GenomeNet

Database: RefSeq
Entry: NC_004455
LinkDB: NC_004455
Original site: NC_004455 
LOCUS       NC_004455               9518 bp    DNA     linear   VRL 13-AUG-2018
DEFINITION  Simian immunodeficiency virus 2 isolate SIVmnd-2, complete genome.
ACCESSION   NC_004455
VERSION     NC_004455.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Simian immunodeficiency virus SIV-mnd 2
  ORGANISM  Simian immunodeficiency virus SIV-mnd 2
            Viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes;
            Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus.
REFERENCE   1  (bases 1 to 9518)
  AUTHORS   Takehisa,J., Harada,Y., Ndembi,N., Mboudjeka,I., Taniguchi,Y.,
            Ngansop,C., Kuate,S., Zekeng,L., Ibuki,K., Shimada,T., Bikandou,B.,
            Yamaguchi-Kabata,Y., Miura,T., Ikeda,M., Ichimura,H., Kaptue,L. and
            Hayami,M.
  TITLE     Natural infection of wild-born mandrills (Mandrillus sphinx) with
            two different types of simian immunodeficiency virus
  JOURNAL   AIDS Res. Hum. Retroviruses 17 (12), 1143-1154 (2001)
   PUBMED   11522184
REFERENCE   2  (bases 1 to 9518)
  AUTHORS   Harada,Y., Takehisa,J., Mboudjeka,I., Taniguchi,Y., Ndembi,N.,
            Ngansop,C., Kuate,S., Zekeng,L., Ibuki,K., Tamaru,K.,
            Yamaguchi-Kabata,Y., Miura,T., Kaptue,L. and Hayami,M.
  TITLE     Molecular characterization of new SIVmnd, SIVmnd-2
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 9518)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2002) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 9518)
  AUTHORS   Harada,Y., Takehisa,J., Mboudjeka,I., Taniguchi,Y., Ndembi,N.,
            Ngansop,C., Kuate,S., Zekeng,L., Ibuki,K., Tamaru,K.,
            Yamaguchi-Kabata,Y., Miura,T., Kaptue,L. and Hayami,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-DEC-2002) Viral Pathogenesis, Institute for Virus
            Research, 53 Kawaharacho, Sakyo-Ku, Kyoto 6060-0804, Japan
  REMARK    Sequence update by submitter
REFERENCE   5  (bases 1 to 9518)
  AUTHORS   Harada,Y., Takehisa,J., Ndembi,N., Yamaguchi-Kabata,Y.,
            Mboudjeka,I., Kuate,S., Zekeng,L., Bikandou,B., Ido,E., Miura,T.,
            Ichimura,H., Kaptue,L. and Hayami,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-MAR-2001) Viral Pathogenesis, Institute for Virus
            Research, 53 Kawaharacho, Sakyo-Ku, Kyoto 6060-0804, Japan
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AF367411.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..9518
                     /organism="Simian immunodeficiency virus SIV-mnd 2"
                     /proviral
                     /mol_type="genomic DNA"
                     /isolate="SIVmnd-2"
                     /host="Mandrillus sphinx"
                     /db_xref="taxon:159122"
     gene            737..2290
                     /gene="gag"
                     /locus_tag="Siv2gp1"
                     /db_xref="GeneID:956108"
     CDS             737..2290
                     /gene="gag"
                     /locus_tag="Siv2gp1"
                     /codon_start=1
                     /product="gag protein"
                     /protein_id="NP_758886.1"
                     /db_xref="GeneID:956108"
                     /translation="MGASASGLRGEKLDELEKIRLRPSGKKKYQLKHIIWVSKELDRF
                     GLHEKLLESKEGCEKILSVLFPLVPTGSENLISLYNTCCCVWCVHAKEKVTDTEEAKE
                     KVKQKLHLVAEKENAASEKEQRAIVTPSGRSKNYPIQIINQTPVHQGISPRTLNAWVK
                     CIEEKKFSPEIVPMFIALSEGCLPYDLNGMLNAIGDHQGALQIVKDVINEEAADWNLR
                     HPQVGPMPQGVLRNPTGSDIAGTTSSIEEQIEWTTREQDAVNVGGIYKQWIVLGLQKC
                     VSMYNPVNILDIKQGPKEPFKDYVDRFYKALRAERTDPQVKTWMTQTLLIQNANPDCK
                     SILKGLGMNPSLEEMPLACQGVGGPKYKAQMMAEAMKEAQSAVMMQNSGGPPRGPPRQ
                     PPRNIRCPNCGKFGHGLRDCISPRKKGCFKCGDLGHIMRNCPKMVNFLGNTPWGSGKP
                     RNFPAMPLTPTAPPMPGMEDPAERMLLDYMKKGQQQKAESKQEKKERGPYEAAYNSLS
                     SLFGTDQLQ"
     misc_feature    740..1144
                     /gene="gag"
                     /locus_tag="Siv2gp1"
                     /note="gag gene protein p17 (matrix protein); Region:
                     Gag_p17; pfam00540"
                     /db_xref="CDD:249943"
     misc_feature    1190..1834
                     /gene="gag"
                     /locus_tag="Siv2gp1"
                     /note="gag gene protein p24 (core nucleocapsid protein);
                     Region: Gag_p24; pfam00607"
                     /db_xref="CDD:279002"
     misc_feature    1988..2041
                     /gene="gag"
                     /locus_tag="Siv2gp1"
                     /note="Zinc knuckle; Region: zf-CCHC; pfam00098"
                     /db_xref="CDD:278525"
     gene            <2050..5082
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /db_xref="GeneID:956107"
     CDS             <2050..5082
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="protease, RT, RNaseH, integrase"
                     /codon_start=1
                     /product="pol protein"
                     /protein_id="NP_758887.1"
                     /db_xref="GeneID:956107"
                     /translation="FFREYPLGQWQTQELPGDAIDPNGPSNARDGRPSRENAVRLHEE
                     RATAESGKQTGKEREGSIRGSLQLPQFSLWNRPTTVVEIEGQKVEALLDTGADDTVIK
                     DLDLKGNWKPQIIGGIGGSINVKQFFNCKVTIAGKTTHASVLVGPTPVNIVGRNVLKK
                     LGCTLNFPVSKVETVKVTLKPGTDGPKIKQWPLSKEKILALQEICSQMEKEGQISKIG
                     PENPYNTPVFCIKKKDGTSWRKLVDFRQLNKVTQDFFEVQLGIPHPGGLKQCEQITVL
                     DIGDAYFSCPLDEDFRKYTAFTIPSVNNQGPGIRYQYNVLPQGWKGSPAIFQATADKI
                     LQPFRERHPDVVIYQYMDDLFVGSDRVAPEHSRMIQELRDHLLFWGLETPDKKFQKEP
                     PFEWMGYILHPKKWTVQKVQLPEKEEWTVNDIQKLVGKLNWASQIYSGIKTKELCRLI
                     RGAKPLDEKVEWTREAELEYEENKLIVQEEVHGVYYQPEKPLMAKVQKLTQGQWSYQI
                     EQEDNKPLKVGKYARTKNAHTNELRVLAGLVQKIAKEALVIWGKLPKFYLPIEREVWD
                     QWWPEYWQATWIPEWEFVSTPHLIGLWYNLLREPVPGEDVYYVDGAANRNSKEGKAGY
                     VTARNKSRVIALENTTNQKAELEAIKMALQDSGPKVNIVTDSQYAMGILSAAPDQSDN
                     PIVREIIELMIHKEAVYLAWVPAHKGIGGNEQVDKLVSRGVRQVLFLEGIDKAQEEHD
                     KYHNNWRALAQDFCIPNIVAKEIVAQCPKCQTKGEPIHGQVDTSPGTWQMDCTHMEGK
                     VIIAAVHVASRYLEAEVIPTETGKETAHFLLKLAGRWPVKHLHTDNGPNFTSEKVATV
                     CWWAQIEHTTGIPYNPQSQGVIEAKNHHLKQIIGQVRDQAEKLETAVQMAVLIHNFKR
                     KGGIGEYSPGERIVDIIATDLLTTKLQHNIQKIQNFRVYYREGRDQQWKGPAELIWKG
                     EGAVVIKEGTDLKVVPRRKAKIIRDYGKTVDSDPNVEA"
     misc_feature    2272..2547
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Cellular and retroviral pepsin-like aspartate
                     proteases; Region: pepsin_retropepsin_like; cl11403"
                     /db_xref="CDD:299705"
     misc_feature    order(2326..2328,2332..2334,2338..2340,2401..2409,
                     2503..2505)
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:133137"
     misc_feature    2326..2334
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:133137"
     misc_feature    2326..2328
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Catalytic residue [active]"
                     /db_xref="CDD:133137"
     misc_feature    order(2401..2409,2410..2421)
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Active site flap [active]"
                     /db_xref="CDD:133137"
     misc_feature    2602..3252
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="RT_like: Reverse transcriptase (RT, RNA-dependent
                     DNA polymerase)_like family. An RT gene is usually
                     indicative of a mobile element such as a retrotransposon
                     or retrovirus. RTs occur in a variety of mobile elements,
                     including retrotransposons; Region: RT_like; cl02808"
                     /db_xref="CDD:295487"
     misc_feature    2737..3252
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:278506"
     misc_feature    order(2878..2895,3001..3006,3097..3099,3103..3108,
                     3238..3243)
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="active site"
                     /db_xref="CDD:238185"
     misc_feature    order(2878..2895,3001..3003,3103..3105)
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238185"
     misc_feature    3004..3006
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
     misc_feature    3277..3438
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Reverse transcriptase thumb domain; Region:
                     RVT_thumb; pfam06817"
                     /db_xref="CDD:284283"
     misc_feature    3502..3807
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Reverse transcriptase connection domain; Region:
                     RVT_connect; pfam06815"
                     /db_xref="CDD:284281"
     misc_feature    3871..4221
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="RNase H; Region: RNase_H; pfam00075"
                     /db_xref="CDD:278503"
     misc_feature    order(3877..3888,3970..3975,3982..3984,4042..4044,
                     4153..4155,4207..4209)
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:259998"
     misc_feature    order(3877..3879,4042..4044)
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="active site"
                     /db_xref="CDD:259998"
     misc_feature    4252..4365
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Integrase Zinc binding domain; Region:
                     Integrase_Zn; pfam02022"
                     /db_xref="CDD:280240"
     misc_feature    4402..4710
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:279057"
     misc_feature    4891..5034
                     /gene="pol"
                     /locus_tag="Siv2gp2"
                     /note="Integrase DNA binding domain; Region: IN_DBD_C;
                     pfam00552"
                     /db_xref="CDD:278951"
     gene            5042..5680
                     /gene="vif"
                     /locus_tag="Siv2gp3"
                     /db_xref="GeneID:956111"
     CDS             5042..5680
                     /gene="vif"
                     /locus_tag="Siv2gp3"
                     /codon_start=1
                     /product="vif protein"
                     /protein_id="NP_758888.1"
                     /db_xref="GeneID:956111"
                     /translation="MEKQWIVIPTWKLDRHAVERWNSLVKYHKYKGEKHLDKWDLKAH
                     FQCSGWWTHSQKYIPLEEDEQIIITILWNLTPEKGWLSTYAMTIEYKFTNYYTHIDPQ
                     TADRMIHWKYLPCFTEQAIRQALLGKRLTVCYFHWGHKGKVGSLQYLALLSYTAYCNN
                     GRRGPRDPRRSRRGGSKYLVGKISGENQSGGKITLPPRVPFPSLERMHRTLA"
     misc_feature    5042..>5494
                     /gene="vif"
                     /locus_tag="Siv2gp3"
                     /note="Retroviral Vif (Viral infectivity) protein; Region:
                     Vif; pfam00559"
                     /db_xref="CDD:278957"
     gene            5520..5819
                     /gene="vpx"
                     /locus_tag="Siv2gp4"
                     /db_xref="GeneID:956114"
     CDS             5520..5819
                     /gene="vpx"
                     /locus_tag="Siv2gp4"
                     /codon_start=1
                     /product="vpx protein"
                     /protein_id="NP_758889.1"
                     /db_xref="GeneID:956114"
                     /translation="MAEGAPEIPEGAGEVDLNTWLERSLEKINQEARLHFHPEFLFRL
                     WNACIEHWHDRHQRSLSYAKYRYLLLMNKAMFTHMQQECPCRSGHPRGPPPPGMV"
     misc_feature    5571..5768
                     /gene="vpx"
                     /locus_tag="Siv2gp4"
                     /note="VPR/VPX protein; Region: VPR; pfam00522"
                     /db_xref="CDD:278923"
     gene            5834..6139
                     /gene="vpr"
                     /locus_tag="Siv2gp5"
                     /db_xref="GeneID:956112"
     CDS             5834..6139
                     /gene="vpr"
                     /locus_tag="Siv2gp5"
                     /codon_start=1
                     /product="vpr protein"
                     /protein_id="NP_758890.1"
                     /db_xref="GeneID:956112"
                     /translation="MEQPPEDEAPQREPYNEWLIDTLAEVQEEALKHFDRRLLHAVGS
                     WIYKTYGDTLEGVRQLISILQKALSMHYRYGCRESRIGQEGGGCYPLRSFPRSDNPL"
     misc_feature    5834..6082
                     /gene="vpr"
                     /locus_tag="Siv2gp5"
                     /note="VPR/VPX protein; Region: VPR; pfam00522"
                     /db_xref="CDD:278923"
     gene            6054..8625
                     /gene="tat"
                     /locus_tag="Siv2gp6"
                     /db_xref="GeneID:956113"
     CDS             join(6054..6270,8489..8625)
                     /gene="tat"
                     /locus_tag="Siv2gp6"
                     /codon_start=1
                     /product="tat protein"
                     /protein_id="NP_758891.1"
                     /db_xref="GeneID:956113"
                     /translation="MDAGKAVSDKKEGDVTPYDPFRDRTTPCDTCYCKRCCYHCQLCF
                     LQKALGVHYHAYRNRRSRQRLLEKISEDSRVIALFLMSSRETISVPTTSNSQAKKEKK
                     SPTQKNRVPNQTAPK"
     misc_feature    6099..6257
                     /gene="tat"
                     /locus_tag="Siv2gp6"
                     /note="Transactivating regulatory protein (Tat); Region:
                     Tat; pfam00539"
                     /db_xref="CDD:278940"
     misc_feature    join(6143..6270,8489..8719)
                     /note="similar to rev protein"
     gene            6309..8909
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /db_xref="GeneID:956110"
     CDS             6309..8909
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /codon_start=1
                     /product="env protein"
                     /protein_id="NP_758892.1"
                     /db_xref="GeneID:956110"
                     /translation="MLRYIILGIIVGLGLGNQWVTVYYGTPKWHKAETHLFCATENDS
                     LWVTTSCVPSLLHYEEQPIPNITWNFTGPMEENEVVMQAWGAISSMIDAVLKPCVKLT
                     PYCVKMQCTKGKDLATPIPTTSTTTTTTTTKTVANTTELDIDTNNTETTTQQNRVCKF
                     NTTGLCRDCKLEIEENFRYEDVTCTNGTNNTYSCYMTQCNTSVITQDCNKASTDEIKF
                     RLCAPPGYVLLRCLERLNVSKKCTNITAVQCTQPLPATTSTMCGSSGTKHDYNELIQT
                     NTKKGKEEFHDHKYVYRVDEKYNLQVVCRRKGNRSVISTPSATGLIFYSGLEPGKNLK
                     KGMCQLKGQWGIAMHDLAIELRKIDSSIWRNVTKGYCKGLKRKENRTGCALKTIKVSD
                     YTTKGEPGAETIMLLCGGEYFFCNWTKIWRTWNDQNSSVWYPWMSCNIRQIIDDWHKV
                     GKKIYMPPVSGFNNEIRCSNDVTEMFFEVQKTEEGYIIKFVPQDEVQNRFTAVGAHYQ
                     LVKVDPIGFAPTEVARYHLPEARQKRGAVLLGMFGLLGLAGSTMGSVAVALTVQSQAL
                     LNGIVEQQKVLLSLIDQHSELLKLTIWGVKNLQARLTALEDYVADQARLSMWGCSFAQ
                     VCHTHVPWPNDSITPNWTSETWLEWDKRVTALTDNMTVNLQKAYELEQKNIYELEKLG
                     DWTSWASWFDFTWWLKYVKIGLLIVIVIIVLRILACLWSVLGKFRQGYRPLPYVFKGD
                     YLRPHNLKQPGKEREEEPDSEKQSTKSDSSKVEFGKPWSKEQIRDWLKTSRGYVWLKN
                     LQAVIEYGWQELKTAGGKIFKVLQGYAQGLWSRGHQWGLSTAACFRAIARGIINIPRR
                     IRQGAEVLLN"
     misc_feature    6360..7910
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /note="Envelope glycoprotein GP120; Region: GP120;
                     pfam00516"
                     /db_xref="CDD:278917"
     misc_feature    7989..8351
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /note="heptad repeat 1-heptad repeat 2 region (ectodomain)
                     of the transmembrane subunit of various endogenous
                     retroviruses (ERVs) and infectious retroviruses, including
                     Ebola virus and human immunodeficiency virus type 1
                     (HIV-1); Region: Ebola_HIV-1-like_HR1-HR2; cl02885"
                     /db_xref="CDD:295533"
     misc_feature    order(8055..8063,8067..8072,8076..8078,8085..8093,
                     8097..8105,8109..8114,8118..8123,8133..8135,8139..8147,
                     8151..8153,8253..8255,8262..8267,8274..8276)
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /note="homotrimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:197370"
     misc_feature    order(8055..8078,8082..8126,8133..8153)
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /note="HR1; other site"
                     /db_xref="CDD:197370"
     misc_feature    8136..8162
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /note="immunosuppressive region; other site"
                     /db_xref="CDD:197370"
     misc_feature    8250..8276
                     /gene="env"
                     /locus_tag="Siv2gp7"
                     /note="HR2; other site"
                     /db_xref="CDD:197370"
     gene            8722..9279
                     /gene="nef"
                     /locus_tag="Siv2gp8"
                     /db_xref="GeneID:956109"
     CDS             8722..9279
                     /gene="nef"
                     /locus_tag="Siv2gp8"
                     /codon_start=1
                     /product="nef protein"
                     /protein_id="NP_758893.1"
                     /db_xref="GeneID:956109"
                     /translation="MGGKSSKQQEEKYLKYYKAMRRGYGAEGTNGDYQQLHASEPLLG
                     ALSTSQEEFDREQKSSSTDEEEETGFPVYPQCPVREPTYKDLVDMPHFLKEKGGLEGI
                     WHSKRREEILDLYAQNEWGFIPTWQSYTDGPGIRYPKTFRFLFKLCPVAVPPDQENNE
                     CNKLLQSSQLGIQEESLGREASVEV"
     misc_feature    8725..9246
                     /gene="nef"
                     /locus_tag="Siv2gp8"
                     /note="Negative factor, (F-Protein) or Nef; Region:
                     F-protein; pfam00469"
                     /db_xref="CDD:249884"
ORIGIN      
        1 cgtcgggtgg gggagtggtc aacccaacct ggctgcatat aagcagctcg ctttgcgctt
       61 gaagtgagtc tctccctgag aggctaccag attgagcctg ggtgttctct ggtgagtctt
      121 ggaaggagtg cctgcttgta gccctgggtg gttcgcaggc ccctggcttg tagctctggg
      181 cagctcgtca ggtgttcctg aagaggctca tcgggggctc ccttgcttgg tcttggtaga
      241 cctctagcag tctcggtggc caagaggctg tgggattgac taccgcttgc ttgcttttaa
      301 gtgctcaata aaagcttacc caagttaaga aaagcaagtg agtgtactcg cctattttgt
      361 ctttggtaga aactctggtt actggagatc cctcagatcg gtggcagaga tttgatatct
      421 agtggcagta gagaaaaaat ccccagcagt ggcgcccgaa cagggacttg acaagggttc
      481 gagtcattcc aacctgtaag ggacgaaggc ggcagccagc cggaccgacc cacccggcga
      541 agtgagttaa ccaaggagcc ccgacgcgca ggactcaagg taagcggtgc accgaacagt
      601 tgtgtgtgtg agtccagggt ccgctagagc aagcgagacc gccgaggcaa ccccagtagg
      661 caaaaggaaa agaggggaag taaggccgag gcaaagtgaa aagaggtcct tgtgaaagag
      721 gacagggggc aagaaaatgg gcgcgagcgc gtcaggtctt aggggagaaa aattggacga
      781 gctggaaaag attaggttac ggccctccgg aaaaaagaaa taccagctga aacacataat
      841 atgggtaagc aaggaactag acagatttgg ccttcatgaa aagctgttag aaagtaagga
      901 aggatgcgag aaaattctta gcgtactctt tccactagtt cctacagggt cagaaaattt
      961 aatctcgctg tacaacacct gctgctgcgt atggtgcgta catgcgaaag agaaagtaac
     1021 agatacagag gaagcgaaag agaaagtaaa acaaaagctc catctagtgg ccgaaaagga
     1081 aaatgcagca tcagaaaaag aacaaagagc aatagtgaca cctagtggcc gctcaaaaaa
     1141 ttacccaata cagataataa atcagacccc agtccatcag ggaatttcac cgcgcacgct
     1201 gaatgcgtgg gtaaaatgca tagaagagaa gaagtttagc ccagaaatag tgcccatgtt
     1261 catagccttg tctgaagggt gcctccccta tgatctcaat ggcatgctca atgctattgg
     1321 agaccatcag ggagcgcttc aaatagtgaa ggatgtcatc aatgaggaag ctgcagactg
     1381 gaacttgaga cacccacaag tgggtcctat gccccaaggt gtcttgagaa acccaacggg
     1441 cagtgatatt gctggaacaa caagctccat agaagagcag atagaatgga ctacaaggga
     1501 gcaagatgca gtaaatgtgg gaggaatata taaacaatgg atagttttag ggcttcagaa
     1561 gtgtgtaagc atgtataatc cagtaaacat cctggacata aagcaaggac caaaggagcc
     1621 gttcaaggac tatgtggaca ggttttacaa agctctgcgg gcggagcgga ctgatccaca
     1681 agtcaaaacc tggatgacac aaactttgct catccagaat gctaacccag attgtaaatc
     1741 catccttaaa gggctaggca tgaatccctc tttagaagag atgccgctag cctgccaagg
     1801 ggtaggaggc cctaaatata aagcacaaat gatggcagag gctatgaagg aagcccagtc
     1861 agctgtaatg atgcagaatt cgggagggcc accgcggggc cccccgagac aacctcctag
     1921 aaacatcaga tgccctaact gtggaaaatt tggtcatggg ctgagggact gtataagccc
     1981 tcgaaaaaag ggatgcttca agtgtggaga tctaggacac ataatgagaa attgcccaaa
     2041 gatggtgaat tttttaggga ataccccctg gggcagtggc aaacccagga acttcccggc
     2101 gatgccattg accccaacgg cccctccaat gccagggatg gaagacccag cagagagaat
     2161 gctgttagat tacatgaaga aagggcaaca gcagaaagcg gaaagcaaac aggaaaagaa
     2221 agagaggggt ccatacgagg cagcttacaa ctccctcagt tctctctttg gaacagacca
     2281 actacagtag tagagataga agggcaaaaa gtggaggcct tactggacac aggagctgat
     2341 gatacagtaa tcaaagatct agatttaaaa ggtaattgga aaccacagat tattggagga
     2401 attggaggat caatcaatgt aaaacagttt ttcaattgta aagtaacaat agcaggcaaa
     2461 actacacacg cttcagtcct agtgggcccc acacctgtaa atattgtagg tagaaatgtg
     2521 ctgaagaaat taggatgtac actaaatttt ccagttagta aagtagaaac agtaaaggta
     2581 acactaaaac caggaactga cggacctaaa ataaaacaat ggccattgtc taaggaaaag
     2641 attttagcct tacaagaaat atgtagtcaa atggagaagg aaggccagat ctctaagata
     2701 ggtccagaaa atccttacaa cacaccggtg ttttgcatca aaaagaaaga tggaaccagc
     2761 tggagaaaat tggtagattt tagacagtta aacaaagtaa ctcaggactt ctttgaggtg
     2821 cagttgggaa tcccacaccc tggaggtctc aaacaatgtg agcaaattac agtactggac
     2881 ataggggatg cctatttctc atgtcctttg gatgaggact ttagaaagta cactgcattc
     2941 accattccat cggtgaataa tcagggccca ggaatcaggt accagtataa tgtcctacca
     3001 cagggatgga agggctcccc agccattttc caggcaacag cagataaaat cttacagccc
     3061 ttcagagaga gacatccaga tgtagtgatc tatcaatata tggatgatct ctttgttggg
     3121 agtgatagag ttgccccaga acacagcaga atgattcaag agttaagaga ccacctcttg
     3181 ttttgggggc tcgagacccc agacaagaag tttcaaaagg aaccaccctt tgagtggatg
     3241 ggatacatac tgcaccctaa gaaatggaca gtgcagaaag tacagcttcc agagaaagaa
     3301 gaatggacag taaatgacat ccaaaagttg gtagggaaac ttaattgggc aagtcagatt
     3361 tattccggaa ttaaaacaaa agagctctgt agactaatta gaggggcaaa acccctagat
     3421 gaaaaagtag aatggactag agaagcagaa ttagaatatg aagaaaacaa actcatagtg
     3481 caggaggaag tgcatggagt atactatcaa ccagagaagc ctttaatggc aaaggttcaa
     3541 aaattgacac aagggcaatg gagttaccaa atagagcagg aggataataa gccgctgaag
     3601 gtagggaaat atgccagaac aaagaatgct catacaaatg agcttagagt gcttgcagga
     3661 ctagtacaga agattgcaaa agaagcttta gtgatctggg gaaaactccc taagttttat
     3721 ctgccaatag aaagagaagt ctgggaccag tggtggccag aatattggca agccacatgg
     3781 attcccgaat gggaatttgt atccactcca caccttatcg ggttgtggta taacctgttg
     3841 agagaacctg tgccaggaga agatgtgtat tatgtggatg gagcagctaa cagaaactcc
     3901 aaagaaggga aagcaggata tgtaacagct agaaataaat ccagagtaat agccctagag
     3961 aataccacaa accaaaaagc agaattggag gcaataaaaa tggcattaca agactcagga
     4021 ccaaaagtaa atatagtgac agattcacag tatgctatgg gtatcctatc ggcagcaccc
     4081 gaccaatcag acaaccccat agtaagagaa attatagaac tcatgatcca caaggaagca
     4141 gtatacctag cttgggtacc agcacacaaa ggcataggag ggaatgagca agtagataaa
     4201 ctagtgagca gaggagtaag gcaagtactg tttttagaag gcatagataa agcacaagaa
     4261 gagcatgata aatatcacaa taattggagg gcattagcac aagacttctg tataccaaac
     4321 atagtggcaa aagaaatagt agcccagtgt ccaaagtgtc aaacaaaagg agagccaata
     4381 catggccagg tagatacatc cccaggaacc tggcaaatgg actgcacaca tatggaagga
     4441 aaagtaatca tagcagcagt ccatgtagca agtaggtatc tagaagcaga agtaataccc
     4501 acagaaacag gaaaagaaac agcacacttc ctgttaaaat tagcaggtag atggccagta
     4561 aaacatctac acacagataa tggccctaat ttcaccagtg aaaaagtagc cacagtctgt
     4621 tggtgggctc aaatagagca cactacagga attccctaca atcctcagag tcaaggagta
     4681 atagaggcaa aaaaccatca tctcaaacaa atcatagggc aagttagaga ccaagcagag
     4741 aaactagaaa cagcagttca aatggcagta ttaattcaca attttaaaag aaaagggggg
     4801 ataggggaat acagtccagg agaaagaata gtagacatta tagcaacaga cctcctaaca
     4861 actaaattac aacacaatat tcaaaaaatt caaaattttc gggtttatta cagagaagga
     4921 agggaccaac agtggaaagg accagcagaa ctcatttgga aaggagaagg agcggtggta
     4981 atcaaagagg ggacagactt gaaggtagta ccaaggagaa aagcaaaaat catcagagat
     5041 tatggaaaaa cagtggatag tgatcccaac gtggaagctt gatagacatg cagtagaaag
     5101 atggaattca ctggtaaaat accacaaata taaaggagaa aaacatttgg acaaatggga
     5161 tttaaaggca cattttcaat gctcaggatg gtggacacac tcacaaaaat atattcccct
     5221 agaagaagat gaacagatca taatcaccat cctgtggaac ttaaccccag aaaaaggatg
     5281 gttatcaact tatgccatga caatagaata taagttcaca aactactaca ctcacataga
     5341 cccccaaaca gcagacagga tgatacattg gaaatatctc ccctgtttta cagaacaagc
     5401 aataagacaa gccctgctag gaaagagact aacagtgtgc tacttccact ggggacataa
     5461 agggaaggta gggagcctgc agtacttggc tttgctaagt tatacagcct actgtaacaa
     5521 tggcagaagg ggccccagag atcccagaag gagcaggaga ggtggatcta aatacctggt
     5581 tggaaagatc tctggagaaa atcaatcagg aggcaagatt acacttccac ccagagttcc
     5641 ttttccgtct ctggaacgca tgcatagaac actggcatga cagacatcag agaagcttaa
     5701 gctatgcaaa gtatagatac ctgctgttga tgaataaagc aatgtttact cacatgcaac
     5761 aagaatgtcc ttgtagaagt gggcatccga gaggacctcc tcctccaggg atggtctaac
     5821 ctctgtgtta cagatggagc aaccacccga ggacgaggcc cctcaaagag aaccatacaa
     5881 tgaatggcta attgacacct tagcagaagt tcaagaagaa gctttaaagc attttgatag
     5941 acgcttattg catgcagtag gaagctggat ctacaaaacc tatggggata cattagaagg
     6001 ggtgcgacag cttatctcaa ttcttcaaaa agctctgtct atgcactata gatatggatg
     6061 cagggaaagc cgtatcggac aagaaggagg gggatgttac cccttacgat cctttccgag
     6121 atcggacaac cccctgtgac acatgttact gtaaaagatg ttgctatcac tgccagctat
     6181 gcttcttgca gaaggcctta ggagtacatt atcatgccta cagaaacagg agatctagac
     6241 agagacttct ggaaaaaata tcagaagata gtgcagcgcc tgtgggaagg taagtattaa
     6301 cagtaagtat gcttaggtac ataatattag gaataattgt aggactaggg ttaggaaacc
     6361 aatgggtgac agtatattat ggcacaccta aatggcataa ggcagagaca cacctgttct
     6421 gtgcaacaga aaatgattcc ttatgggtaa caactagttg tgttcccagc ttgttgcact
     6481 atgaagagca accaattccg aacataacat ggaatttcac aggtcccatg gaagaaaatg
     6541 aggtagtaat gcaagcatgg ggagctatct cctccatgat agacgcagta ttaaaacctt
     6601 gtgtgaaact gaccccatac tgtgtcaaga tgcagtgtac aaaaggaaaa gaccttgcta
     6661 cccctatacc cactacatcc accacaacta ccacaactac caccaagacg gtggcaaata
     6721 ctactgagtt ggacatagac accaataaca ctgaaactac aacacaacag aacagggtct
     6781 gtaaattcaa tactacagga ttatgtaggg attgcaaatt ggagatagaa gaaaatttta
     6841 gatatgaaga tgtaacttgt acaaatggca caaataacac atattcttgt tatatgacac
     6901 aatgcaatac atcagtaata acccaggact gtaataaagc atccacagat gaaataaaat
     6961 ttagactgtg tgcacctcca ggatatgttc tcttgaggtg cctagaaaga ttgaatgtct
     7021 ctaaaaaatg taccaatatc acagcagtac agtgtacaca gccattgcca gccaccacct
     7081 caactatgtg tggatctagt gggacaaaac atgattataa tgaattaata cagacaaata
     7141 caaagaaagg caaagaggag tttcatgacc ataagtatgt gtatagagta gatgagaagt
     7201 acaacttaca agtagtatgt agaagaaaag gaaacagatc tgtgatctca acacctagtg
     7261 caacgggatt gatcttttat agtgggttag aaccagggaa aaatcttaag aaaggtatgt
     7321 gtcagttgaa gggacaatgg ggaatagcca tgcatgatct agcaatagaa ttaagaaaaa
     7381 tagacagctc catatggaga aatgtaacaa agggctattg caaggggtta aaaagaaagg
     7441 aaaatagaac gggttgtgcc cttaaaacaa taaaggtctc tgactacacc acgaaaggcg
     7501 aaccaggagc agaaactatt atgctcctct gtggaggaga atacttcttt tgtaattgga
     7561 caaaaatttg gagaacatgg aatgatcaaa attcatcagt atggtatcca tggatgtcat
     7621 gtaatattag acaaataata gatgattggc ataaagtagg aaagaagatt tatatgcctc
     7681 ctgtatctgg atttaataat gagataagat gttctaatga tgtaacagaa atgttctttg
     7741 aggttcaaaa gacagaagag ggatacatca tcaaatttgt gccacaagat gaggtacaaa
     7801 accgatttac agcggtagga gcacactatc aactagtaaa agtggaccca attggctttg
     7861 ctcctacaga agtggcaaga tatcatctgc cagaagctag gcagaagagg ggagcggtct
     7921 tgcttgggat gttcggcctc ctaggtttgg caggttccac gatgggctca gtggcggtgg
     7981 ccctgactgt ccagtctcag gctttgttga atgggattgt ggagcagcag aaggttctgc
     8041 tgagcctgat agatcagcac tccgagttat taaaactaac tatctggggt gtaaagaatc
     8101 ttcaggcccg ccttacagcc ttggaggact atgtagctga tcaagcaaga ctatccatgt
     8161 ggggctgctc attcgcccag gtatgccaca cacatgtacc atggccaaat gactctataa
     8221 caccaaattg gacctcagag acatggctgg aatgggataa aagagtaaca gctctaactg
     8281 acaatatgac agtaaactta cagaaggcat atgaattgga gcaaaagaat atatatgagc
     8341 tagaaaaatt aggagattgg acttcctggg ctagctggtt cgactttacg tggtggctta
     8401 aatatgttaa gataggttta ctaatagtaa tagtgattat agtgttaagg attttagctt
     8461 gcttatggtc agtcttagga aagtttaggc agggttatcg ccctcttcct tatgtcttca
     8521 agggagacta tctccgtccc cacaacctca aacagccagg caaagaaaga gaagaagagc
     8581 ccgactcaga aaaacagagt accaaatcag acagctccaa agtagaattt gggaagcctt
     8641 ggagcaaaga gcaaatcaga gattggctga agacttcaag gggctacgtg tggctgaaga
     8701 atctacaagc agtaattgaa tatgggtggc aagagctcaa aacagcagga ggaaaaatat
     8761 ttaaagtact acaaggctat gcgcaggggc tatggagcag agggcaccaa tggggactat
     8821 caacagctgc atgcttcaga gccattgcta ggggcattat caacatccca agaagaattc
     8881 gacagggagc agaagtcctc ctcaactgac gaagaggaag aaacgggctt tccagtatat
     8941 ccacagtgcc cagtaagaga acccacctac aaggacttgg ttgatatgcc ccacttttta
     9001 aaagaaaagg ggggactgga agggatttgg cattctaaaa gaagagaaga gatcttggac
     9061 ttatatgctc aaaatgaatg gggattcatt cctacctggc aatcttatac tgatggccca
     9121 gggataagat acccgaagac atttaggttc ttattcaagc tttgcccggt ggcagtgcct
     9181 ccagaccagg agaacaatga gtgtaacaaa ttgctccagt cctctcagct gggaatccag
     9241 gaagaatcct tggggagaga ggctagtgtg gaagtttgac tctggccttg cttacacctt
     9301 ttatgccccc ataaagagac caggtgaatt caagcatgtg caaagcatca gccatattgc
     9361 ttatgctaag gagcataagc cagagtgctg caagaggaag tggtggcagt tctagccgac
     9421 cacagaaggt tgccatggag atgacctgca gaaatgctga ctctggaggg actttccact
     9481 agtgcatgcg cactagactg gggacttttc cagactga
//
DBGET integrated database retrieval system