtggtgggcg agcggtccag gtgcgtcttg acgatgaccg
   224701 tgtagaagcg gcagaagcgg tcgaagatca agagtgagga gacgtcgaag aagccgccgg
   224761 gccggtaggc acccacggcg cccagcagga accagcggca gcgcagccgc aggctgaggt
   224821 acatttcgca ctcggccagg cggcagggcg ccgccacctc gaagggccag cactcggaca
   224881 ggcagccgaa gttggtcagc agcttcagcg tcttggcgtg gcgcccgggc gtgtggaagt
   224941 tcacgtcccg cccgtggtgc tcgccgacgc aggcggccag cgcgtcgggg ctccggcagt
   225001 tgtgcagcag cgcccgcacc acgtcgtgcg ggacgcgcgt ggcgtagggc gtctgcggct
   225061 ggcggtagat ggactcggtg tagagcaggc cgtagcgcgc cagctcgtcc aggtgcttgg
   225121 cgcacagcag cagaatctcc tgcgagggct cgtagatgta caggcgcgtg ctgccgccca
   225181 tacagagcac cagctccgtc tcctcgtagc ggtcgcccac cagcaccacg cacttgccca
   225241 gcacgatgag ccgctcggcg cagcagatca cgtcgtccaa caactggtcg cgtagctcgg
   225301 gcatgctgct gcccgggcgc acctgcagga accagttgtg cgggatgccg agcgacagca
   225361 cctggtcgac gtggttgcgg acccagtcgc gcaccacctc ggcgctgtgc tgccgctcga
   225421 agatggcctt gaagtcgccc atgacccgta ggaaggtttc gtagcgcgta tggcagtaga
   225481 ggaactcatc gtgtcgcgtg aaggtgggcg ccccctcttc ccagcgcgtt cgccacatgc
   225541 cgccgccaac ccgagcgccg gagaaggagg agaaacaaga agaatcactc gagacacggc
   225601 tcagaaccca gcgactcttt attccgcgtc cctcgcaccc ggctcaaatc tggatgtact
   225661 ctcgcacgcc cgtcaggctc tttaaaggaa aagggtccga gtacgtcacc agtcgcgact
   225721 gctgcaccag cgcgctgatc acccgctcgg cgccgtcgcg cgtcgacgaa cgcgtcgtca
   225781 ccaggcagtg cagacgggga cccgtgtcgt cctggcgctc ggcggcctcg cgctcggccg
   225841 cctgcagccc cacgatgtcg ggatccacca cgtaggtctg cgaattggtg tcgtagcggt
   225901 gcagcaccaa ggcgttgggg tccaggcgct cccaggcgcc ctcgtgcgga tcgaagcgct
   225961 ccgttaaaca gagccactcg tagtgctgtt gcagcacgcg ccgctcgcgc tcgcgccgct
   226021 cgtcagggtg ccaggcgtcc tcgttgaaga ggatgtcgcg cttgtggtcc acggcgcgct
   226081 cgtggtggtg cgggcacagg tgccggtgct ccatgcgcgt ctggcgctgc cgctcgcgct
   226141 cgaagcgccg gtgacggaac accatcttta acagccccat gcggaaaaac tccgtcacgc
   226201 tgttggccac gcgccgcacg tagtggttgg ggtcgtccat ctggatggcg tacacggcgc
   226261 cgaaccagtc cagcagcacc agcacctcgg ccacgaaggc gcgccccggc cgcggccggc
   226321 ccgtcacgcc caacagatac cacggcgtgc acaggttggc gcggatgccc caccaccagc
   226381 ggcggcactc ggcgtcgttc agcgcgcaga agggccagac gcactgcagc tgctgcacgg
   226441 tcttcatcag ccgcataatc accgtgccgt agcccggcgt gtgcagcttc acgtcgcagt
   226501 tcaggatgcg ctcggccgtg gcgtacgagc cctcgggcgt ggtgtcgttg aggaacaaga
   226561 tgtgcatggt gcgcgcgccc cgcgggtagc gccgcgggag cggcggctga cgccgccgca
   226621 gggccgtgtg caccacgtca cgataggcga tctccgagcg cgacacgccg tagcgcgcca
   226681 gctcgtccag gttgtgggcc accagcacca ggtactggtc gcgggtgtcg taggcgtaga
   226741 tgcgcgaata gcggccctga aacaccacgt agggcgtgga gatgacgctg tcgtcacgat
   226801 cgcgccgcgg atcgggcagc aggatcacgg cgtagcccag cggcgtcagg ggctcgccgc
   226861 agcacaccag cttgctcgcg gccttcttgg cgctgacgat gatctcgtcc tctaggcgca
   226921 acgtcacgtg ccagcccttc ggcggaccca gacacaggca gcgtccctcg ttgcgctgca
   226981 cgaaacgggt gatctccagg ggatccaggc acatgaacag gtccttgaag tcccgtagga
   227041 cctgacggta cagcgccatg gggtcctcgc ccgccgccgc gccgggcagg cccatcaggg
   227101 cgtccagcga gggcagctgc gggggcacca cggcggccag cgcggcctcc gcggccccct
   227161 ccgcgccggg ccccccggcg aaatccatgg cggcgccgcc cgcagagacc cccgcgccga
   227221 gccaaataca gacaccggac accaaacccc gacgctgacg tggaaacgcg cctcggtctg
   227281 agaaccggcc tagcgttcgg accgcagtcg agacagatga cggtccgagc cactgagcgg
   227341 ttcccagccc tggcgcagcg ctcgaaagca ctcgcaagtc gtcgccgcca ccctctccga
   227401 gcctcttctc ccgcctccgc cgcccttccc agcccagttt atagcctcgc gccccccatt
   227461 ccactcgtcg ccaggggggc caatcggacc gtcggagatt cccaagtgga tgacgacctc
   227521 ccaggtcacg tcggtcatcc tctgagaaac accgctaccc gaaagacccc acgttccccg
   227581 tcgcccagac cgtcgacggc gctaccgccg ctgcgcttga cgtccgtcgt cctcggcgac
   227641 cgttcccatc tgacaccccc acaacgacgc ccgcccggat tttaaaaacc gcacattccg
   227701 gccgtatcat ccacagaaaa aaacatcaaa tcgcgtctgt ctttattgcc aacacacgcc
   227761 gtttaggtcc aaagattttt tgtccggcga atcatatcca gaacggcagg taggaggacg
   227821 gatgaggcat ggcaggcttg ggcgccggtc ggccctccaa cacggcggcc cgagcggcac
   227881 gcctggtcag gacccgcctg tacgcgggac tgatgtcctc ctcgaccttt ttgttttttc
   227941 ccgtagtctt ctcggcctct gtgccgcttc ccccctcgga cttggtccgc tgcttctggt
   228001 tctcttcctc gtcggaggag tcgcccccgt tctccgcctc gggtttctcg tcctcgtccg
   228061 agtagtacac acagagtccc tggctcacca gactgggatt catgaggtcc cgacgcggga
   228121 tgcgctgttg caaacgcttc acggcgcgtt ccagacgtga ggtcataccg taccacatgg
   228181 tgtacctgcg ggaaggcccg taccgctgcg tctgctcgcg cacgtgatcg ttgagctgct
   228241 gccagtactg cttggcgcac tcgagatcgg agatctgagg gtaatcgggg cgcacgcgcg
   228301 ggtcccagct cacgtccgag gcgccggaaa cctcgtccag gctgttgcgc gcgtagcagc
   228361 cgtcggtcct ggagtagaac cggtcgcggc gcaccaacca cttgtagcgc tgttcgtggt
   228421 gacgctggaa ggaacgcacg cgttccacgg ccccgaagcg atcccagaag ggaaagttct
   228481 catgcggaca acgcccgggc atctccagac gctcggcgtc ctccacggcg aagtggaaac
   228541 gccggccggc ctggtagatt ttcatgagac ccacggtgaa gagcatgtcg atgtcgttgg
   228601 ccagacgcca catttcgcga cgaaacacgt cgaagtagaa gatgacgcag ccccggtcag
   228661 ccagcagcac gaactcggcg tgaaagaggc cggagggtag cgactcgccc accacgccca
   228721 gcaccatagc ctcgcagcac agacagtcca cgaagaactt gagcaggttg tggaactgtg
   228781 gggtctccat gcagatgaac ggccagacgc ccttgaggtt gtcggcgtgc ccgcagagca
   228841 tgaggggccg cgtcatctca cccggagtac gcaagggaat acattcgccg cgatagcgac
   228901 aagccacccg ctgcagttcg ttgatgttgt ggtcgtgcag ccgcaggtcg cagatcatgt
   228961 tgtcgggctg cgtggtgagc agcggcgtgc gcatcttgtc ggcgtagatg acctccaggt
   229021 gcaacaggcc gtgacgtgcg aaatcgtcga ggctgtgagc caggtagtag agagtctgtt
   229081 gctcgcggtc caaacaccac atggtttcgt aacgtcccag caggagcacc agccgggccc
   229141 ggctggggga ctcgatctcc tccacgtaga gaaagaaatc ctcgtcctcg gagtcctcct
   229201 cgtccgagga ggtgcgcggg cggcgcagga ccggcagcac ggagctagag tactgcagca
   229261 cccctagggg ctcgagggac tcctcgcagc agatgagccg tccccagggc gagtcgggcc
   229321 cgtcgatgac ggccgactcg ccgaaaatgt cttgaaactc cacgaaatcc aaccgccaac
   229381 cgttgggcgc ggggataggc aggctgatgt tcatgtcggc atagctacga accagctgtc
   229441 ggacctcctg tcgcgagtct tggcacgtga agatcttgcg cagaccccgc agagtccggc
   229501 gcacgacggc gccggaggcg tagcgatagg actggcgcat gtcgacggtg cgcggagcga
   229561 ctgttggcag gctattttat ggactcgtgc cagtgacgtc gcttgtacac gtcgttcgtg
   229621 gcccaaagac acgggtggcg ggtacgggga cacggcgtat aaggttctca cggtctgaaa
   229681 atcacctgaa cctacgtgac ccatacctgc gtcagagact cacgagagta accgagtctt
   229741 gcgacagcta cgatggtcac agcagaagcc ggtcgcaccg gccgcaatga acgtcagccg
   229801 agttacgtca aaaatgacgc ggtttctgtg tgagcacata gacggtattg agatacaggt
   229861 gagtggaaag ggacggggaa agtgtactgg gaacctgggt gcttgtgaga actaaacaca
   229921 gtacgggact ttttcaggaa aatttagcgc accatgtcca acaacaccac cagccgcatt
   229981 ccgccgaaga tctacaacac tacattgtat cagctgtacg attataccag aacgtgggta
   230041 tgggtcatag gattcatggg gattttgttg aatttatgtg tgattctcac catcgtaatc
   230101 aaacgtcgaa aaaagaagtc tcctagcgac gtctatcttt gcaacatcgc tttagcggac
   230161 ttggcgctcg tgtttattct gcctaccata ctcgaatatg tgcacaatca taaggacacc
   230221 gcacatcatg tggcttgtta tgctatgaat gcttgttttt acatatgtct tttcgcaaat
   230281 gtatgctttt ggactaactt gtttatggac cgctactccg ctatcgtgtg gggtgtacaa
   230341 ctcaatagca tccgaaatcg ccgtcgctct atgtggtgga gccttatgtt ctggctcttt
   230401 gccctgataa tggcatctcc tcactacgct ctgaaacaaa gaagcgacag tgaatgtgta
   230461 ggagactaca gtcatgacct aactaaggtc gttttccctg tgtttatcaa tttcaaagtg
   230521 aatatcctcg gttttctagt tcccatcatc gttatgtcgc tcgcttatca caatatggtc
   230581 cgttttgtga ttaactacgt aggtagatgg aacttacaga ctcttgatgt actcctggtg
   230641 attgtggtat ctttcggctg cttctggttt cccttcaatt tggcactgtt tctggagtct
   230701 attgaactaa tgtggagcag tacctctagg tttttaggag gtgctatcga gctttgtctc
   230761 cacctaggcc attttttcgt gtattttcgc gcctgcttta acccactgat ctatatcatc
   230821 gtgggcaaac agatgtctaa ggacatgtgt gataccttta gatctatgtg cttatgttgt
   230881 tatccccgaa cggtgcccta ccaggacatc gacctcgagg tgaaaaaaga ctttcagaga
   230941 cggctcaaag atagcaaaaa ggcctcctat cacggtaaga acgataaggt cccggtggaa
   231001 gacacagaat tcctgctgta atctgattcc gtctcaataa acagatctct atttttgcac
   231061 agcgcatgtc tatgcctctc gttctttccc gagggggtca gacggggacg tcattttagt
   231121 ggcgcgcttt tcactcataa atagtaaaac ctcccgaatc tcagtctctc gaagcgtggt
   231181 tctgccagcg tccatgcctc gggagctcga agggtgctat catgacgcca gcgggtgcgc
   231241 tgacaacgga gttcgaatac gatacagcgg ctgaggcttg taacctcacc gacgtacttc
   231301 atcagtctag gcccgttacg ctgttattct acggtctcat cttcatcttc ggctgtgtcg
   231361 gcaatctcct ggttatcttt accatcactt ggaggcgaca gatccgctgc tccggcgatg
   231421 tctacttcgt caatctggct ctggccgacc tcatgttcgt ctgtaccttg ccgctgtgga
   231481 tgcaatacct cctcaatcac gactcgctgg cgagtgtgcc ttgtaccgtt ctcaccgcat
   231541 gtttctacgt cgccatgttt gccagcctct gcttcatcac cgagatcgct ttggatcgct
   231601 actacgccat cgtctacatg aagtaccgcc cggtgaaaca ggccgtcttc gccagcgtct
   231661 tctggtggct cttcgccttc attatcgcca ttccgcactt tatggtggtc accaagaaac
   231721 aaaaccagtg tatgaacgac tacgagcagc tggagcgcag ctaccccatc atccttaaga
   231781 ccgagatcat cttaggtgcc tttgtcatcc ccctcagcgt catcagctac tgtcactacc
   231841 aaatctccaa ggtggtggct ggttcccagt cacgacacaa aacccacgtc atgcgagtct
   231901 tgctcgccgt ggtctgcgtc ttcatcctct tctggatgcc ttaccatctg gccttgttcg
   231961 tcgacgtcct ccggctcctt cactggattc cggactcctg cgagttcaca aaatccctgc
   232021 agaagacgct cattctcacg gagtccgtgg ctttctgcca ctgctgtttc aaccccctcc
   232081 tctacgtctt cgttggtact aaattcagac aagaactcta cctgttgctg ggtaacctgc
   232141 ggcagcggct cttctcccgc gccgtagcca gctaccagac catgactttc tctcgtcgga
   232201 gctctaggac cgacgacggt acgacacagg acaccatctc cgagaccttt tctacggtct
   232261 cggaattacc gtactaataa aaagcccgat tttgtctgtt ttgtaccatc ggctgtcgcg
   232321 tctcgttttt ccgcgtcccc gttacacgcg gtattaaaca atcgtcgcgt ttccctgcga
   232381 atagcgaatc gcgacggcgg atggagttat ctcgagaaaa ccgtcctccc acgccatggg
   232441 cccccgcggg tggtggtggc tgtgcggcgt ctgttgttgg tggtgggtca cgtttggatg
   232501 tgctcggacc gtgacggtgg atgtcgtcgc gcccacggtc cgggcacaat caaccgtggt
   232561 ttactctgag cctccgagga gcagtagcag cagtcgcggc ggcaccgcga agcggaggtc
   232621 caccgtctcg cgctggctgc gcctgcggca cggcaacgcc agcgcctgcg tgtcggaggt
   232681 cgactggacc acccagtttt tcttctctgg ctgcgagcgc taccccagct tcgtcaagct
   232741 caacggggtc aagcgctgga cttcggagcg ccagtttctg ggcgaggtgg cctactacgg
   232801 gggctgctgt gtggtgagcg gggggcgaca tgcgtacgtc gtgctcatta acggttacgg
   232861 gactgccacc tatggtaatg ctctgcgtct ggacttttcg cgccgtaact gcactgtacc
   232921 gctgcagacc taccctcgcc gtctggagat ctacgatggg cagacgactc cgagccgctg
   232981 cgatccctat cgagtgtatt tctacggtct gcgctgccct cagcagctgg ttctcaacgc
   233041 ctccggcggt ctggagctac ggcgctgccc cggtacctcc cccgccgccg cggacccctc
   233101 ccggccgcga caccgcggcg atctggagga tgagctacgc ggtctgtgcg tggacctgct
   233161 ggtgtgtgtc tttctactag ctctgctcct gctggagctc atccccatgg aggccgtccg
   233221 ccaccccctc gtcttctggc gccggatggc cttgacgccg tccagctgcc gcttcgagcg
   233281 ctggtgtaag gctcgtctgc ggcgtctgct gggactgccg ccgcctccgc cgctcgcgcc
   233341 gccctcccca cccaaaaaga gccccagtgt cttcgccacc gacaactctg cttgggcacc
   233401 gctgtccgcg ccgccgtggc ggccgccgtt accgtcggtc gttcccgaca gtccgccgcc
   233461 accgtacagc ttgcgtcatg ctacgtcact cgtcaccgta cccacgctgc tcttatatac
   233521 gtcatccgag gcgtcgttcg caatgcccca aacagcgtgc gcgctgtacg ctacttatgg
   233581 ggaacccggc gagcctgctg gatccgcgga tgcgtcgccg ggatccggag ctgccgctgc
   233641 cgtctcggct cctggccccg gtggctccga cggcctcgac gcggtccctt ctggccaaga
   233701 acatggagct gcgtttcagc ctggcctgga tctggttccc gagcctgtgc cttctgctcc
   233761 tgaggaaccc tgctgatgcc tgtctagtcg acgtgggatc ccaggtgacg atccgggagc
   233821 agtgccggct tcagaacggc gccatgatct ccggcggggt gctcgagggc aatttcagcg
   233881 gcggcgccgt actggagctc gattacgagg gcctggacta ccttggcgag ggacaacgca
   233941 tgcagctcca cctcagcggc ctggagaagg aggacgccgc cgccgcgtct gcttcttctc
   234001 accgggggca tcatcacggg cgtctccggt ggtctttcta cgtgcagcag cgccagccca
   234061 agtacggtat ccaccgccgt gtcgtgcgtc tgcgcgtcct gtcgtccgag gaacagggac
   234121 ggttcgacct ccccacgtcc tgtgcccatc agaagagata ccaccccttg cgcgacggcg
   234181 aggataacca cgacgacgac ggatccgcta cccacgcctc ccactacaac ctcctcggcg
   234241 ccctcctggt ctggatcggc tccggtctta acatcgtctg gtggaccggc atggtactcc
   234301 tggccatgga cgccctggga ctcggcgagc gctggctgcg tcaggccctg caccacggcg
   234361 agacccagca gcgctcgcgg gcgcaggccc tgcagcacga gcgggacatg ttctggcaac
   234421 gtcgcaagcg ggccaagcgt tcgcgcgcgg cctccgaaga cggttccgtt tcgcccgtga
   234481 tcaagatctc ccaggaggaa aaagtgcgcc acctcgtcgc cctgccctgg ggcgggacgc
   234541 agaccgccct cgtcaccggt gagcctctgc cgtcaccgcc tccgctgccg gacctgcctc
   234601 ccgtgccgtc atccgctcct cccgtgctgt tgtcgcagcg gccccccgaa tactccgagc
   234661 ttccgcctgt ataaaataaa gagattgggc cgacctccgc tctgagtgtc tcgtttgcgt
   234721 tcgtcttccg cggatcctat cgccggcaag acgggatccc tttcagccag cttcgatttc
   234781 atgtcgcttc tagagcgcga agagaggtgg cgccgagtca tcgactactc ccacgagctg
   234841 tggtgcgact gcgggaactg gcaaactcac gtcgagatcc aggacgacgg acccaacagc
   234901 caggagccgg agccggcgca ttggctgcag tacgtggagt gtcaatggca actgcgtgtc
   234961 cgcgactcgc acgaccgttg gtgcctctgc aacggctggc gtgatcacgc cctgcggggc
   235021 cgctggggca cggcttactc gtcgggctcc tcggcctcgt cgtcggggtt cgtggccgag
   235081 agcaagttca cctggtggaa gcggttacgg cacgctaccc gacgctggat gtttcgtcgg
   235141 aaccgtcatc gtagcccctc gcggtacagc agtagcagca gcgaggacga cgacggctcc
   235201 agcctgcgga ccaacgaggc ctacgtgcgg tcccagcggt agcggtcccc ctggcctccg
   235261 cggacgcggg tttacggacc ggatatcggg atagctgata ggctttaaaa agagacagag
   235321 aggacggtct tctcgcgcgg acactaccac cccctagcga tagacagccc ccgggatggt
   235381 gatcgccacc acggactccg agcgcgattg gcgtcgcgtc atggtggaat cccacgccct
   235441 gtggtgcgac tgcgacgagt ggcagtcgca cctctaccgc gtgttcgaca gcgatttcca
   235501 ccgccgagcc cgcaaccggg aggaacgacg cgccgccaac tggcgacgac agatgcgacg
   235561 gctacaccgc ctctggtgtt tctgccggga ctggaagtcg cacgcgctct tcaccatctg
   235621 ggacgggatg gagtccgacg ccgattcctc cgcctcgtcc tcgggcgagg cccccgagca
   235681 acccgtctgc aaatggaaga acgcgcgggc cctctcacgg gcttaccact atcgccggag
   235741 tcgcggccgg cggggcacgc cgcccccgcg aaacatgccg ggtttcgagc acgtcaggcc
   235801 cctgtggtac aacaacccgc gggacgtgcg ggaggacgag aggcggactc gggcggagcc
   235861 cgaccgcgtg gtgtttcagt tgggaggggt gcaccctcgc cgcccctttc gtatctatga
   235921 accccccgac cccgaagaag aggaacaggg ggcgtagccc gagtaataaa agcggtgttt
   235981 tccccccgtc atcacgagtg gcgcgtgtgt ctctgacgta caggaagagt gattgacgta
   236041 cgtggaaagt gtgactgaga agcgcgtcag cgtctgacgc gggatggtga ggacaccaca
   236101 cggggaggga ggcataaaaa acatactcgg ttcccctttt cgcgctcaca cgcctcgcga
   236161 ctcctgagaa caccatgagt ttcgggttcc ccgagcggat cgaggccgcg attcgacgtc
   236221 gacgcccgca ctgcaagcgc gttcgcacgg gtcatccgac aaacatgatg cacttcgtgg
   236281 tcaggcagct gatgatgtac ccgcgtctga tcccgtttcc cctgccgttt tacacaccgc
   236341 ggttagaggt acgtcggtag gaggaagaac gacgcggggg ttcacgggac ttgagcaaga
   236401 tgcggcgttt cggaaacccc cgtgatccgc tggcgtggga gccacgtcga tgctacgtca
   236461 aaccaccgtg actcgggaga acgttaccag ataaagctca aacgccgtcg gcactcgatc
   236521 ctcagagcaa cgcctcgggg cgatgcggtg atgaacatcg agaagctggt gaatctcctg
   236581 ggtctgctct gctggatcgc cgcccagacc gtcagccgca tcgctccgca tgctcgagga
   236641 ctcagtcctg atcagcttca tggtctctac cggggtctgc acctggagct tctggaacct
   236701 gctcggccgc aagcggcgaa ccggtccgtc cgagaccgag gaggaccagc cacctgccaa
   236761 gaagagaagg accgaggagg gtccttccct cgcttctcag gttttcgtgc tcgccgtgtg
   236821 ccatctcacg gcagccagcc tcggggctcc gacacccttc ccgccctccg ctttcagctc
   236881 ccagagagag tcctcctctg cctgaaccgc gggtgtcatg gtctctacgc ggttgtggaa
   236941 cggcctcgtc tggttggggt gcctgtttct aattccactg ttctgcctgt gctgtggctg
   237001 aaaccaggag cgacatggga aaacggtacc gctcctattc gcggacctga ggaacgatga
   237061 agttctttaa atctcgcgcc agacctccgc gcctgacggt gccccgggtc ctccgcttct
   237121 tcggatacgc cgttttactc gccgtcgctt ggcaacgcct gaagaaagag cgtgccgcga
   237181 gcctacggcg ctatgaagaa aaaatgcgtc ggcaacaggt acggcgtcgg cagagctttc
   237241 catgaactca gagactggtt gcgatcagcg tgctggatcg cggtgctctg tgccgcgacg
   237301 acgcatgtgt ccgagcatgc ggcggtctag tgagaccacg ggactctaac ctgagagcct
   237361 cagagcgatg tatcaataaa gaggatatta tttttgtacc ggattcgctt gtcttgtgtt
   237421 cttttcgggg tcgggagagt tcgacagttt atgagatagg acaggaaaag taaggatata
   237481 aaagaaataa aagcgaggat agaaatcgct agttacatcg gtcgtatgta ctagcccaac
   237541 gattcctgtg taagatggtg ttgctgaggg ctaaaggccg ggtggtgtgt tcgctgacca
   237601 cctcctggcc tctgtttatt gtagcgtgta tcctagcgtt gggagataaa tgtcaaagag
   237661 agctgggttt ctgtgtgttg tgtctgatct tgcatatcgt gaccaccgtc agcttcacgg
   237721 aggaaagtct gagttcggcg gtgccgtgaa agagatatgt atcttgtgtt ttatgtatgt
   237781 ggtataacat ggtaatgaag tattcaaagc gcgaataaag gtcacattcg tccatcaacg
   237841 tgtctttatt gaacgttata gtggtaatgg gtggcgacgt tagagaaagt gacacgtcgc
   237901 atgtcacggc atagtcgggc agtggtatcg tagtacggta ccggggcagg catgcacacg
   237961 ggctggatga acccgggggc catgtgaggt accacgtagt tcccgggatc ggagaattcg
   238021 ggggcggtgt agttgagaga cgtttgtggc ggcgatgttg tcgcttcgtg aatgaaagac
   238081 tggggtcggc agcctttcgg tggtaccggg agagggcgct ctatgtccag gccacaacgt
   238141 atggtagctt tcttccagcg tcgttgtacc acgtcgtttt tgcgactggt gcccaatacc
   238201 cagatggact cgtcgaggtc gaaccaggcg tcgtcggcga tcggtcggct gggtcgccag
   238261 tcttcgtcat cgcgtcgtag ggcccgtcct atgctggctt ggtgactcaa cgggggttct
   238321 gagggtcgat tgtatttgct ggatttgcct ttcgccgagg gttcgtcttc ttttccccga
   238381 ccttttttgc cttttttatc cttgtgtaga tgtcccccgg cttccaggag gatcatagcc
   238441 aagtcgaggc caagagcctg ggcgtcggca cggcgtcgag cgtcgttgag gtgatcttcg
   238501 accgcgatag aatcgcttag cccttggttt ttggcggcga gggccagtac ctcggattct
   238561 ccgcgtcccg gacgtaataa gaaattcagc tggccggcgc cgtcgcgtac ccatagcggg
   238621 gcgcggggat gaacgtgcag ggcgtcccag cggggccgct cccagtgctc gcggtcgagg
   238681 tcgggcagga ggcgcagggc ggcctcggcg ggcggggcgg agacgcggcc cagggtcagc
   238741 agccccagga ggccggcgcg cagcaggtgc gagagctcgt cggccagcgg gtagaggtgg
   238801 ccgtcctggg ggcagtagcc gaagacggca cccagctcgt ccagcactag cagggcctgg
   238861 gcgtagggcc ggccgtccgt tccccgaacg ggcggttgct gcaactgttg cagttgctgc
   238921 tgctggagca ggtcggcggc cgtgggacgt tgaccagagg aggtagcacc ggcagcagtt
   238981 ccagcagcag aagtcgggcc ggcggagctc gacagaggtg gggacacggc acaggtagca
   239041 gcggacgagt tgtggggcgc gacgccgtgt ccctgggtgt tcgccgtatg cgttattaga
   239101 ggcgcgccgg ctgggtgtcc cgcgggtccg tttccgcgtc ctgcggtctg gctcggcgcc
   239161 atccccgaag acaagcccgt cccggtacct gcgccagctg cggtattaga ggcgccgggc
   239221 cccgtcccgg tctgtcgtcc gccatgctga ggagacgtcg tggctgcatt cgccggaccc
   239281 ccggacctgg tcgcggcgcc gtgttccgag gaagagagcc tggctgagga cgaggcatcg
   239341 ttcccggtat cagccgacac gctcgggttt tcctgcggcg tccccgcctc tgtgtcgtgg
   239401 cggcagtaga tcgttagcca gcgactgggc agcacgacgc ccagaaacag ccacccgcag
   239461 cacaggcgct ggtggatgtg gcgctgcacg gccgtcagca gcgacggcgg gtgtggcgcc
   239521 gaggcgaacg gctcgtagtt ttccagctcc tgccaggagc ccaggatcac ccagggttgg
   239581 cgcagtcgtc cgggcgtctg cagcgggatg cccgtgtgct gccaccggcg gcgcagctcg
   239641 cggcccagtt cgttcacgtc gtcgctcttg gtcagcgtcc gcagcagcgc gggctcgggg
   239701 acagcggtgg cccgcggcgc gttcagcccc agccggttgg accgatacag ccgcgccacg
   239761 tcgccggcgc cgtagcggaa ccattcgtcg gcgtcgcggg cggctagggt cagcgtgttg
   239821 cgctgcaggt cgtagatgaa cacccgaaag ttgacgccca gggccaggta cagctggtcc
   239881 tgttggcaca ggccgtccag tcccgtaggc ggcgccgtgg ctcccgggga cggcagcggt
   239941 tcgtgtcccg tcgccgcctc gtggacgatg gtggccacca gcacgatcca ggggtcgcgc
   240001 ggcgagagct ggcgcaggtc ggtggccccg acgccggcca tctggctgcg cggcgtgatg
   240061 cgcgcgtaga agccgtacgg ccggcccagc gggagcagac cgccggcctc tcgttgcgcc
   240121 cacttgcgca tggctcggct ggtggtgtta gccatgaacg ccgtgcgcca gatggtgccc
   240181 atggcttggt attccagctc cgtcaacgtt ctccgttcca cggggatctg cgccagcagg
   240241 aaccgctccg ggctgttcca gaagttgagg ctcggcgggg cgccgggcgg tcctccgccg
   240301 atggcgcctg cttggcctcc ggcgtggggc ttgcacgtgg tggggttgtg cacgttgggg
   240361 tgggcgtgcg gtcgtcccgg cgggcgcgga aagcgctggc tcatggcgtc ggcctgagcg
   240421 tacgttgcct acagagagcg tcgtgaggaa ttgaagtggg gaagggcgga tcggagtccg
   240481 caacgggaac ggcttcagcg gaaagtcggt gtggatcgcg gacggcgatt atggttccta
   240541 atagtctcgt tagagtgcac gcgcgtcacc cctgaaaacc gcgtgttctc tcggccctcg
   240601 cggagcacgt agttttcaga ggcaaacggc gagaagcgca ggcgtgcgtg tgtgagctcc
   240661 gaaggcagat tttataccca gtgttgttcc cgcgtgaggc gggcagcggt cgcaggcgcc
   240721 gcctccggca gctcacgctt ggttggccgt ttgcacgcct ggggacgcca gaccggtgga
   240781 cgcacacact ccgatccggc ctccgctgcg ggtcccgggg ggtggggggg tgtttttggc
   240841 gggggggcac taaattggcg caaggttgcg cgtgtcgctt gccgcgggcg tgcagggagg
   240901 ccgaagcggc ggccggagcc gtgcagaaac acgtacgtac gcacgccaaa ccagtccccg
   240961 cgacgacccg ccggcccgaa acacgtccga ccggccggcc cgccgcacgc cgccgcggaa
   241021 accggttccg tgactcaccg atcccggcca cggcaaacac gcgccacact cgctgcgcgg
   241081 atagact
//
DBGET integrated database retrieval system