GenomeNet

Database: RefSeq
Entry: NC_005337
LinkDB: NC_005337
Original site: NC_005337 
LOCUS       NC_005337             134431 bp    DNA     linear   VRL 20-DEC-2020
DEFINITION  Bovine papular stomatitis virus, complete genome.
ACCESSION   NC_005337
VERSION     NC_005337.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Bovine papular stomatitis virus
  ORGANISM  Bovine papular stomatitis virus
            Viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota;
            Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae;
            Parapoxvirus.
REFERENCE   1  (bases 1 to 134431)
  AUTHORS   Delhon,G., Tulman,E.R., Afonso,C.L., Lu,Z., de la
            Concha-Bermejillo,A., Lehmkuhl,H.D., Piccone,M.E., Kutish,G.F. and
            Rock,D.L.
  TITLE     Genomes of the parapoxviruses ORF virus and bovine papular
            stomatitis virus
  JOURNAL   J. Virol. 78 (1), 168-177 (2004)
   PUBMED   14671098
REFERENCE   2  (bases 1 to 134431)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JAN-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 134431)
  AUTHORS   Kutish,G.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-SEP-2003) African Swine Fever Research, Plum Island
            Animal Disease Center, U.S. Department of Agriculture, Agricultural
            Research Service, P.O. Box 848, Greenport, NY 11944-0848, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AY386265.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..134431
                     /organism="Bovine papular stomatitis virus"
                     /mol_type="genomic DNA"
                     /strain="BV-AR02"
                     /isolate="ORFB"
                     /isolation_source="three week old calf with oral lesions,
                     then passaged in primary lamb kidney cells"
                     /db_xref="taxon:129727"
                     /country="USA: Arkansas"
     gene            complement(513..956)
                     /locus_tag="BPSVgORF001"
                     /db_xref="GeneID:2947905"
     CDS             complement(513..956)
                     /locus_tag="BPSVgORF001"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein; contains a twin-arginine
                     translocation (Tat) signal; The Tat pathwayis involved in
                     transporting folded proteins across energy-transducing
                     membranes; Viruses of the genus parapoxvirus cause
                     localized diseases in large and small ruminants; the
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957911.1"
                     /db_xref="GeneID:2947905"
                     /translation="MSALRRLAAAAALVALGLLLGALFRPAAPALPAAFVEPGPARAD
                     GSAELVCLVVGGAQHMAAVEAAGAALSPAYPAAAGVRASFASARKGPLLLQEVTVAVQ
                     DVAALDADAEFACVAFAGGFRAAAAYARPVAEWRRQLERLRREEL"
     misc_feature    complement(552..887)
                     /locus_tag="BPSVgORF001"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02708"
                     /db_xref="CDD:177484"
     gene            complement(1097..2587)
                     /locus_tag="BPSVgORF003"
                     /db_xref="GeneID:2947906"
     CDS             complement(1097..2587)
                     /locus_tag="BPSVgORF003"
                     /note="ankyrin-like protein; although the function of the
                     ankyrin-like protein is not completely understood, it is
                     highly conserved throughout the Orthopoxvirus genus; it
                     may be critical for overcoming cellular restriction
                     factors; the ankyrin-like protein of the modified vaccinia
                     virus ankara interacts with Skp1a, a member of the
                     Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="ankyrin-like protein"
                     /protein_id="NP_957912.1"
                     /db_xref="GeneID:2947906"
                     /translation="MESALYDYFFTRGPDVRASEVRQLLSLGADVNFTGGFGNTALHT
                     YLHYDGPDPEVVRCLLEAGAHVDAVDRCCGALAPELYLLNSKSFDAELFAKLLFGPRT
                     DTAFREFLSKVLYGAVVHRPFDQTTERVVDTLVALGADVNARGVVDRTPLHACLTGLA
                     ARADTVRLLLRHGADLNSMDVYSMTPMAVLLRSSDATLELVRLLADAGSDMRTTDFRC
                     NTLLHQHAESYRPRPAIFEELISRGCDPLATNVFGNTPLHSMATISSCKNTLLQPFVR
                     AGLDIDALNVRYGASPLHFATGHRNDAAAAKLVAAGARIDLRSRNGITPLDNIVAHNL
                     GRAMRAVIKRSPPAHEVADALARAEVTVPTETTRQCVAYVVAHLGAAALADPDKHAHA
                     DFIRICLADTAVLRTVTFGDPLCSALDLLRRRMDNLPADPPPRAILRLIARLVVYGPD
                     LRERVVEMRARAALAHRLAGRSAGALPAELVARVLRLLPAAALRRL"
     misc_feature    complement(1100..2587)
                     /locus_tag="BPSVgORF003"
                     /note="ankyrin-like protein; Provisional; Region:
                     PHA03095"
                     /db_xref="CDD:222980"
     misc_feature    complement(2078..2527)
                     /locus_tag="BPSVgORF003"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(2378..2479)
                     /locus_tag="BPSVgORF003"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(order(1943..1945,1970..1972,1979..1981,
                     1991..1996,2012..2020,2036..2038,2042..2044,2048..2050,
                     2075..2077,2084..2086,2096..2101,2114..2122,2129..2131,
                     2141..2143,2147..2149,2153..2155,2180..2182,2189..2191,
                     2216..2221,2225..2233))
                     /locus_tag="BPSVgORF003"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    complement(1814..2164)
                     /locus_tag="BPSVgORF003"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(2048..2149)
                     /locus_tag="BPSVgORF003"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(1943..2044)
                     /locus_tag="BPSVgORF003"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(1589..1948)
                     /locus_tag="BPSVgORF003"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(1838..1939)
                     /locus_tag="BPSVgORF003"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(1733..1834)
                     /locus_tag="BPSVgORF003"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     gene            complement(2656..4215)
                     /locus_tag="BPSVgORF004"
                     /db_xref="GeneID:2947907"
     CDS             complement(2656..4215)
                     /locus_tag="BPSVgORF004"
                     /note="ankyrin-like protein; although the function of the
                     ankyrin-like protein is not completely understood, it is
                     highly conserved throughout the Orthopoxvirus genus; it
                     may be critical for overcoming cellular restriction
                     factors; the ankyrin-like protein of the modified vaccinia
                     virus ankara interacts with Skp1a, a member of the
                     Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="ankyrin-like protein"
                     /protein_id="NP_957913.1"
                     /db_xref="GeneID:2947907"
                     /translation="MDHPVMEDAVMEDGVEAALYNYFCLCPRVSARAVRTLLKMGADV
                     NYTGPLDKTPLHAYLHTGGPKDVRIVQALLKAGAYVDVYERCCSSTPLHLYLRLAVVD
                     LRVLKTLMRGRCQTIDILLSSRFMSSLLREYVLNRDFSACSWEVMEFLVRAGANVNDG
                     IGFTRTLLHACMGVRTNVFMVNSILKLGADVRARDVYGATPLGALLKSPSACVELVEL
                     LVAAGSDVCTVDARHNNLLHQHAQSRRPSAAVIRRLIELGCDPTALNSSGNTPLHLMA
                     AHTSCKRSLIQPFLDAGVAVDVRNARYDTTPLHVAAAHRNDKACARLLALGADVTLRS
                     FTGKTPLAHMIVNDHITCIDRALDARPAAVAVAESLAVAEVRGVRASRRCVAYVVAHI
                     GAHALPEPVRQSQAAFVAECEAETALMRAVRVGTPATPLLDVVCSRTPPATLVRRRSA
                     KSLKILSIYRDVLQQRLVHMRHRSALVDSLVMRIGPCPLPADVVALVLLRVPTPQLRT
                     SCGLDDSFCMN"
     misc_feature    complement(2671..4203)
                     /locus_tag="BPSVgORF004"
                     /note="ankyrin-like protein; Provisional; Region:
                     PHA03095"
                     /db_xref="CDD:222980"
     misc_feature    complement(3610..4086)
                     /locus_tag="BPSVgORF004"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(3964..4068)
                     /locus_tag="BPSVgORF004"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(3631..3729)
                     /locus_tag="BPSVgORF004"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(3244..3639)
                     /locus_tag="BPSVgORF004"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(3526..3627)
                     /locus_tag="BPSVgORF004"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(3421..3507)
                     /locus_tag="BPSVgORF004"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(order(3241..3243,3250..3252,3262..3267,
                     3271..3279,3286..3291,3301..3303,3307..3309,3316..3318,
                     3343..3345,3352..3354,3364..3369,3379..3387,3394..3399,
                     3409..3411,3415..3417,3421..3423,3448..3450,3457..3459,
                     3469..3471,3478..3480,3484..3492,3499..3504))
                     /locus_tag="BPSVgORF004"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    complement(3316..3417)
                     /locus_tag="BPSVgORF004"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(<3133..3312)
                     /locus_tag="BPSVgORF004"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(3217..3309)
                     /locus_tag="BPSVgORF004"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     gene            complement(4331..4627)
                     /locus_tag="BPSVgORF005"
                     /db_xref="GeneID:2947908"
     CDS             complement(4331..4627)
                     /locus_tag="BPSVgORF005"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF005 hypothetical protein"
                     /protein_id="NP_957914.1"
                     /db_xref="GeneID:2947908"
                     /translation="MSGTPRYGMYDQGGNYKGTANDPGGACKRPHSLSSGGGSSDGSG
                     WGSMWGGPPAKKHCGGGGGGIFAGMYGGSGGSGGICGGVKGGVSGGINGGISKI"
     misc_feature    complement(<4535..4627)
                     /locus_tag="BPSVgORF005"
                     /note="Orthopoxvirus C10L protein; Region: Orthopox_C10L;
                     pfam07020"
                     /db_xref="CDD:115660"
     gene            complement(4904..5362)
                     /locus_tag="BPSVgORF006"
                     /db_xref="GeneID:2947897"
     CDS             complement(4904..5362)
                     /locus_tag="BPSVgORF006"
                     /note="vascular endothelial growth factor like protein;
                     causes marked vascularization and the proliferation of
                     endothelial cells in the teats of infected sheep, goats
                     and cattle; binds to mammalian VEGFR-1; Viruses of the
                     genus parapoxvirus cause localized diseases in large and
                     small ruminants; the poxviridae are enveloped unsegmented
                     dsDNA viruses; unlike many dsDNA viruses that replicate in
                     the host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="vascular endothelial growth factor like protein"
                     /protein_id="NP_957915.1"
                     /db_xref="GeneID:2947897"
                     /translation="MKCLIVCMQWSLALLLCLQCVKWMQAAPTSSNGNHEVEKWSDVY
                     DNSRCQPMKTPVKVSDEYPDNTNDRHSPPCVTLMRCGGCCNDESLECVPTETSNVTMQ
                     IMTTSAYNDGGTSGGISSGMREMSFLQHNKCECRPKSTPPPETTEESHRR"
     misc_feature    complement(4910..5359)
                     /locus_tag="BPSVgORF006"
                     /note="vascular endothelial growth factor like protein;
                     Provisional; Region: PHA02661"
                     /db_xref="CDD:177444"
     misc_feature    complement(4952..5224)
                     /locus_tag="BPSVgORF006"
                     /note="Platelet-derived and vascular endothelial growth
                     factors (PDGF, VEGF) family; Region: PDGF; smart00141"
                     /db_xref="CDD:197537"
     misc_feature    complement(order(5042..5053,5096..5107,5111..5113,
                     5213..5224))
                     /locus_tag="BPSVgORF006"
                     /note="receptor binding interface; other site"
                     /db_xref="CDD:238079"
     misc_feature    complement(order(4958..4960,4964..4966,5090..5092,
                     5111..5113,5123..5125,5216..5218))
                     /locus_tag="BPSVgORF006"
                     /note="cysteine knot motif; other site"
                     /db_xref="CDD:238079"
     misc_feature    complement(order(5114..5116,5141..5143))
                     /locus_tag="BPSVgORF006"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238079"
     gene            complement(5458..5949)
                     /locus_tag="BPSVgORF007"
                     /db_xref="GeneID:2947898"
     CDS             complement(5458..5949)
                     /locus_tag="BPSVgORF007"
                     /note="ORF007 dUTPase; hydrolyzes dUTP to yield dUMP and
                     pyrophosphate thereby facilitating dTTP synthesis from the
                     dUMP; similar to Vaccinia virus strain Copenhagen F2L;
                     Viruses of the genus parapoxvirus cause localized diseases
                     in large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; Orf virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="ORF007 dUTPase"
                     /protein_id="NP_957916.1"
                     /db_xref="GeneID:2947898"
                     /translation="MEFVENHFACDALRVVRLSPNATLPTRGSPRAAGYDLCSACDCI
                     VPAGGRRVVFTDLQIQLPDGCYGRVAPRSGLAVKHFIDVGAGVIDADYRGNVGVVLFN
                     FGHNDFEVKTGDRIAQLICERAAFPDVEEVACLDDTERGAGGFGSTGVRTERCRTTVW
                     YVN"
     misc_feature    complement(5461..5949)
                     /locus_tag="BPSVgORF007"
                     /note="ORF007 dUTPase; Provisional; Region: PHA02703"
                     /db_xref="CDD:165079"
     misc_feature    complement(order(5596..5598,5608..5610,5617..5631,
                     5641..5643,5647..5649,5653..5655,5659..5661,5680..5682,
                     5689..5691,5701..5709,5725..5742,5746..5748,5794..5796,
                     5800..5805,5818..5820,5848..5853))
                     /locus_tag="BPSVgORF007"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(5659..5664,5674..5676,5683..5691,
                     5728..5736))
                     /locus_tag="BPSVgORF007"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            complement(6025..7581)
                     /locus_tag="BPSVgORF008"
                     /db_xref="GeneID:2947899"
     CDS             complement(6025..7581)
                     /locus_tag="BPSVgORF008"
                     /note="ankyrin-like protein; although the function of the
                     ankyrin-like protein is not completely understood, it is
                     highly conserved throughout the Orthopoxvirus genus; it
                     may be critical for overcoming cellular restriction
                     factors; the ankyrin-like protein of the modified vaccinia
                     virus ankara interacts with Skp1a, a member of the
                     Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="ankyrin-like protein"
                     /protein_id="NP_957917.1"
                     /db_xref="GeneID:2947899"
                     /translation="MLSRESVFSSHEDLLFRYLETGSPVDLDVVRALVATDADVNFRG
                     EYGRTPLHLCVLVARNANCADIVETLLEAGADVNARDVCGYTPLHCYVQHDYVQLRVV
                     ETMLAAGAEVRTEGGFVFYDNVLSSFLASCGSTGSEADIVRVLIRAGADVRESDAYDM
                     TALHVYARNPAARPDVLGLMLEAGADVRAMDKHGVTPLAVLLSSTGVNDELVAMMLRA
                     GADPRARDMDGRTLLHHLATVPRAKESIMRTLVDSGCDPAGIDTGGNTALHYMAMYGT
                     CRRPVVSFLLEKGLDMDRQNDAGQTALYRAAVFNPAACRRLIQMGADLAPVAATGFCA
                     VAEVFRRNDFKSAAALLERKPPIDLLVRALVTATNWGFFFPDSEAALLCVHSLVARGA
                     GERVRAEPVLGKYADAVRECEAEIRAMREVRCNADTTLLDVLRADESAKAVHVPNALL
                     DRVHAFKVYGNALFGKVCMMRLRMSLAEHVAGLLCPCALPPEIVTSILSYMSYEELMG
                     LRTALLAPAR"
     misc_feature    complement(6037..7581)
                     /locus_tag="BPSVgORF008"
                     /note="ankyrin-like protein; Provisional; Region:
                     PHA03095"
                     /db_xref="CDD:222980"
     misc_feature    complement(6934..7461)
                     /locus_tag="BPSVgORF008"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(7339..7446)
                     /locus_tag="BPSVgORF008"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(7252..7335)
                     /locus_tag="BPSVgORF008"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(7009..7110)
                     /locus_tag="BPSVgORF008"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(6628..7017)
                     /locus_tag="BPSVgORF008"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    complement(6904..7005)
                     /locus_tag="BPSVgORF008"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(6817..6900)
                     /locus_tag="BPSVgORF008"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(6694..6795)
                     /locus_tag="BPSVgORF008"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    complement(6616..6690)
                     /locus_tag="BPSVgORF008"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     gene            complement(7713..9110)
                     /locus_tag="BPSVgORF009"
                     /db_xref="GeneID:2947900"
     CDS             complement(7713..9110)
                     /locus_tag="BPSVgORF009"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein; Similar to Vaccinia virus
                     strain Copenhagen F11L and Molluscum contagiosum virus
                     MC018L; Viruses of the genus parapoxvirus cause localized
                     diseases in large and small ruminants; the poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins; Orf
                     virus and BPSV are capable of infecting humans but usually
                     infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957918.1"
                     /db_xref="GeneID:2947900"
                     /translation="MTWCGLARMSSFTSLFRRLSYGRSSCVPRTGCMPMRRPRIRSND
                     EDSEYDDNVPYGGDPDSVDAAAPVARPLVLTVPGASRPVLVDSVFERIIPDVSALVTH
                     LGEWTEIRLFESPFHRAPVRVCRSVLARYIYDAEAMFEVKDCQALKLRHGEWYMRQKV
                     SPDMASFVALICIRNEGVAALAVNNTKYLNTNITVGSAIVFPAVRGMFLLPHIGGEAE
                     YIILTMTPTQDLLDQGYDVFSPSVDQDAQIRTASAAETRKRACVLVSDLITLRIELEE
                     CYHRICKLMIVISEFGDLYSNVGAKMITESVDAIAKGMGSVDVGGENCEVDGVASAVA
                     LCRRASSRSRRRPVSVSMNRSHSLLNIGLNNLFAMFAQCANGTPHPDSLMARMEKDLQ
                     DMYARFTELWDTVLEKAADLDSTLPRTEVLEKFIHLQVCNSPAGIERNQLVQRLTMLA
                     GSGYRLTGSGEGVPV"
     misc_feature    complement(7716..9110)
                     /locus_tag="BPSVgORF009"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02699"
                     /db_xref="CDD:165075"
     gene            complement(9147..11078)
                     /locus_tag="BPSVgORF010"
                     /db_xref="GeneID:2947887"
     CDS             complement(9147..11078)
                     /locus_tag="BPSVgORF010"
                     /note="EEV maturation protein; similar to vaccinia virus
                     strain Copenhagen F12L; facilitates the transport of
                     intracellular viral particles to the cell membrane; in its
                     absence particles are assembled but remain intracellular
                     and do not traffic to cell membrane; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="EEV maturation protein"
                     /protein_id="NP_957919.1"
                     /db_xref="GeneID:2947887"
                     /translation="MLGFWGKVCNSLTSKQAWDEQLVATDLVPGEYALAKARDGKTII
                     FDAQSVRDAAIVLPSLKSTRITCTFVDPHRDALDPPAASTQRFAIVSRDDPACYIPES
                     SSPFLDILRRRSEDEPELLAAFEENPPPAGARSIDELNQWLSDAGLYHLRMVSTDAVR
                     RLGTPVRKQTLLDIMNVCYVGVYAIWVKDPASYTRPDTEVLAHDARTAAQASSWAQPH
                     LHSPSTSCVAAWFCYRCGGDGRVQLHSIVMNTGMVFRGPSARMVVRELLMWLATCKEH
                     MTVYGFYSSFFDSRQVFALAGKGWTRLSENTLLSKLGNRVTFVDLARFAPGTLFSEYC
                     EFWGGACVEVPEDIVPDDENPAVAEDAASVAAQALMDAARSHQAALARIFPSCDMAAF
                     NGLREMVLGNAARGCGACPMHSSALDMVNAALFIEEAGANPAPADARCFRLSSPLREA
                     ASKRYPAGKPHFVTELTRGLLSIALCEVERSPEVRIPVLFDPDDEDQLRFSVVLTSVD
                     IETANRLKGYSIRVIAALEWGRSEEVLRTGIEAQMAATRELNIPQTSNLMSRIASMPL
                     PLDPDSSPSGRSSAVVRAFAASYCRSTIHSLIERVDSHFSGNFVVRHGYDRFWVRDRV
                     AKHLTGVSGIQEVLPAVAR"
     misc_feature    complement(9165..11069)
                     /locus_tag="BPSVgORF010"
                     /note="EEV maturation protein; Provisional; Region:
                     PHA02952"
                     /db_xref="CDD:222950"
     gene            complement(11155..12291)
                     /locus_tag="BPSVgORF011"
                     /db_xref="GeneID:2947888"
     CDS             complement(11155..12291)
                     /locus_tag="BPSVgORF011"
                     /note="palmytilated EEV membrane glycoprotein; similar to
                     vaccinia virus strain Copenhagen F13L; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="palmytilated EEV membrane glycoprotein"
                     /protein_id="NP_957920.1"
                     /db_xref="GeneID:2947888"
                     /translation="MWPFSSIPVGAECRVVETLPAEVSSLQVGNMSTFECFSAIVESA
                     TKFLYIASFCCNLGSTREGVDVKDKLCTLAKSGVNVTVLVDVQSKDRDAEELREAGVN
                     YYKVKVSGRDDVGNLLGSFWISNAGQWYVGSASLTGGSISNIKNLGVYSTNRHLATDL
                     MNRYNTFYSMIVEPKVPFSRLCCAMITPTATDFHLDHAGGGVFFSDAPEKFLGFYRTL
                     DEDLVLHRIDSAKNSIDLSLLSLVPVIRHADRVEYWPRIMDALLRAAIDRSVRVRVIV
                     TEWKNADPLSVSAARTLNDFGVGSIDISTRLFSIPGRDDAANNTKLLIVDDTFAHVTV
                     ANMDGTHYKYHAFVSVNAEKGDIVNQLSAVFERDWRSQYCKPIN"
     misc_feature    complement(11158..12291)
                     /locus_tag="BPSVgORF011"
                     /note="palmytilated EEV membrane glycoprotein;
                     Provisional; Region: PHA03003"
                     /db_xref="CDD:177506"
     misc_feature    complement(11833..12249)
                     /locus_tag="BPSVgORF011"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:301585"
     misc_feature    complement(order(11854..11856,11887..11889,11893..11895,
                     11932..11934,11938..11940))
                     /locus_tag="BPSVgORF011"
                     /note="putative active site [active]"
                     /db_xref="CDD:197200"
     misc_feature    complement(11938..11940)
                     /locus_tag="BPSVgORF011"
                     /note="catalytic site [active]"
                     /db_xref="CDD:197200"
     misc_feature    complement(11353..11862)
                     /locus_tag="BPSVgORF011"
                     /note="Catalytic domain of phospholipase D superfamily
                     proteins; Region: PLDc_SF; cl15239"
                     /db_xref="CDD:301585"
     misc_feature    complement(11269..11349)
                     /locus_tag="BPSVgORF011"
                     /note="Phospholipase D. Active site motifs; Region: PLDc;
                     smart00155"
                     /db_xref="CDD:197546"
     misc_feature    complement(order(11260..11262,11284..11286,11290..11292,
                     11329..11331,11335..11337))
                     /locus_tag="BPSVgORF011"
                     /note="putative active site [active]"
                     /db_xref="CDD:197206"
     misc_feature    complement(11335..11337)
                     /locus_tag="BPSVgORF011"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:197206"
     gene            complement(12312..12569)
                     /locus_tag="BPSVgORF012"
                     /db_xref="GeneID:2947889"
     CDS             complement(12312..12569)
                     /locus_tag="BPSVgORF012"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF012 hypothetical protein; unknown function;
                     Viruses of the genus parapoxvirus cause localized diseases
                     in large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; Orf virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957921.1"
                     /db_xref="GeneID:2947889"
                     /translation="MRVHGARRNLDEVIDQLLDDMQIDGDIFPEVPDCTPEDMVDALD
                     NFLEDINYKNECCLLSQEEMDELLVEIEDMMKLLSDGMKQS"
     misc_feature    complement(12324..12569)
                     /locus_tag="BPSVgORF012"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02698"
                     /db_xref="CDD:177480"
     gene            12910..13131
                     /locus_tag="BPSVgORF013"
                     /db_xref="GeneID:2947890"
     CDS             12910..13131
                     /locus_tag="BPSVgORF013"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF013 hypothetical protein; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957922.1"
                     /db_xref="GeneID:2947890"
                     /translation="MCLCGIFFPCAEWLVRRVNRLIIWVRRRVGGEPAYVSVVQACDD
                     YFTEDEFDAQQSVSLLRAGAEAATPIARV"
     misc_feature    12910..13128
                     /locus_tag="BPSVgORF013"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02696"
                     /db_xref="CDD:222921"
     gene            complement(13212..13493)
                     /locus_tag="BPSVgORF014"
                     /db_xref="GeneID:2947891"
     CDS             complement(13212..13493)
                     /locus_tag="BPSVgORF014"
                     /note="similar to Molluscum contagiosum virus MC026L"
                     /codon_start=1
                     /product="ORF014 modified RING finger protein"
                     /protein_id="NP_957923.1"
                     /db_xref="GeneID:2947891"
                     /translation="MPIKVKSWKVAVKCSLACPPVCYICSKKASEGCLNAACPGACPF
                     VVMVCGHGYHRHCLGPANTDVCFVCRSVLQKADIPDETASDAVIREFML"
     gene            complement(13500..15110)
                     /locus_tag="BPSVgORF015"
                     /db_xref="GeneID:2947909"
     CDS             complement(13500..15110)
                     /locus_tag="BPSVgORF015"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Molluscum contagiosum virus MC027L"
                     /codon_start=1
                     /product="ORF015 hypothetical protein"
                     /protein_id="NP_957924.1"
                     /db_xref="GeneID:2947909"
                     /translation="MDEELILLLGFAMDSEMPLSHMNKLRRRLTKLRMNSFAVIMCLR
                     EAILRKAWLPSGSILGTDISDDVRLLEFVVSEVDSARENIEPYLVTVQWTHNADIFDE
                     CMREAMEALFGDSVQRLAMGVVESRYPHLVAERCNSCLAALMPEDASVRFVNAILRYS
                     GNMAGAIVDRSREAGSHEELADMVRQQHASKIRMWPRVVGAVVARVVEMDIEGLKTYC
                     RTCLLAARFSAGGLLDVIKDHLAGIVVECIDSHINERNLERALSLYIHFHSAIVREGL
                     HATVLTKLSGKALYSAAISADPCDTDTLLSYIARLPKDELADFVRVATARIVKSLYTE
                     VGLEKHLSLKIAMERYPQMVSPSLNDLSRKYMAGTLRIPLLSPPSPMEHDGAAPAHDP
                     TMTLVPVNVYTLPTTVPEAELTPPESLRGALERALDRADTSYDLAPLAAFGRAEITLT
                     TSHGDLDVICSTAHLVCLALMEEAGKTGVTIEEVALSLGGDARLAEMALLGLCRNKIA
                     KRRTVDSVKRFTLNTRREVLDSPVLVFI"
     gene            complement(15198..15947)
                     /locus_tag="BPSVgORF016"
                     /db_xref="GeneID:2947910"
     CDS             complement(15198..15947)
                     /locus_tag="BPSVgORF016"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF016 hypothetical protein; unknown function;
                     Similar to Vaccinia virus strain Copenhagen F16L and
                     Molluscum contagiosum virus MC029L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957925.1"
                     /db_xref="GeneID:2947910"
                     /translation="MDESDEISRRMAMIITTSRMQSMGDTIRQEEICRQFCSKHGMFP
                     AVTVRVTGVVSADAIGQDTWDLARSHDVRHVVLFKASVVDWRIAELFLEFGDKLCEIY
                     TLSFVVDGFHYDGSASPFKPVDGMETMLRCVLRDVLDDAGGGAVVPRAPSVASQCLLD
                     RYLVPFGGLLAMYNHFTGVHSQVPSARLEASRGRSVRRAIFHGYADTETYNQMLAEAR
                     RHNVRRRRRQDRFDLLAVCRSLDCMTLDGDE"
     misc_feature    complement(15204..15947)
                     /locus_tag="BPSVgORF016"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02697"
                     /db_xref="CDD:222922"
     gene            16259..16576
                     /locus_tag="BPSVgORF017"
                     /db_xref="GeneID:2947911"
     CDS             16259..16576
                     /locus_tag="BPSVgORF017"
                     /note="ORF017 DNA-binding phosphoprotein; important for
                     virion morphogenesis; required for the proteolytic
                     processing of virion structural proteins; Similar to
                     Vaccinia virus strain Copenhagen F17R; Viruses of the
                     genus parapoxvirus cause localized diseases in large and
                     small ruminants; the poxviridae are enveloped unsegmented
                     dsDNA viruses; unlike many dsDNA viruses that replicate in
                     the host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF017 DNA-binding phosphoprotein"
                     /protein_id="NP_957926.1"
                     /db_xref="GeneID:2947911"
                     /translation="MEAGGVHKRPFIVNVEGQGRVLVLRYVKLCEVPEARCEAPRTSC
                     VLKVDPPKSPVCDRRPVPLSPTACVRTPPGSPGATPFMPTNMLESLFTRAKTNGEQAC
                     RRQ"
     misc_feature    16259..16573
                     /locus_tag="BPSVgORF017"
                     /note="ORF017 DNA-binding phosphoprotein; Provisional;
                     Region: PHA02700"
                     /db_xref="CDD:177481"
     gene            complement(16595..18040)
                     /locus_tag="BPSVgORF018"
                     /db_xref="GeneID:2947947"
     CDS             complement(16595..18040)
                     /locus_tag="BPSVgORF018"
                     /note="poly(A) polymerase large subunit; catalyses
                     template-independent extension of the 3'-end of a DNA or
                     RNA; The poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins"
                     /codon_start=1
                     /product="poly(A) polymerase large subunit"
                     /protein_id="NP_957927.1"
                     /db_xref="GeneID:2947947"
                     /translation="MAPPVIEEYLGSRPSMERCVLLRAQRRAMTRVLNFDRKLFLSLV
                     VKSRRRFFKKLGGSEKEIAARIEEYFTRQTRLEKLGQILTVLELQSVIVTEFTKTVGS
                     LTSPMPAINAAVRRVDVSPAKDLTRRALESYMVLQPPAGEPAAMARHKHSDLVDVVKR
                     LMKEHLRRNNKRCVCYGSYSLHLLNPEIEYGDIDMVQTNARPFLINLAFLIYFVTGRQ
                     TVLLRVPYLKSYVVLQDEEGGHILDSFNVRQATLRALPTLQVDNIYILHPFVQLMAAL
                     KMFSQTDRIFDLVENFDKARARMETLLAFAMEELECRPPVAEPSDRMPLPCAFARPAD
                     PDESAGSRVLEVDASAHAFGFSRAVVFLDEPVLVQKILDLGVPEDDIVDFESVSNSAF
                     LVHGDTLYTHFSNTVLMDGDAVHDISRRAVTAHIVMFLLLTRHPAAEAAVREMLSTLV
                     STGRRVTAVVERSKKSGTHGVIDITRNVITH"
     misc_feature    complement(16598..18040)
                     /locus_tag="BPSVgORF018"
                     /note="poly(A) polymerase large subunit; Provisional;
                     Region: PHA02996"
                     /db_xref="CDD:177503"
     misc_feature    complement(17729..18028)
                     /locus_tag="BPSVgORF018"
                     /note="Poxvirus poly(A) polymerase N-terminal domain;
                     Region: Pox_polyA_pol_N; pfam12630"
                     /db_xref="CDD:289402"
     misc_feature    complement(17234..17683)
                     /locus_tag="BPSVgORF018"
                     /note="Poxvirus poly(A) polymerase nucleotidyltransferase
                     domain; Region: Pox_polyA_pol; pfam03296"
                     /db_xref="CDD:281312"
     misc_feature    complement(16601..17227)
                     /locus_tag="BPSVgORF018"
                     /note="Poxvirus poly(A) polymerase C-terminal domain;
                     Region: Pox_polyA_pol_C; pfam12629"
                     /db_xref="CDD:289401"
     gene            complement(18051..20228)
                     /locus_tag="BPSVgORF019"
                     /db_xref="GeneID:2947948"
     CDS             complement(18051..20228)
                     /locus_tag="BPSVgORF019"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF019 hypothetical protein; unknown function;
                     Similar to Vaccinia virus strain Copenhagen E2L and
                     Molluscum contagiosum virus MC032L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957928.1"
                     /db_xref="GeneID:2947948"
                     /translation="MLHNVKSFVASAAACGSVERAFADLSVEDALSLMADGIHPKHLP
                     RKMYAPVSERFQTYLHLFRPQHVLPEDLLEELSRRRCGALFAEHIAYHTPYLVQHADY
                     ALLCRCIPFMDITEDDVRLIEERFPDDVDDVLVNVNARSVHNINAVFTDEMMEAIVEA
                     RPQMAPALYATRPLDIGFLKRMLCDHGIPPVNAGLEAASPLDAVEILARLTAVYDVRR
                     VLDGLRHSVLSSETVKAFAIERIRQGEVQAYRHYAEDYLRDRVSDIGAFGPIFVEAAT
                     YLNMDALSHAELLAIADFPNKFDATFMWNTALAKGYHDVLAKLIRLADVDAVTDDVCV
                     GIVESGHPVAVADMCVHTTRVAEACVRQKLPDIVDLLDTVPLRALLKMGADPFASDYV
                     FRTAWFNDRPELAEEYTRRFSFSGERMSRLLFGYALKPATLQRVYDTLRSEDAVSPAV
                     RESLGFLVSAGDMRLKPNHEVRRPREVDDLEEGYEQEVFSSEHSARLAACLSVYSLPG
                     LRGYATADLAITHHPSGNVILQILRAHKSDNAVNKVVDHIFDVARMARYGLFLLPDMF
                     TPGWTPVLDMARGLPASPPPVLKAERLSFSPSEMVEYRGIGRFSLGYESATGPCSDHQ
                     MAMDALFRCLFVHIALGVRLTEQVDVTVLARQVINAFTDGLCTERYTDTVEFVEQELV
                     ELRAWGPNERTIESSKVCMRNTTLLCQRVCAQFAMYNNRVFKK"
     misc_feature    complement(18054..20228)
                     /locus_tag="BPSVgORF019"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02695"
                     /db_xref="CDD:177477"
     gene            complement(20289..20876)
                     /locus_tag="BPSVgORF020"
                     /db_xref="GeneID:2947949"
     CDS             complement(20289..20876)
                     /locus_tag="BPSVgORF020"
                     /note="ORF020 dsRNA-binding PKR inhibitor; inhibits
                     IFN-mediated induction of the dsRNA-dependent protein
                     kinase to enhance viral replication; Similar to Vaccinia
                     virus strain Copenhagen E3L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF020 dsRNA-binding PKR inhibitor"
                     /protein_id="NP_957929.1"
                     /db_xref="GeneID:2947949"
                     /translation="MASCDRESKILTFLSSSGTPVPAKRVAAALGISKHDANRCLYKL
                     LESDAVSCVDGCPPLWSAPCEADEKKDTASGDDEATGGSGSDPEPMETECTYLGASLF
                     GEDIDVLTVGAVTHLKTLNPVSAVNEYCMRVHRPLVFQECRTGGHDHCPLFTCTVVVS
                     NKTVSTASGCSKKAARNAACTDALTILINNCGVSF"
     misc_feature    complement(20292..20873)
                     /locus_tag="BPSVgORF020"
                     /note="ORF020 dsRNA-binding PKR inhibitor; Provisional;
                     Region: PHA02701"
                     /db_xref="CDD:177482"
     misc_feature    complement(20679..20867)
                     /locus_tag="BPSVgORF020"
                     /note="Adenosine deaminase z-alpha domain; Region:
                     z-alpha; cl02659"
                     /db_xref="CDD:295419"
     misc_feature    complement(order(20349..20351,20358..20369,20493..20498,
                     20514..20516))
                     /locus_tag="BPSVgORF020"
                     /note="dsRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238007"
     misc_feature    complement(20316..20513)
                     /locus_tag="BPSVgORF020"
                     /note="Double-stranded RNA binding motif; Region: DSRM;
                     smart00358"
                     /db_xref="CDD:214634"
     gene            complement(20883..21482)
                     /locus_tag="BPSVgORF021"
                     /db_xref="GeneID:2947950"
     CDS             complement(20883..21482)
                     /locus_tag="BPSVgORF021"
                     /note="RNA polymerase subunit; subunit of the poxvirus RNA
                     polymerase subunit; early, intermediate and late genes are
                     transcribed by the viral RNA polymerase compex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="RNA polymerase subunit"
                     /protein_id="NP_957930.1"
                     /db_xref="GeneID:2947950"
                     /translation="MDEAKLRELAAAHVDDAAAAEIASWALICAHKFALKNIVNTKTS
                     NTEDTNFDPAHNIGIEYSKDTKNRLSYKNKRSLEVVEGDEYADLRAQVRATNGVEQDA
                     LRYVLFAVRCVAAGVPYDIDDVRDHDYGEYFNVLDEEHNLPCPSCRSKNTMPMMIQTR
                     SADEPPLIKYACKNCQKSFNPPKFCDKKPPQNPKKTSDP"
     misc_feature    complement(21060..21404)
                     /locus_tag="BPSVgORF021"
                     /note="Poxvirus DNA dependent RNA polymerase 30kDa
                     subunit; Region: rpo30_N; pfam12410"
                     /db_xref="CDD:289195"
     misc_feature    complement(20940..21059)
                     /locus_tag="BPSVgORF021"
                     /note="C2C2 Zinc finger; Region: ZnF_C2C2; smart00440"
                     /db_xref="CDD:128717"
     misc_feature    complement(order(20958..20960,20967..20969,21042..21044,
                     21051..21053))
                     /locus_tag="BPSVgORF021"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:259791"
     gene            21585..23285
                     /locus_tag="BPSVgORF022"
                     /db_xref="GeneID:2947892"
     CDS             21585..23285
                     /locus_tag="BPSVgORF022"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein; similar to vaccinia virus
                     strain Copenhagen E6R; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="NP_957931.1"
                     /db_xref="GeneID:2947892"
                     /translation="MDFIRRKYMIHAIDRNLDFMRAEFQQKVSIFSLGHVLALHYLVT
                     TFPHAVVTKDVLASTNFFVFVHMSQRCEVFDAVLRAAFDAPQLFVRALSRNFEAFSSA
                     IQAYRTACAALLQDARFMEVAARSAELAEVIGVNYDLASNPLFADGEPIRDMELVFAR
                     LFRKTEFRAVKRLAVLRLLVWAFLVKRDVGGEYADNDRQDLFTLLQKAGPVRHSGLTE
                     SIREYMFPGDKPSYWVWLNARVTSDADVYRDRNARTLYERVLSYAYSEVKQGRVNANT
                     LKLVYRLEDDTDIRGLLLQLIYDVPGDILGVVDSADEEWRQYFVRLYRENFVDGKTFT
                     ADARFRDDLFRVVAAVDPDFFEPARIREAFGADARLRERFADMDLNGAFMSHLVYGTA
                     DPDLHAAERGLGMRLYNEDSEFFIREYNTYLFLTEDDPLVLDRGALSKLSDVPRERHR
                     ELFSDSVLRYFLDAKLGTLGLVLEDYSDDVVASMLRHLRRVEDVSSFVTHAARRNAAA
                     VPGIVRAVVSNFNPAVVAAMRPFLRENLTRVEALLDGLAHLTPADKQYIRRVILQGRS
                     "
     misc_feature    21585..23282
                     /locus_tag="BPSVgORF022"
                     /note="Hypothetical protein; Provisional; Region:
                     PHA03000"
                     /db_xref="CDD:177505"
     gene            23315..24133
                     /locus_tag="BPSVgORF023"
                     /db_xref="GeneID:2947893"
     CDS             23315..24133
                     /locus_tag="BPSVgORF023"
                     /note="putative membrane protein; similar to vaccinia
                     virus strain Copenhagen E8R; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957932.1"
                     /db_xref="GeneID:2947893"
                     /translation="MVDVNTHDVDAAAQLRTPNQQTFFTKGLSPRMRHTYIYNNYAYG
                     WIPETAVWSSRLGDYSVTDFYPISLGMLKKFEFMFSLLADPGGACPAYTPKLNTEFVN
                     QGSFSGRFVNPFHRFAVLPEREYISFLLLTSVPIFNILFWFKGETFDTAKHSLVGAVF
                     TTRERHVELARYLRRTGDYKPLFSRLGNDETFDRAFSGFTRISNPTPVGRLPPSDFET
                     LANLSTILYFTRYDPVLMFLVFYVPGMSVTTKITPGVEFLMEKLSLTAEDVVLV"
     misc_feature    23315..24130
                     /locus_tag="BPSVgORF023"
                     /note="putative membrane protein; Provisional; Region:
                     PHA03004"
                     /db_xref="CDD:177507"
     gene            24187..24870
                     /locus_tag="BPSVgORF024"
                     /db_xref="GeneID:2947894"
     CDS             24187..24870
                     /locus_tag="BPSVgORF024"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF024 hypothetical protein"
                     /protein_id="NP_957933.1"
                     /db_xref="GeneID:2947894"
                     /translation="MASYDNTAFYGERTASQTRCRSPYRYADPVPANIMLPTLSLEQL
                     MEEDSLDTRDIVDGSTETAVQCLLEEFSALCPGDQITMLRCMAAAFYRNYTFVPYACL
                     QIITSRLRVMYAREVVHTADDLADVLRTADCSAFRRHRQRILEDMLDEEMDVYRYLMS
                     ANEDITEDNLLTAVETLLRRFKHLGCYRSLCMLKILALQHEDLAPFIKNRIAEIRKRA
                     HARTHTVYV"
     misc_feature    <24193..24867
                     /locus_tag="BPSVgORF024"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02694"
                     /db_xref="CDD:177476"
     gene            complement(24872..27901)
                     /locus_tag="BPSVgORF025"
                     /db_xref="GeneID:2947895"
     CDS             complement(24872..27901)
                     /locus_tag="BPSVgORF025"
                     /note="DNA polymerase; catalyzes the replication of the
                     viral genome; The poxviridae are enveloped unsegmented
                     dsDNA viruses; unlike many dsDNA viruses that replicate in
                     the host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins"
                     /codon_start=1
                     /product="DNA polymerase"
                     /protein_id="NP_957934.1"
                     /db_xref="GeneID:2947895"
                     /translation="MELKCLNWFENRSNDSRYLFLKARCSRNSVVYLRFVQHFYYVVR
                     KSALREIVQPVAWTRDLGPMSVVSIDEIVARSAKIPERERREEELCLVASVHKLSLPE
                     TFMSDFLNVSWFFVAHDIDPDGCYRVDTSALRDLGNNCFHCDDPGACFAEKIPRFNVV
                     KSCLFLDIECHFDKKFPSVFKNPVSHISFCVVDKAGAETRFTLTNSEMLSDEDLAAAA
                     RQGVPLCAEPQDVVFDAAVTLCPEVTLLRVAKRLLEMPLDFVVTFNGHNFDLRYLDSR
                     LSLLAGEHIRFRLPDGSETVNFCVYERTKTSHKGVGGVSSTTFHINNNNGTIFFDLYA
                     FIQRTEKLDSYKLDAISKNSFHCTAVVEDVGRTTTTFRGDRSTDKDGNAAVFARVLST
                     GNYVTVDEHVCRVLHKRVDDGGFTVELEDPACRSPGDVVTLSFGKDDVSLADMYANYS
                     LEVCMDMARYCLHDACLCLYLWEHYGVETKIAAAASTYLLPQSVVFEYRASTCIKGPL
                     MRLLLDNRTVMVRSDTKSKYFYEGGRVMAPKQKMYDKHVLIFDYNSLYPNVCIYGNLS
                     PETLVGVVVSDNRLEAEIAAVDIRRRFPAPRYIAVACEPRSPEFVSEVAIFDREAKGI
                     IPMLLRSFLDARAKYKKLMKSAETAVDRAIYDSMQYTYKITANSVYGLMGFRNSALFS
                     YASAKSCTAIGRNMIMYLERTLDGATVRGARLTLAARPDNPLLRDAAFEGRGAEVEID
                     AAVAGDRADETVSFRSVYGDTDSVFLEVGSADIGFSRRVGRCLERVINEYVLFENFKV
                     EFEAVYCNLIMQSKKKYTTLKYAVVDGGGSERVSKGTSETRRDVAPFHKFMIRKYKDM
                     LCRTLAEEGSRNVGVEILRSLEDELTFEFESRAMPLEWFTLSRVHHKNFKSPDNPNIA
                     LVTKYNAENAESIEIGERYFFAYVCEEGPWRRRLTNIKSYERVVDKTFALEKNERIMY
                     EVYFKRLCTEIVNLLDNKAMSTLFFEKLFGCKPVFTS"
     misc_feature    complement(24884..27901)
                     /locus_tag="BPSVgORF025"
                     /note="DNA polymerase; Provisional; Region: PHA03036"
                     /db_xref="CDD:222962"
     misc_feature    complement(27833..27901)
                     /locus_tag="BPSVgORF025"
                     /note="DNA polymerase family B exonuclease domain,
                     N-terminal; Region: DNAP_B_exo_N; pfam08452"
                     /db_xref="CDD:285628"
     misc_feature    complement(<26846..27406)
                     /locus_tag="BPSVgORF025"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:299142"
     misc_feature    complement(order(27095..27103,27110..27115,27392..27403))
                     /locus_tag="BPSVgORF025"
                     /note="active site"
                     /db_xref="CDD:176647"
     misc_feature    complement(order(27098..27103,27110..27115,27392..27400))
                     /locus_tag="BPSVgORF025"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176647"
     misc_feature    complement(26408..26851)
                     /locus_tag="BPSVgORF025"
                     /note="DNA polymerase family B viral insert; Region:
                     DNA_pol_B_3; pfam08408"
                     /db_xref="CDD:285593"
     misc_feature    complement(25256..26314)
                     /locus_tag="BPSVgORF025"
                     /note="DNA polymerase type-B family catalytic domain.
                     DNA-directed DNA polymerases elongate DNA by adding
                     nucleotide triphosphate (dNTP) residues to the 5'-end of
                     the growing chain of DNA. DNA-directed DNA polymerases are
                     multifunctional with both synthetic...; Region: POLBc;
                     cl10023"
                     /db_xref="CDD:271693"
     misc_feature    complement(order(25616..25618,25901..25903,25913..25915,
                     25994..25996,26234..26242,26249..26251))
                     /locus_tag="BPSVgORF025"
                     /note="active site"
                     /db_xref="CDD:99912"
     misc_feature    complement(order(25613..25618,25622..25624))
                     /locus_tag="BPSVgORF025"
                     /note="metal-binding site"
                     /db_xref="CDD:99912"
     gene            27931..28224
                     /locus_tag="BPSVgORF026"
                     /db_xref="GeneID:2947896"
     CDS             27931..28224
                     /locus_tag="BPSVgORF026"
                     /note="virus assembly; sulfhydryl oxidase; involved in
                     disulphide bond formation pathway; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="sulfhydryl oxidase"
                     /protein_id="NP_957935.1"
                     /db_xref="GeneID:2947896"
                     /translation="MEPRFWGRAIWTVIFIVLRRFEEHRNLELCKRQLYVICSTLPCI
                     ACRRHATAAMEKNNVLSSDDPNFVLFFFISLFNNLAFDDRFKIDPSKVRPLVP"
     misc_feature    27931..28218
                     /locus_tag="BPSVgORF026"
                     /note="sulfhydryl oxidase; Provisional; Region: PHA03005"
                     /db_xref="CDD:222961"
     gene            complement(28221..28634)
                     /locus_tag="BPSVgORF027"
                     /db_xref="GeneID:2947875"
     CDS             complement(28221..28634)
                     /locus_tag="BPSVgORF027"
                     /note="putative virion core protein; similar to vaccinia
                     virus strain Copenhagen E11L; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins"
                     /codon_start=1
                     /product="putative virion core protein"
                     /protein_id="NP_957936.1"
                     /db_xref="GeneID:2947875"
                     /translation="MEAINVFLETASGRVRILYSEDECACPTQCRATARRAAASVLQE
                     LDKYIVVKESTFTLAIRDEDIFYYLCDKGRLTLADNEFYLFHHGLLFLDDARDEEVTG
                     VGFVITDTTHVRVVPRDGVSVIVYSDNSRAYEGML"
     misc_feature    complement(28227..28634)
                     /locus_tag="BPSVgORF027"
                     /note="putative virion core protein; Provisional; Region:
                     PHA03001"
                     /db_xref="CDD:222960"
     gene            complement(28621..30723)
                     /locus_tag="BPSVgORF028"
                     /db_xref="GeneID:2947876"
     CDS             complement(28621..30723)
                     /locus_tag="BPSVgORF028"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF028 hypothetical protein; unknown function;
                     Similar to Vaccinia virus strain Copenhagen O1L and
                     Molluscum contagiosum virus MC042L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957937.1"
                     /db_xref="GeneID:2947876"
                     /translation="MLLYPRKARDAAASLAKKSFCAEKLSRSQLQCLLAHGLHGELPE
                     SVYEEAVAACPLNVMYFPPHTVKLTDLITALKTVKTVPKKMTPVVILNKRQLLAARDM
                     DVLRVLLSAGLVYEPEVVDLVEKGEVPAVLALTCAPWTACPRLRLTRTEIETVCRAID
                     PSNVNEMIPKLKISPQDLVALADKGNIPPLNRALCELEDACTCARLVCEWPYFNIMKF
                     LSVDMVRSKEFARAVREGAAALCVRPVGADNLVGISKSQSRRLPEEHVDFHYDESDTT
                     DSCSNTWSTRSTHSTRSTRSTRSGDSPDSESFEEPGPLVRRNTARACAPRASVRSSAA
                     SIRRHRGSTRISEPVISSEGRVPKVVMASASDTAEELLCHLSSEWVHGRRAKTAVLEK
                     LLEDFRLNLAFPRLVLCSDAPNELKKKILKVICNWHTVGDPTSAATAAVEGTTDQILG
                     LLLTDYRHVSGVMTLLSKPPLPPSCGCEFCDRQATPGRAALRSASFGTGAAASPELDD
                     AALRTAVADMVLLALHGVVDPCFAGSAAWGPLSCALAGARLMDEARLVEALEYEKLIF
                     ANLSADGVKNTNNLLRLSRVKASDFVAEASILNTDHSRALIAVGCIAEYMLAAIFFRV
                     VVLRRMSKIREFVAQIIAAAMDATGTVAPPIKVHDRVEKEVRDFAEVGAGVPFCTVGL
                     VLRTVLTILEELVHHGSD"
     misc_feature    complement(28624..30723)
                     /locus_tag="BPSVgORF028"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02693"
                     /db_xref="CDD:177475"
     gene            complement(30767..33190)
                     /locus_tag="BPSVgORF029"
                     /db_xref="GeneID:2947877"
     CDS             complement(30767..33190)
                     /locus_tag="BPSVgORF029"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Molluscum contagiosum virus MC043L"
                     /codon_start=1
                     /product="ORF029 hypothetical protein"
                     /protein_id="NP_957938.1"
                     /db_xref="GeneID:2947877"
                     /translation="MRIRVFTPTTMNHHTGQRAASLVRCLMASGFDLWAIERDDLPLA
                     VLMGFTGTVNAQFSERTDYNLHRLASELSKFSSSCVTLVSPELVTPDLVCTMLQNTTD
                     VTPAMVPYLDTHAYCVSNMLDVDCLFRLCLYGTEELQSLSVSRPFAHFMDYALRRLSA
                     SSPLCDLSKIPYAVALCDTEEKTRDFFRQCTVSEARTALTCRELSHEVLLEVHNLHGI
                     PPLNSGLRNVRNFRMLLDIIPSLMNETSVDFTQFLHHSMLKHRLVLETVLDELRPHVA
                     CRSLFRFLSAEFTPEYIVQRAGVIAYACFPEHASDLFEACNISVALPLANSELDIIFE
                     YAEVYVDTLDMRAAMYNVLETLRITDPDTYARLWRVQTAGCVTVAMYANSINDILQQS
                     MRLGLRVEATENLVELQSAFAETITAETMEMIVERDAVDMEWFSASTVDMVLPYLDRV
                     LSVEDVLLPSSSDATESIFLREEVVTAYALKFRNHHMFFGAVVGSSMPVSLKLRIFAR
                     AMQGGPFPISMLESAIFSFAYSWSPRLLYNYQPTIHPEVERVEGVSLLDDNLIRLGNK
                     TRVMVGPRARKCMFVMDMMRREGGMKSESSCDHKLVLVQCENTVVVGMRFEQRKMAFA
                     SLAHRIRCRSRDLLMLLQRGIVYRLVTWGSSADIDLPECGIVRALYSVQFNTLHWGNY
                     CTLDDDMLRVGNCMARCNLPLVRARAVAHYLYTYVAYFILMWFYNYREERLEDILRVI
                     DESIGAGLACRRYDPKVAAQQLGLVVTENALVSTRCHHRFTEADLFVDAVVTGALAKL
                     CEDAQSAQN"
     misc_feature    complement(<31727..33010)
                     /locus_tag="BPSVgORF029"
                     /note="Poxviridae protein; Region: Pox_E2-like; pfam04497"
                     /db_xref="CDD:282366"
     gene            complement(33392..34360)
                     /locus_tag="BPSVgORF030"
                     /db_xref="GeneID:2947878"
     CDS             complement(33392..34360)
                     /locus_tag="BPSVgORF030"
                     /note="putative DNA-binding virion core protein; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="putative DNA-binding virion core protein"
                     /protein_id="NP_957939.1"
                     /db_xref="GeneID:2947878"
                     /translation="MEEERLVFNKVNANVLKAYLCARISEIVDEMVDRRHMQKKKSAA
                     RRVELRIPVDLLHPAFVREFSLDSYKDGVLSSLVTSIVENNFFSSVDGKLVEGAERVL
                     LLTPLETRILGCVPRESSLYIDVADVKALAGRLKSPPSCIECAGARYEIDARHVDDFI
                     NTALRDGLISLDERSSLKDSMYCVDEELLCAMRRRFMRSPQISMGLISRSRLHDYLMR
                     AMTREEHRIYVGLKDPASATVLGLETVCLGDFTYVKYTALVSALSAAIDRCNKRMHED
                     VYVRLAHVVPENSRMNVTKLVDALTVPMTRMEQPVQGLSPVVSGDE"
     misc_feature    complement(33425..34360)
                     /locus_tag="BPSVgORF030"
                     /note="putative DNA-binding virion core protein;
                     Provisional; Region: PHA03061"
                     /db_xref="CDD:177511"
     gene            complement(34369..34578)
                     /locus_tag="BPSVgORF031"
                     /db_xref="GeneID:2947879"
     CDS             complement(34369..34578)
                     /locus_tag="BPSVgORF031"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF031 hypothetical protein; unknown function;
                     Similar to Vaccinia virus strain Copenhagen I2L and
                     Molluscum contagiosum virus MC045L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957940.1"
                     /db_xref="GeneID:2947879"
                     /translation="MDKLYAGVFGSFLSNSDEDFEEFLNVVRSVMADKPPARRSGLPW
                     STATLLWLAAAALLVLLCFHYLKLV"
     misc_feature    complement(34372..34578)
                     /locus_tag="BPSVgORF031"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02692"
                     /db_xref="CDD:177474"
     gene            complement(34585..35451)
                     /locus_tag="BPSVgORF032"
                     /db_xref="GeneID:2947880"
     CDS             complement(34585..35451)
                     /locus_tag="BPSVgORF032"
                     /note="DNA-binding phosphoprotein; has strong affinity for
                     ssDNA suggesing a role in DNA replication and/or repair;
                     The poxviridae are enveloped unsegmented dsDNA viruses;
                     unlike many dsDNA viruses that replicate in the host
                     nucleus poxviruses encode their own replication machinery
                     and therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins; the
                     DNA-binding phosphoprotein is expressed at early and
                     intermediate times postinfection"
                     /codon_start=1
                     /product="DNA-binding phosphoprotein"
                     /protein_id="NP_957941.1"
                     /db_xref="GeneID:2947880"
                     /translation="MKRASTGTTKSPSARQPSDDSPNTAQAPKKFDCRAMKCIEAVEF
                     ARSLSTSQTRAIESVTLTPSQYPSCSNINVTLVDSLASRLVAPLIMLKGEFKIHTSKK
                     TDMQRQGPDSGFFARIKPVSASQMLYQLLEGIYTNILEGTRVPHSLRSFNVESSTDAT
                     FKNGCIYVNRLTGALVEFTSEDGAPPHICPIMREIEALATRDAQMATMILSPIVLYRA
                     GNEAKVTFALKKVTMPRECTLTVLGLDGESTSVKMSETPAVFNEEQEVRGLGVVDPAT
                     FEEEDAESPFNI"
     misc_feature    complement(34588..35451)
                     /locus_tag="BPSVgORF032"
                     /note="DNA-binding phosphoprotein; Provisional; Region:
                     PHA03068"
                     /db_xref="CDD:177515"
     gene            complement(35465..35725)
                     /locus_tag="BPSVgORF033"
                     /db_xref="GeneID:2947881"
     CDS             complement(35465..35725)
                     /locus_tag="BPSVgORF033"
                     /note="ORF033 IMV membrane protein; structural protein;
                     Similar to Vaccinia virus strain Copenhagen I5L and
                     Molluscum contagiosum MC047L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF033 IMV membrane protein"
                     /protein_id="NP_957942.1"
                     /db_xref="GeneID:2947881"
                     /translation="MNNRDLGTAVGATLLMLVIVVLGGATVLRRGSASLGIRSRGALR
                     VLTVMDFLAMLTTIPCTIILYFLCMQQLWRASGKRTENIHVL"
     misc_feature    complement(35480..35725)
                     /locus_tag="BPSVgORF033"
                     /note="ORF033 IMV membrane protein; Provisional; Region:
                     PHA02702"
                     /db_xref="CDD:177483"
     gene            complement(35731..36900)
                     /locus_tag="BPSVgORF034"
                     /db_xref="GeneID:2947924"
     CDS             complement(35731..36900)
                     /locus_tag="BPSVgORF034"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein; contains DNA-binding domain;
                     likely involved in viral replication; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins; the
                     Entomopoxvirinae are a sub-family of the Poxviridae that
                     infect insects"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957943.1"
                     /db_xref="GeneID:2947924"
                     /translation="MNHFVKQIASGIRKPATRLTPSGSHEVRVHTVPVEMPGFFYNNE
                     NLFHKPLNSVDAVLKSLAIAGTFRDEWESLRSVARALQAAGVHVVDVFFSPVGWLAGA
                     AQPPGTPAAFRIVAPSAAAAAKAVRQVVKTVRPPAQLQPGEAREDSVVEVQEFSSAYS
                     SQGPPPVGVMAVCPFDQEASLLVLFFGRTQDAQCGIAYQCASKTETDRMLATLMPVVS
                     EMHVVCDDVGRSTVTRHRGGGSVAAFPDDRVTSIVGVVHHFDHRQFPSAPGASPSSDL
                     ALYVPKRFVFVIDLPSGVDIRCASRNGTDFVTHVDGRKLDAVLVIVKDGFMAGTTMEG
                     VFQKENLVWRGKYTYRITRSTFDVPEFRGKAGGSPPDGRVLASRDFVTRSLYTVL"
     misc_feature    complement(35734..36900)
                     /locus_tag="BPSVgORF034"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03067"
                     /db_xref="CDD:222969"
     misc_feature    complement(35842..36819)
                     /locus_tag="BPSVgORF034"
                     /note="Poxvirus I6-like family; Region: Pox_I6; pfam04595"
                     /db_xref="CDD:252691"
     gene            complement(36897..38189)
                     /locus_tag="BPSVgORF035"
                     /db_xref="GeneID:2947925"
     CDS             complement(36897..38189)
                     /locus_tag="BPSVgORF035"
                     /note="similar to Vaccinia virus strain Copenhagen I7L and
                     Molluscum contagiosum virus MC049L"
                     /codon_start=1
                     /product="ORF035 virion core protease"
                     /protein_id="NP_957944.1"
                     /db_xref="GeneID:2947925"
                     /translation="MDRYTDLVVSKIPEMGFTNLLCHIYSVVGLSAYLDVSNFKTNCN
                     GYVVKRFDTSASAGKVTCLPLAALLDFAKRGLIDPVAPEQAAEDEVAQKTVLLENLKR
                     KFSFREAVTLEWTVPLMYFFKPSLREKVSAAVDFSQMPLQVDDLTRAGVHTGVNSKVV
                     PIAVKPDRGAWMSNVSIQNLVAPFAFRSEVTYLGQFNLNFLNGAAIHEKSERFRSNML
                     HLTLKDKIERAETRYVMFGFCYMFHWKCCIFDTVSRLVSFYDSGGNSPAEFHPCKYFY
                     FYSFSDGFNVNSGSADLDNRNCDVDVLMRFFVDSFKARRGCINLEVNQLMESECGMFT
                     CIFMILCTIRPPDNFRTLRCIYTYFRFLADKKMTLLKSILFDPTSPRLETAEIMSDGM
                     KEYMKMERWTRKSARVLAERITERINTLLPPEPEPPAE"
     misc_feature    complement(36936..38189)
                     /locus_tag="BPSVgORF035"
                     /note="Vaccinia virus I7 processing peptidase; Region:
                     Peptidase_C57; pfam03290"
                     /db_xref="CDD:281306"
     gene            38195..40249
                     /locus_tag="BPSVgORF036"
                     /db_xref="GeneID:2947926"
     CDS             38195..40249
                     /locus_tag="BPSVgORF036"
                     /note="RNA helicase NPH-II; catalyzes the unidirectional
                     unwinding of duplex RNA with a 3' tail; RNA helicase
                     NPH-II; The poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins"
                     /codon_start=1
                     /product="RNA helicase NPH-II"
                     /protein_id="NP_957945.1"
                     /db_xref="GeneID:2947926"
                     /translation="MENPLPEMLLFPNCVTVFPFEYALEDVLRLPDETRRAFALAAFP
                     LVKHRWRGARVERNDRRVWLDVEREARAAAVAASTSALLDDAMDRLVDDQGRVITPEA
                     YAFMRCAPGARVAELADDVAAIAGIVHGGNALRIFSSDSVHAKEAWRERSVGVLGNPE
                     PLEPVPLASLKPDVQQTLFAAWCRRRPVVLTGDTGVGKTSQVPKLLLWFNYLFGGFDR
                     LDAIHEFSERPVVLSLPRVTLVRAHTATYLRSLGFVGIDGSPVSQRHGALTDDERNSA
                     PRAYGLVMSTHRLTLNAIRRFDTVVVDEIHEHDQMGDIVVAVARKLAGSVRSLVLMTA
                     TLEDDRERLEEFLDDPAFVHIGGGTLFAIREVYVKNAQQPPLSRKYAEEELRNVTEAL
                     GTFVPDQGKCGILFVATVAQCALFAENISAKHPGLLVRIVHGKIPSVADVLAEVYAAD
                     RPAVLVSTPYLESSVTVKNATHVYDTGRVFVPEPFGGRERIVSRAMYTQRRGRVGRVA
                     PGTYVRFFDTRLAAPIKRIDSEFLHPYVLYARVFDLKLPDDLLVRPSDPELLRRTEEY
                     VDGFGISVCRWTELLNRHYMHMLEYAKVYVRGGRLARALDAFERDGVMTQEATEAIRA
                     VEMLAGVVAVRRTGDRYRAECKVLFGPFVGKRFSVVGRRRPGKYVLMVTDRVFIESEV
                     PS"
     misc_feature    38198..40234
                     /locus_tag="BPSVgORF036"
                     /note="RNA helicase NPH-II; Provisional; Region: PHA02653"
                     /db_xref="CDD:177443"
     misc_feature    38201..38707
                     /locus_tag="BPSVgORF036"
                     /note="Domain of unknown function (DUF3503); Region:
                     DUF3503; pfam12011"
                     /db_xref="CDD:288834"
     misc_feature    38756..39202
                     /locus_tag="BPSVgORF036"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    38777..38791
                     /locus_tag="BPSVgORF036"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    39101..39112
                     /locus_tag="BPSVgORF036"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    39404..39715
                     /locus_tag="BPSVgORF036"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    order(39416..39427,39491..39496,39566..39574)
                     /locus_tag="BPSVgORF036"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    order(39590..39592,39689..39691,39701..39703,39710..39712)
                     /locus_tag="BPSVgORF036"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(40224..42032)
                     /locus_tag="BPSVgORF037"
                     /db_xref="GeneID:2947927"
     CDS             complement(40224..42032)
                     /locus_tag="BPSVgORF037"
                     /note="virion morphogenesis; putative metalloprotease;
                     metalloendopeptidase that likely plays a role in the
                     maturation of viral proteins; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins"
                     /codon_start=1
                     /product="putative metalloprotease"
                     /protein_id="NP_957946.1"
                     /db_xref="GeneID:2947927"
                     /translation="MIVLGNGVRVFLRPSMKRDIYLGISNFGFGRDVGDVLGLAHLLE
                     HVLISFDHRRFLANASTARNFMSFWCKSLRGRPMDAVRELASWFFEDGRLRTCFDDVD
                     VRAFAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFDDLVAATDIRERMAARMRS
                     IAGPSIVVFLRQISAPAVELLNATFGTLPRTPDVICPRAVAGVGGKAVMMATPFYSVL
                     VRVDATLDNALAVMALRETYHLFDYETMGEDLYVVLSFVDETDYDGLLRGIKDLPLET
                     VPDARLAVDSDDHAMNAYLNFPWMSHDLLDYEDYFRDNAERLVAGLKRDILAAVAERD
                     CVALYPGFTSSIFNAQDAQRHRVMMLDLHQDQDGRPLHRGHGDACPVRLMRKTPAGGN
                     VVVRLGDADLLRFVTLATAVHPETRVRRTHEGIRFQHRLSAEDMDAIMESEVFMKFSK
                     SRPAAAYQYMFLDFFASERSMEDILENRTTARRGGCMPHLVFDRRTRYDVVACSSFVC
                     GVVKGRALRKERLHELMWRMKRLGIIYSLDHTPLKSPCTFYVFAFSLSPEETFRCISK
                     CPGVTSYCLVVARRGAADDFSALTKKVVLRMGPPTR"
     misc_feature    complement(40239..42032)
                     /locus_tag="BPSVgORF037"
                     /note="putative metalloprotease; Provisional; Region:
                     PHA03081"
                     /db_xref="CDD:222973"
     gene            complement(42047..42382)
                     /locus_tag="BPSVgORF039"
                     /db_xref="GeneID:2947928"
     CDS             complement(42047..42382)
                     /locus_tag="BPSVgORF039"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF039 hypothetical protein; unknown function;
                     Similar to Vaccinia virus strain Copenhagen G3L and
                     Molluscum contagiosum virus MC057L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957947.1"
                     /db_xref="GeneID:2947928"
                     /translation="MTWAVLEVALFVGFLALMYALNVLPTNKMQLAVRELADDRLYRQ
                     RLDAQLDAVSESVLFQTPDAPRASAVLVSMDSRNERVTVAHGRDKSVFDLKRRGDVQT
                     LIPILLLSK"
     misc_feature    complement(42050..42382)
                     /locus_tag="BPSVgORF039"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02691"
                     /db_xref="CDD:177473"
     gene            42376..43077
                     /locus_tag="BPSVgORF038"
                     /db_xref="GeneID:2947866"
     CDS             42376..43077
                     /locus_tag="BPSVgORF038"
                     /note="transcriptional elongation factor; The poxviridae
                     are enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="transcriptional elongation factor"
                     /protein_id="NP_957948.1"
                     /db_xref="GeneID:2947866"
                     /translation="MSFRELILFHAATHVVTGDPEAPRRAASLCAGFGVSFRAEYGEF
                     AKRYPRTAAAVERAELLPETDMVFPPDALRALVRLRLEAAGLSVKASRLLAPAMCGTA
                     VVDGCSVRVCGANDALLDFLAKRYDPEVYRYVATAAPSVRCGSRAFVCSGGSVTFVAA
                     HESRITANRPLRVVVTDACVTKVLERGAAEVFERGSGVLLRALRDMFYRLREDEDGAA
                     TGQTLNLAERMASRS"
     misc_feature    42385..43044
                     /locus_tag="BPSVgORF038"
                     /note="transcriptional elongation factor; Provisional;
                     Region: PHA03078"
                     /db_xref="CDD:222971"
     gene            complement(42996..43412)
                     /locus_tag="BPSVgORF040"
                     /db_xref="GeneID:2947867"
     CDS             complement(42996..43412)
                     /locus_tag="BPSVgORF040"
                     /note="virion morphogenesis; glutaredoxin-like protein;
                     functions as an electron carrier in the
                     glutathione-dependent synthesis of deoxyribonucleotides;
                     utilizes glutathione and NADPH as cofactors; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="glutaredoxin-like protein"
                     /protein_id="NP_957949.1"
                     /db_xref="GeneID:2947867"
                     /translation="MATDAAVGAKPTLILLGKPLCSVCEVTSRMLAALESEFDLKRVN
                     ILSLFAKDGAVTVLGMGVYRLITEITEYFGNEYVLLLKYDAALKAMAAVDIRQFVVVA
                     QIDEKKVDLDQLREAILSAKFNVWPVAAPSSSSLRR"
     misc_feature    complement(43023..43388)
                     /locus_tag="BPSVgORF040"
                     /note="glutaredoxin-like protein; Provisional; Region:
                     PHA03075"
                     /db_xref="CDD:177519"
     gene            43415..44740
                     /locus_tag="BPSVgORF041"
                     /db_xref="GeneID:2947868"
     CDS             43415..44740
                     /locus_tag="BPSVgORF041"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins; the Entomopoxvirinae are a sub-family
                     of the Poxviridae that infect insects"
                     /codon_start=1
                     /product="Hypothetical protein"
                     /protein_id="NP_957950.1"
                     /db_xref="GeneID:2947868"
                     /translation="MGIKNLKALLMSQGSLKPYEPADGERHPAVFVDGFSVLMTMAYS
                     CMDEDEFRSSVEERIQHWTRVSATEKLVVFLDRGDIPIKQPLRDQRRRAIKERVNRHR
                     EIVARADADDGPADDGDFAEEIRTEKQLKLQRIRFQLSIANHDVVRSLITSTLQRAGG
                     AVEIVYCDGVDAEMVMCTRGREEAARNGRWPLLVTTDQDALLFTSTDRMEKFVSTVSA
                     CYRYLPTDETEYLCKLAALTNGCDFFPGLAGISVGVESVRRMTLFREFNARNVAMSLC
                     TRAMRLAAAERASAEAVADMISFIDRYARGDEGIYGAAPPSACCGRAFIRAALCEEWG
                     DAPPPTGMGPVADMIVGLPERREPPPEDVERLAELEASSRRGRVTDAQLALAAELLGY
                     RVAEGDSDDAAAAIGVSAKGVFRRLGASRVFFNPEHVEIESESRLLKLL"
     misc_feature    43415..44734
                     /locus_tag="BPSVgORF041"
                     /note="Hypothetical protein; Provisional; Region:
                     PHA03065"
                     /db_xref="CDD:222968"
     gene            44740..44931
                     /locus_tag="BPSVgORF042"
                     /db_xref="GeneID:2947869"
     CDS             44740..44931
                     /locus_tag="BPSVgORF042"
                     /note="RNA polymerase; responsible for the polymerisation
                     of ribonucleotides into a sequence complementary to the
                     template DNA; The poxviridae are enveloped unsegmented
                     dsDNA viruses; unlike many dsDNA viruses that replicate in
                     the host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="NP_957951.1"
                     /db_xref="GeneID:2947869"
                     /translation="MVFPVVCSTCGRDLSNERFRLIIRQERLKVVLRDVRNICCRIKL
                     ATQIEPHRNLTVTPMLDIS"
     misc_feature    44740..44928
                     /locus_tag="BPSVgORF042"
                     /note="DNA-dependent RNA polymerase subunit; Provisional;
                     Region: PHA03082"
                     /db_xref="CDD:222974"
     gene            44943..45521
                     /locus_tag="BPSVgORF043"
                     /db_xref="GeneID:2947937"
     CDS             44943..45521
                     /locus_tag="BPSVgORF043"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Vaccinia virus strain Copenhagen G6R and
                     Molluscum contagiosum virus MC062R"
                     /codon_start=1
                     /product="ORF043 hypothetical protein"
                     /protein_id="NP_957952.1"
                     /db_xref="GeneID:2947937"
                     /translation="MEARMLREIVDTCPRGSLIFVSSAASMTDCFNPSKYKHAAIYVG
                     SVDCRTMLRKLGAGRPEIRADVPYVIDASAPHGARLTPLEDLLRNCVVVKAYRLAVPG
                     ALSLMSLAADAAFELVGTPYGFNHGRTYCFKLVADCFASVGVPTKTRRIMGREVVLSQ
                     DFLEDGAWTKILDSTEDLDVPVSSRTALSLSP"
     misc_feature    44979..45455
                     /locus_tag="BPSVgORF043"
                     /note="NlpC/P60 family; Region: NLPC_P60; cl21534"
                     /db_xref="CDD:304415"
     gene            complement(45490..46665)
                     /locus_tag="BPSVgORF044"
                     /db_xref="GeneID:2947938"
     CDS             complement(45490..46665)
                     /locus_tag="BPSVgORF044"
                     /note="putative virion core protein; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="putative virion core protein"
                     /protein_id="NP_957953.1"
                     /db_xref="GeneID:2947938"
                     /translation="MEASNAASRAGGRIFDSLLRFIVTGATAGCLTDTADIEAKARLL
                     PGSSPARRAQIANIIHDRCIANTRVTSRQDLADALARLRRRFVHAGGSPDLLRLHGAL
                     LRFTHCNSFFMVCRPTIQVTLATLIAYVLVGELMQAVDMVDAVERVVFRKNRPMASEL
                     ADLLELKYGLINLAQYKLIPGLLEEAGCCEDVVRAGAPAGAAEDMAEMEAERLLEMPV
                     RSGALSRLCDFLVQRGTPTSHAQSEYMAGLKIEELPADAPVAEHAVEEQNSALAKLSA
                     VMDSAARYERGAVLDGAVTSPLGAVGQSPFDGVTLQRFVLLEYLHIMKLLANCISQRS
                     SGEKIRIAVNTCPFKTTTAAPTPAPAPDAEDPEAQVRAYQKRLQSLPITGTKTTPFG"
     misc_feature    complement(45619..46653)
                     /locus_tag="BPSVgORF044"
                     /note="putative virion core protein; Provisional; Region:
                     PHA03080"
                     /db_xref="CDD:222972"
     gene            46699..47499
                     /locus_tag="BPSVgORF045"
                     /db_xref="GeneID:2947939"
     CDS             46699..47499
                     /locus_tag="BPSVgORF045"
                     /note="late transcription factor VLTF-1; viral
                     transcriptional activator of late genes; The poxviridae
                     are enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="late transcription factor VLTF-1"
                     /protein_id="NP_957954.1"
                     /db_xref="GeneID:2947939"
                     /translation="MALRIKLEKLKQIVTYFSEFSEEVSVNVDVADGLMYIFAALGGS
                     VNIWTIIPLSASVVYDGEVSRVFNVPVLKVKSCLCSFHPDSVVCLEPDLEDNVIRLSS
                     HHVVSVDCENEPIAHRTNTSICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIK
                     CIHQYQYITVCFRDKKMVLHTPGKVDNYFREYSMTEWAPDLERFSFKIPISSINKLRG
                     FKKRVVMFEARVVMDADDNIIGMLFTDRVGVYRVNVFMSFQDRCLSCD"
     misc_feature    46699..47478
                     /locus_tag="BPSVgORF045"
                     /note="Viral Trans-Activator Protein; Region: Pox_TAP;
                     pfam03355"
                     /db_xref="CDD:146143"
     gene            47511..48515
                     /locus_tag="BPSVgORF046"
                     /db_xref="GeneID:2947940"
     CDS             47511..48515
                     /locus_tag="BPSVgORF046"
                     /note="poxvirus myristoylprotein; virion protein
                     covalently modified by myristic acid during translation;
                     The poxviridae are enveloped unsegmented dsDNA viruses;
                     unlike many dsDNA viruses that replicate in the host
                     nucleus poxviruses encode their own replication machinery
                     and therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="poxvirus myristoylprotein"
                     /protein_id="NP_957955.1"
                     /db_xref="GeneID:2947940"
                     /translation="MGGSVSLPSRDLPPPVRTPEMAIVPERDLVGLMPRLTTADEPQP
                     LGVGDAARAAALKATFPEFAVTSPAPGMLAGVRVRYDGDPTVCCGGFGISHYWEKGAR
                     RANAYFEGGVLRTCDPSRFDAGLCDDRLFRECTSGAADADFCAQWINAAVTKRTDRRS
                     VERLNAMFARECGADASRPHCVAWIRALRSTNTAANDARIDAVLSVQSPEFKRARMRC
                     SYPSPATLEMASYVDEPRECWDPECVSGDVDFMLSDNYTNLGLCRISRCSIGVTHLRL
                     DPRSRLRMRCAGALTGMSRAPVNQAAVVDENVSRAFEPRTETLGVLALCVVYLLIVWL
                     "
     misc_feature    47511..48512
                     /locus_tag="BPSVgORF046"
                     /note="poxvirus myristoylprotein; Provisional; Region:
                     PHA03083"
                     /db_xref="CDD:222975"
     gene            48516..49250
                     /locus_tag="BPSVgORF047"
                     /db_xref="GeneID:2947941"
     CDS             48516..49250
                     /locus_tag="BPSVgORF047"
                     /note="similar to Vaccinia virus strain Copenhagen L1R and
                     Molluscum contagiosum virus MC069R"
                     /codon_start=1
                     /product="ORF047 myristylated IMV envelope protein"
                     /protein_id="NP_957956.1"
                     /db_xref="GeneID:2947941"
                     /translation="MGAAASIQTTVTTINERIRNELQQTASASATADCDVTIGSLIIR
                     KNLGCSVSVQNMCSADASAQLDAVMKAVSSTFNDLSADQKAYVPGLLTAALNIQTTVT
                     TAVKDFENYVRQTCTADSVIHNKIKVQSIVMDECASPPGGQTTHLEFINTGTASGNCG
                     VKAVMDVLAKASTTVKDQQVAGKGYQTIIIAVVVAILAAVFAWYARRMLFTSTTDKIK
                     LELAKKPVVHWTTYLDTFFTEFPPSV"
     misc_feature    48516..49049
                     /locus_tag="BPSVgORF047"
                     /note="Lipid membrane protein of large eukaryotic DNA
                     viruses; Region: L1R_F9L; pfam02442"
                     /db_xref="CDD:280581"
     gene            49299..49568
                     /locus_tag="BPSVgORF048"
                     /db_xref="GeneID:2947901"
     CDS             49299..49568
                     /locus_tag="BPSVgORF048"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF048 hypothetical protein; Similar to Vaccinia
                     virus strain Copenhagen L2R and Molluscum contagiosum
                     virus MC070R; Viruses of the genus parapoxvirus cause
                     localized diseases in large and small ruminants; the
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957957.1"
                     /db_xref="GeneID:2947901"
                     /translation="MLRQLVLERVNGIGERARADRRYLEAIQRHAEGNSMLLRRVRRL
                     LFDLVLTVFVIMYIVLRMVLRNAAACAMLALLAAIIYLFLCLVYF"
     misc_feature    49299..49565
                     /locus_tag="BPSVgORF048"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02690"
                     /db_xref="CDD:222920"
     gene            complement(49569..50699)
                     /locus_tag="BPSVgORF049"
                     /db_xref="GeneID:2947902"
     CDS             complement(49569..50699)
                     /locus_tag="BPSVgORF049"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Vaccinia virus strain Copenhagen L3L and
                     Molluscum contagiosum virus MC072L"
                     /codon_start=1
                     /product="ORF049 hypothetical protein"
                     /protein_id="NP_957958.1"
                     /db_xref="GeneID:2947902"
                     /translation="MEEKRDPGGGGFRRFGASRQAFRRGKKFKNPTGSTEPYVHPSRK
                     TVTFAKTETRHPSGAPGQHAPPESRAEAPAAPSPTRGAPPRQAPVPGPVSAGVGFLEK
                     RICDNVTAFTPVVVSMADEEAGCWIELSAMVRCRKAVGFPVCRRAPQSADTGAVAVCF
                     ESFGSLSTAQMRASERPCSISDAVVFQIVAIMYHLFQRGIFLDDVCVDVVTVPSCTIT
                     FSVSQLVFQVNTSSLVVLSPRSRLYRASLPQSCYMDIVRLLMPPASRFACDSCSYFFE
                     WIIRNHLDLLSKHFVDMFRTHRRTVSGVPLNRRAEPGALVWVTTSDAVVLGVTLTEVS
                     ISDNVRVIWSSDGAVFEVDDFPVHDVFPAPELVSRARAMVCL"
     misc_feature    complement(49587..>50342)
                     /locus_tag="BPSVgORF049"
                     /note="Poxvirus L3/FP4 protein; Region: Pox_L3_FP4;
                     pfam03339"
                     /db_xref="CDD:281350"
     gene            50729..51499
                     /locus_tag="BPSVgORF050"
                     /db_xref="GeneID:2947903"
     CDS             50729..51499
                     /locus_tag="BPSVgORF050"
                     /note="DNA-binding virion core protein; role in DNA
                     replication and/or repair; The poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes encoding non-structural proteins involved
                     in genome replication and late genes encoding the viral
                     structural proteins"
                     /codon_start=1
                     /product="DNA-binding virion core protein"
                     /protein_id="NP_957959.1"
                     /db_xref="GeneID:2947903"
                     /translation="MASLLSLVDADPLFCAGLPSRDETMLVIAGARVRFPRSLLSLFH
                     VVPRTMTRYETELVGTEMLVGAIFSTAYNVRRNLGLGEEPVTMRDLERYFLDSENEVL
                     TLVVNNTDFSNLSGVKKRGRRIPNPVIFRSGSIPILMVLESRKKVNIYRERTDEQANS
                     SYKEVGSNLAIVTRYAGLQLVDVHTPSSMLTVSAVYGVTEDKALKKIGNDKELADYQS
                     TPLSDPIRLSDFTKLFDGVKKSIQLTNVPVPAAADTVS"
     misc_feature    50729..51472
                     /locus_tag="BPSVgORF050"
                     /note="DNA-binding virion core protein; Provisional;
                     Region: PHA03070"
                     /db_xref="CDD:177516"
     gene            51530..51919
                     /locus_tag="BPSVgORF051"
                     /db_xref="GeneID:2947904"
     CDS             51530..51919
                     /locus_tag="BPSVgORF051"
                     /note="ORF051 putative membrane protein; viral entry;
                     Similar to Vaccinia virus strain Copenhagen L5R and
                     Molluscum contagiosum virus MC074R; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF051 putative membrane protein"
                     /protein_id="NP_957960.1"
                     /db_xref="GeneID:2947904"
                     /translation="MATDKAAPVVNLTPVFVEPTIAHSLLRSEPYLTLVVLELLLALA
                     LTYLFFGDELRSALRGRQRPPSPLDAYGEASLACDGDALMIELPGGRLPALALDGRPV
                     AFPGCDGVLRRINGTRKVRLVDVLGRG"
     misc_feature    51533..51916
                     /locus_tag="BPSVgORF051"
                     /note="ORF051 putative membrane protein; Provisional;
                     Region: PHA02689"
                     /db_xref="CDD:177471"
     gene            51873..52328
                     /locus_tag="BPSVgORF052"
                     /db_xref="GeneID:2947839"
     CDS             51873..52328
                     /locus_tag="BPSVgORF052"
                     /note="morphogenesis; similar to Vaccinia virus strain
                     Copenhagen J1R and Molluscum contagiosum virus MC075R"
                     /codon_start=1
                     /product="ORF052 membrane protein"
                     /protein_id="NP_957961.1"
                     /db_xref="GeneID:2947839"
                     /translation="MEHERYVLSMFLEEDDSFFSFVAGLPDDEALGAVQSAATLLDFL
                     LAVVLRGKEKLAAAGHHYDAVTDGRARAVMEFRDLRELVRLFDRRPCAPGGRVQVRDG
                     PAMAFVDACRALMRQRGFDGAQTADRVRYITPRDVAALDAISATLSPNI"
     misc_feature    51873..52313
                     /locus_tag="BPSVgORF052"
                     /note="Poxvirus J1 protein; Region: Pox_J1; pfam03338"
                     /db_xref="CDD:281349"
     gene            52414..53427
                     /locus_tag="BPSVgORF053"
                     /db_xref="GeneID:2947840"
     CDS             52414..53427
                     /locus_tag="BPSVgORF053"
                     /note="poly(A) polymerase small subunit; methylates the
                     ribose 2' OH group of the first transcribed nucleotide;
                     structure has been solved (PDB: 2ga9);The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="poly(A) polymerase small subunit"
                     /protein_id="NP_957962.1"
                     /db_xref="GeneID:2947840"
                     /translation="MEGVEMEKPLLYFDELTGERDFDAAFAEANEPAKLPAQGQLKLL
                     VGELVFLNRLYRHGMLDGSVIVYIGSAPGTHICCLHSHFQELGVSLKWILVDGRKHDA
                     CLMGLRNVTTVTRFADEAYLRELRAELKRAKVVLISDIRSNRVNTEPTTADLLRDYAL
                     QNVMVSVLKPIASSLKWRCPFPDSWEKDFYVPCGKEMLQPFAPPFSAEMRLLSVYADT
                     PARLRLVTLSDAVKYEKRMFYLNSVVRRRVILNFDYPNQEYDFFHMFYLLSSVVCSKE
                     FKSAKDKVLSLQQGFFRFLRIPAISTPGLRAPDDEPAQRAVPGKNSLPKGRGKKRSVR
                     DHK"
     misc_feature    52414..53316
                     /locus_tag="BPSVgORF053"
                     /note="poly(A) polymerase small subunit; Provisional;
                     Region: PHA03108"
                     /db_xref="CDD:165387"
     gene            53342..53902
                     /locus_tag="BPSVgORF054"
                     /db_xref="GeneID:2947841"
     CDS             53342..53902
                     /locus_tag="BPSVgORF054"
                     /note="similar to Vaccinia virus strain Copenhagen J4R and
                     Molluscum contagiosum virus MC077R"
                     /codon_start=1
                     /product="ORF054 RNA polymerase subunit RPO22"
                     /protein_id="NP_957963.1"
                     /db_xref="GeneID:2947841"
                     /translation="MNRHNVRYLAKILCLKAEVKNDPFATISRDTVKRYDIDVEYGDL
                     VSVVTVTHKIESSRTVFQVFNETSVTYSPLPDDYGEPIVLTTYMQREHTRFPVFMLYI
                     DVLASDMFPVFKRPTEEECAVIAAMQRVGGRKEAALKLPRMLDTELVYKILFRPEMQL
                     RVVRFLRRNMFTGVEIADRSVSVVLD"
     misc_feature    53342..53893
                     /locus_tag="BPSVgORF054"
                     /note="Poxvirus RNA polymerase 22 kDa subunit; Region:
                     Pox_RNA_Pol_22; pfam05273"
                     /db_xref="CDD:283042"
     gene            complement(53853..54356)
                     /locus_tag="BPSVgORF055"
                     /db_xref="GeneID:2947842"
     CDS             complement(53853..54356)
                     /locus_tag="BPSVgORF055"
                     /note="similar to Vaccinia virus strain Copenhagen J5L and
                     Molluscum contagiosum virus MC078L"
                     /codon_start=1
                     /product="ORF055 late membrane protein"
                     /protein_id="NP_957964.1"
                     /db_xref="GeneID:2947842"
                     /translation="MFFRRRAALSAAPGPDAPDEEIYAFCDANPDDVRCACLKPSQAV
                     VDTGRDTRLPYYCWYGPCRRADALLPRALKKNIAGCNVSDCVISMGDVRVRDAVIRLT
                     NACGSKLDATAERFQARYLNQHAFAPVADPVVWLPLCLLAVASLVVPALVSRGPRTQT
                     GPRSPRR"
     misc_feature    complement(53925..54293)
                     /locus_tag="BPSVgORF055"
                     /note="Pox virus entry-fusion-complex G9/A16; Region:
                     Pox_G9-A16; pfam03003"
                     /db_xref="CDD:281058"
     gene            54446..58315
                     /locus_tag="BPSVgORF056"
                     /db_xref="GeneID:2947870"
     CDS             54446..58315
                     /locus_tag="BPSVgORF056"
                     /note="similar to Vaccinia virus strain Copenhagen J6R and
                     Molluscum contagiosum virus MC079R"
                     /codon_start=1
                     /product="ORF056 RNA polymerase subunit RPO147"
                     /protein_id="NP_957965.1"
                     /db_xref="GeneID:2947870"
                     /translation="MSIVHRVSYSLYSQSEISATDVVISQMKNEDDLGTVKDPRLGAS
                     DGSICRTCGLTEMECFGHWGKTRIYESYIVRPEYISEVMRLLNHLCIRCGLLRSRDPY
                     TTDVTTLSVHEMRKMKDRMMSKKKACWNSKCLQPYQKIVFSKKKICFVNKIDEIPVPN
                     ALIYQKLTSIHRKFWPLLEVYQDPANLFYREYIPIPPLLIRPAISFWIDNIPKETNEL
                     TYLLGMIVKYCSMNAEEQVIQRAMIEYDNIKIISSNSSSINLSYIISGKSNMLRSFVV
                     ARRKDQTARSVIGPDSSLSVREVGIPDYIRNTLTQKVFVNYLTSKRVRALFEERSVKF
                     YFNKRLRQLTRIKDGKFIKDKIHLLPGDWVEIAMTEGTNVIFGRQPSLHRHNVISSTA
                     RASLGYTIKIPPGIANSQNADFDGDEEWMVLEQNPKSVIEQSVLMYPVTIFKHDAHGA
                     PVYGSIQDEIVAAYSLFRERDLTLDEVLNLLGRYGRDFTPEPGKTKFSGGDIFRFMIS
                     ADINYRGILEDGRVVAANVDSDLVVAMRATSLAGLIADYSTNVQGVRFVDTLSYVLKR
                     YLAIYGFGVTFRDLRPDASLVNRLHALNTEKIEQIKDAYARYLQDVAEGRIVPMSPAD
                     EADAVESLLSNLTNLNVREINEYMRETLENNPDNNLLKMARAGYKVNPTELMYLLGTY
                     GQQRVDGAVAETKVYGRVLPYALPNSADPEARGYIINSLMNGLSGSQFYFAMLVARSQ
                     STDIVCETSRTGTLARKVIKKMEDTVVDGYGQVVSGSVLLKYAANYAKIPGSTTKPVE
                     LIFPDEKMTWFLEISAIWDRIRHGFVRMHRQRMATKILAPFNFLVFVKPAPSAEAAIS
                     PRDLYHMIRRVMDDVREKYFFTLASTDFMEYVFLTHLNPSRVRITRETATLIFRKLYH
                     KLNALLGGGTPVGIMSAQVLCEKFTQQALSSFHTTEKSGGVKVKLGFNEFSNLITMSR
                     NHTEIVSLTSADINKLMPLKINFEFVCLGELLPEISAEPSGRPSIYRVRVRIHRLRIK
                     RAHLTEVLVDSIIERFVSFNVLVKEWGSDMTVDGDHVEYTLLLRFVEPEQLNFHKFML
                     VLPGAANKGKVSKFKIPITECAVHDDHNATRKAFRMNIELMSLKELGIFDLEDVNVVP
                     GMWNTFDIFGIEAARGHLCESMLDTYGVGFDYLFPSCDLLASLLCAGYEPESVNKFKF
                     WNASALKKATFGDGRALLNAALHNRTDTVADNSSCHFFSKTPGVGTGYYKYFVNVEMF
                     MRMEKEIQARVAERKMGELEEAAEEEF"
     misc_feature    54461..56767
                     /locus_tag="BPSVgORF056"
                     /note="Largest subunit of RNA polymerase (RNAP),
                     N-terminal domain; Region: RNAP_largest_subunit_N;
                     cl19114"
                     /db_xref="CDD:302765"
     misc_feature    order(54479..54481,54491..54493,54620..54628,54632..54634,
                     54668..54670,54977..54979,55025..55027,55040..55045,
                     55232..55234,55235..55237,55265..55267,55274..55276,
                     55280..55303,55316..55324,55349..55360,55367..55372,
                     55568..55570,55574..55576,55580..55582,55592..55597,
                     55604..55606,55631..55633,55637..55642,55646..55648,
                     55655..55657,55682..55693,55697..55699,55703..55705,
                     55709..55711,55718..55732,55736..55741,55745..55756,
                     55778..55780,55814..55819,55826..55828,55943..55948,
                     56147..56155,56288..56290,56420..56422,56432..56434,
                     56447..56452,56465..56467,56474..56479,56504..56509,
                     56597..56602,56606..56626,56633..56638,56642..56650,
                     56657..56662,56666..56671,56711..56713,56720..56722,
                     56732..56734)
                     /locus_tag="BPSVgORF056"
                     /note="large subunit interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259843"
     misc_feature    order(54479..54496,54497..54511,54518..54520,54626..54658,
                     54662..54706,54962..54985,55022..55057,55154..55168,
                     55175..55180,55217..55234,55235..55270,55274..55288)
                     /locus_tag="BPSVgORF056"
                     /note="clamp; other site"
                     /db_xref="CDD:259843"
     misc_feature    order(54590..54592,54599..54601,54620..54622,54629..54631)
                     /locus_tag="BPSVgORF056"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259843"
     misc_feature    55001..55837
                     /locus_tag="BPSVgORF056"
                     /note="RNA polymerase I subunit A N-terminus; Region:
                     RPOLA_N; smart00663"
                     /db_xref="CDD:214767"
     misc_feature    order(55244..55246,55259..55261,55280..55282,55298..55300,
                     55577..55585,55682..55684,55688..55690,55694..55696,
                     56699..56704)
                     /locus_tag="BPSVgORF056"
                     /note="active site region [active]"
                     /db_xref="CDD:259843"
     misc_feature    order(55682..55684,55688..55690,55694..55696)
                     /locus_tag="BPSVgORF056"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259843"
     misc_feature    57212..58198
                     /locus_tag="BPSVgORF056"
                     /note="Largest subunit of RNA polymerase (RNAP),
                     C-terminal domain; Region: RNAP_largest_subunit_C;
                     cl11429"
                     /db_xref="CDD:277468"
     misc_feature    order(57212..57295,57323..57325,57347..57361,57371..57388,
                     57875..57898,57911..57955,57965..57979,57980..57982,
                     57995..58021,58025..58042,58067..58069)
                     /locus_tag="BPSVgORF056"
                     /note="cleft; other site"
                     /db_xref="CDD:132719"
     misc_feature    order(57215..57217,58193..58195)
                     /locus_tag="BPSVgORF056"
                     /note="Rpb1 - Rpb6 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132719"
     misc_feature    order(57218..57220,57227..57229,58139..58147,58163..58168,
                     58172..58174,58178..58180,58193..58195)
                     /locus_tag="BPSVgORF056"
                     /note="Rpb1 - Rpb2 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132719"
     misc_feature    order(57386..57388,58040..58042,58091..58096,58103..58105)
                     /locus_tag="BPSVgORF056"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132719"
     misc_feature    order(57893..57898,57911..57922,57926..57928,57977..57979,
                     58016..58021)
                     /locus_tag="BPSVgORF056"
                     /note="Rpb1 - Rpb5 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132719"
     misc_feature    order(58067..58111,58112..58189)
                     /locus_tag="BPSVgORF056"
                     /note="clamp; other site"
                     /db_xref="CDD:132719"
     gene            complement(58312..58851)
                     /locus_tag="BPSVgORF057"
                     /db_xref="GeneID:2947871"
     CDS             complement(58312..58851)
                     /locus_tag="BPSVgORF057"
                     /note="virus assembly; similar to Vaccinia virus strain
                     Copenhagen H1L and Molluscum contagiosum virus MC082L"
                     /codon_start=1
                     /product="ORF057 protein phosphatase"
                     /protein_id="NP_957966.1"
                     /db_xref="GeneID:2947871"
                     /translation="MEAKNDWYAKLLLRCTRAGAPIYLPTAMTRLTEYVYLGSAEDAR
                     AVVMGASGVDFKCVVNMTTAKYSAPESIAVYHIPLRDDNVTSIEGVIPPLVKLLERLE
                     AEKKPTLVHCVAGINRSGAAAMAYIMHRWTSEHPEVSPAARFVFFLKTYYELRDSRGA
                     FLENNNFRYQLIKMFVTGA"
     misc_feature    complement(58336..58770)
                     /locus_tag="BPSVgORF057"
                     /note="Protein tyrosine phosphatases (PTP) catalyze the
                     dephosphorylation of phosphotyrosine peptides; they
                     regulate phosphotyrosine levels in signal transduction
                     pathways. The depth of the active site cleft renders the
                     enzyme specific for phosphorylated Tyr...; Region: PTPc;
                     cl21483"
                     /db_xref="CDD:304379"
     misc_feature    complement(order(58495..58500,58507..58509,58516..58521,
                     58609..58611))
                     /locus_tag="BPSVgORF057"
                     /note="active site"
                     /db_xref="CDD:238073"
     misc_feature    complement(order(58516..58518,58609..58611))
                     /locus_tag="BPSVgORF057"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238073"
     gene            58863..59447
                     /locus_tag="BPSVgORF058"
                     /db_xref="GeneID:2947872"
     CDS             58863..59447
                     /locus_tag="BPSVgORF058"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="putative viral membrane protein; found in all
                     sequenced poxviruses; contains an N-terminal transmembrane
                     domain and four conserved cysteines; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="putative viral membrane protein"
                     /protein_id="NP_957967.1"
                     /db_xref="GeneID:2947872"
                     /translation="MIQMADVTTLSVNGLDLDFARSRAVRSIRAAKTSTLVFFTLTLL
                     TSLFILWLQLTEYPLLAELGRYARIKSAVRSWRPLVDAKTEIESDLGRQKTVDRPDLF
                     EFRCVDFGKFYLPVRYSPTTFLPQAVRRGTGDGWMVQKAADTDLSAKQFCESVLRHRA
                     NNVITCGSEMMRLVGYSGYFEDDHWCAAASGVLM"
     misc_feature    58875..59444
                     /locus_tag="BPSVgORF058"
                     /note="putative viral membrane protein; Provisional;
                     Region: PHA03072"
                     /db_xref="CDD:222970"
     gene            complement(59457..60479)
                     /locus_tag="BPSVgORF059"
                     /db_xref="GeneID:2947873"
     CDS             complement(59457..60479)
                     /locus_tag="BPSVgORF059"
                     /note="morphogenesis; ORF059 IMV protein VP55; immunogenic
                     envelope protein; Similar to Vaccinia virus strain
                     Copenhagen H3L and Molluscum contagiosum virus MC084L;
                     Viruses of the genus parapoxvirus cause localized diseases
                     in large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; Orf virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="ORF059 IMV protein VP55"
                     /protein_id="NP_957968.1"
                     /db_xref="GeneID:2947873"
                     /translation="MDPSPEVINAYVIGVVDGRPQNDVFPTLTYLLKGVADDPKPTPT
                     PAPAPTPAPTPAPTPAPAPAPKPSPPAPHPQGDHVIHVTGWYDVKSKDYEHYFSDMCK
                     SACPQEMQHRVAHHLNLWEHIADPNSATTFPDDAFILVVNNDMTFRRPEVVKPLIEAM
                     KKNSWYMAQLRETYISGALATAIPNSGEPELMVYPGGFDVSLDAYIVRVGSLKRLYAS
                     LIEEGGVRSSMLTEISMLEKRLGLSRVVLAGADKVVHPEYYLQVKKRLGNAKGLWPML
                     AAWLAKYWPGGIYFLTTPLFSFLGVFDINVADIFILAYLLVLLILMPHSRFLWFVAGM
                     LVTAIV"
     misc_feature    complement(59460..60473)
                     /locus_tag="BPSVgORF059"
                     /note="ORF059 IMV protein VP55; Provisional; Region:
                     PHA02688"
                     /db_xref="CDD:222919"
     gene            complement(60480..62891)
                     /locus_tag="BPSVgORF060"
                     /db_xref="GeneID:2947874"
     CDS             complement(60480..62891)
                     /locus_tag="BPSVgORF060"
                     /note="similar to Vaccinia virus strain Copenhagen H4L and
                     Molluscum contagiosum virus MC085L"
                     /codon_start=1
                     /product="ORF060 RNA polymerase-associated protein RAP94"
                     /protein_id="NP_957969.1"
                     /db_xref="GeneID:2947874"
                     /translation="MDSREAILSSIIPKIRAYMRDPNTAAKSYTDFIADNKSIFVVNL
                     YNVDAITDDDIRLLFATMEQNPDADDATLISIFSYIGYKFEKQVRDDATVSLSVGERI
                     ADDTKHSMYDMFFNRFDMIIRQRRVNVLVHDDATGEAAVVNRTSDLRTAFDDSVDPEV
                     REIPFNMRNLLQYVSKNIDRIRFSKKYLEFAYLCRHIGIPVSRRKLNLRYVFMYDLDG
                     VRIPIVIRDFLDVKKVFLEATGKVYLNNFADDHPGIVEWGRAFVDAMAHDERRLLYKY
                     VFLSSRHLCDMFTDLLNPRNAKFRAIARTAVAVSEPPGWRDVVHYESPPCEHQLKLAA
                     AMRVDVDYFAKVNEFVEEYVYFEDGMAYCNICGMNIPDLNTDASGSRAGVVVPATNKS
                     IFLSEPYSYFSHSQRFIFNIVMSFDTIMKTQTWSVKYNINRLILNFLIAINARRQEYE
                     RRFAAEIKKGVFFLRLSANLLDVHASATELFQSAKTLNLNFIVALVIVLNSSADFLVS
                     FMMARGAKKKDRPVEVTEGTLRLSIATVVHHFLVKTRVCTKEDFDTVVLLTEVYTAIM
                     PEELNAHYHRLVAELHRLNTIGRTTRSRNYLVEAYSDREEARSIEFFESQRVGARPMR
                     MPARQWRVACPTVAVPAHTPDETPDARSEFQEIMSDTRVLIRVHDTNAYNMRRFDDHI
                     KIEIEKKKIIISLASLFVTNTMKYYYANPAMYVFRFSDPYPFDETLLGPEHVSHKVNG
                     YNAFRRNFFPDSDLFVYFSDSLSRVDLEFAFFLFLSGLVGSVKDWIDKSITAIKELYM
                     INFNN"
     misc_feature    complement(60483..62891)
                     /locus_tag="BPSVgORF060"
                     /note="RNA polymerase-associated transcription specificity
                     factor, Rap94; Region: Pox_Rap94; pfam03294"
                     /db_xref="CDD:281310"
     gene            62996..63724
                     /locus_tag="BPSVgORF061"
                     /db_xref="GeneID:2947862"
     CDS             62996..63724
                     /locus_tag="BPSVgORF061"
                     /note="ORF061 late transcription factor VLTF-4; envelope
                     protein; Similar to Vaccinia virus strain Copenhagen H5R
                     and Molluscum contagiosum virus MC0086R; Viruses of the
                     genus parapoxvirus cause localized diseases in large and
                     small ruminants; the poxviridae are enveloped unsegmented
                     dsDNA viruses; unlike many dsDNA viruses that replicate in
                     the host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF061 late transcription factor VLTF-4"
                     /protein_id="NP_957970.1"
                     /db_xref="GeneID:2947862"
                     /translation="MSSWRLSMNKCSSGVQTLDSLRQRLKTEAMLCDEATEQYEVRDS
                     LFPCDEVCLEIDGPRATEPSDDICQQVQLPVPPPEDVLSPPPAPVKQPKRRTKKAAEK
                     KPKAVEKLCEDDDRDNKNGEKEPTEEAQRNVSDVESSPKVEEELQNQDVASGGAAAGD
                     DELDELGESDLDLAFAAILADFKHLTGRVKALSSVLTDVQASGVRRSFAGLSKALTEA
                     AAIAAGGSKVPVAPRKKKAAAGKK"
     misc_feature    62996..63694
                     /locus_tag="BPSVgORF061"
                     /note="ORF061 late transcription factor VLTF-4;
                     Provisional; Region: PHA02687"
                     /db_xref="CDD:222918"
     gene            63754..64716
                     /locus_tag="BPSVgORF062"
                     /db_xref="GeneID:2947863"
     CDS             63754..64716
                     /locus_tag="BPSVgORF062"
                     /note="DNA topoisomerase type I; ATP-independent enzyme
                     that regulates the number of topological links between two
                     DNA strands; relaxes positively and/or negatively
                     supercoiled DNA"
                     /codon_start=1
                     /product="DNA topoisomerase type I"
                     /protein_id="NP_957971.1"
                     /db_xref="GeneID:2947863"
                     /translation="MGARALFLSKGKLFFDKDFSQPVPDDNPAYEVIANIRIPPHLTD
                     VVVYEQTLEDAHQGLIFVGKDSKGRKQYFYGRDHVRRRTAVRNAVFVRVHRVMEKINA
                     FIDSHLASGSESNAQMAAFLLMETSFFIRIGKTRYEKESGTVGMLTLRNKHLSLTEGG
                     EEMRVKFVGKDRVAHEFAVRDGQRLFAALRRLWDPGAPEQLLFDRLSERRVYAFMRRF
                     GIRVKDLRTYGVNYTFLYNFWSNVRSLDPRPSAKALICASVRQTAETVGHTPSISRSA
                     YMATAVLELVKDGTFLDRVAATDSLDDFVNSVVDYVNNSEVVNG"
     misc_feature    63763..64704
                     /locus_tag="BPSVgORF062"
                     /note="DNA topoisomerase type I; Provisional; Region:
                     PHA03101"
                     /db_xref="CDD:222985"
     misc_feature    63769..63942
                     /locus_tag="BPSVgORF062"
                     /note="Viral DNA topoisomerase I, N-terminal; Region:
                     VirDNA-topo-I_N; pfam09266"
                     /db_xref="CDD:286365"
     misc_feature    64021..64611
                     /locus_tag="BPSVgORF062"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain; Region: DNA_BRE_C; cl00213"
                     /db_xref="CDD:294145"
     misc_feature    order(64102..64104,64144..64149,64381..64383,64387..64389,
                     64420..64422,64582..64584)
                     /locus_tag="BPSVgORF062"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    order(64144..64146,64420..64422,64429..64431,64555..64557,
                     64582..64584)
                     /locus_tag="BPSVgORF062"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            64709..65128
                     /locus_tag="BPSVgORF063"
                     /db_xref="GeneID:2947864"
     CDS             64709..65128
                     /locus_tag="BPSVgORF063"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF063 hypothetical protein; Similar to Vaccinia
                     virus strain Copenhagen H7R and Molluscum contagiosum
                     virus MC088R; Viruses of the genus parapoxvirus cause
                     localized diseases in large and small ruminants; the
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_957972.1"
                     /db_xref="GeneID:2947864"
                     /translation="MDKSLAVAVRLVEGLSPLDVAVCLCHLRAEQPARRFPAIDEASG
                     EAFLDFEFADGDVASRYLPMCARELAPDERKAHMSAIACRLTEADLALAAGPRGKARA
                     VIRVCKNKKKVHRLLRLIKESEDRDVDFSFIRDAVLR"
     misc_feature    64709..65122
                     /locus_tag="BPSVgORF063"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02686"
                     /db_xref="CDD:177468"
     gene            65164..67692
                     /locus_tag="BPSVgORF064"
                     /db_xref="GeneID:2947865"
     CDS             65164..67692
                     /locus_tag="BPSVgORF064"
                     /note="similar to Vaccinia virus strain Copenhagen D1R and
                     Molluscum contagiosum virus MC090R"
                     /codon_start=1
                     /product="ORF064 mRNA capping enzyme large subunit"
                     /protein_id="NP_957973.1"
                     /db_xref="GeneID:2947865"
                     /translation="MSAPSLDELLVALAAKAAAVDRGSPADEVHHEVELVLVHPPLAT
                     LATALRLASETESFILFTVTALAKEEGKLRARMPLSRVVGLDVKNVQLVNSIDTIVWE
                     RKSLVEETELHPGCLLRHSTERRHLFVDFKKYLSAIRVELVNLVRVRSKEVIADFKFK
                     YFLGSGAQAKSALLHALNHPKIRPSATLEFEVVPSGETLDEASVLAELRAMAKALFMA
                     GSDSVFLTPALSAPPVRTVMLQKQEIPALELEGLYSVSKTDGVLAAVAVTEDGVRCSF
                     GHLGYTIRYPLAKAPKCEYRLWCEAVRPVGERVWAMHVLFVEEPQGSDRIADAAAAAE
                     ALCGVCARVEFKSKRVDGPFSATSELVEHISSAIKTEPEGIVLFYASGERSKLDFKVK
                     RDNTVDQTTNVTFRYMSSEPIVFGDGATFLEFKRFSNDKGFPKDYGTGRIFLRDDVIY
                     HNNIYCIEFTKTHREVGLASVVVPVKFISEFSQEGYLLRPRPEKTMKYLRNPSYYGNQ
                     HSVVLEHARDQLLSVMDVFDENRMAAVGHTLANDAFRLNPDTPYFTNRRTRGPLGVLS
                     NYVKTLMISLYCSKTFLNNPEKRKVLAVDFGNGADLEKYFFGEIASMVATDPDARAIE
                     RAMDRYNRLNAGLKSRYYKFNYIQETIRSETYVESIRQVMYFGRFNLVDWQMAIHYSF
                     HARHFATVMRNLRELTAPGCKVLITTMDGDYLATLTGKVSFVINRNLQESENFMSVER
                     VAEDQVMVYTPSTMAQPMTEYIVRREDIVKLFADNGFDLIDHANFETVIRRSRRFVEG
                     VSRLETRPSTKNFFELNRNALEEMDRTDVAELLKRYVLYVFSKR"
     misc_feature    65230..66141
                     /locus_tag="BPSVgORF064"
                     /note="mRNA capping enzyme N-terminal, ATPase and
                     guanylyltransferase; Region: Pox_ATPase-GT; pfam10640"
                     /db_xref="CDD:287595"
     misc_feature    66856..67689
                     /locus_tag="BPSVgORF064"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:302624"
     gene            complement(67654..68130)
                     /locus_tag="BPSVgORF065"
                     /db_xref="GeneID:2947929"
     CDS             complement(67654..68130)
                     /locus_tag="BPSVgORF065"
                     /note="ORF065 virion protein; unknown function; Similar to
                     Vaccinia virus strain Copenhagen D2L and Molluscum
                     contagiosum virus MC091L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF065 virion protein"
                     /protein_id="NP_957974.1"
                     /db_xref="GeneID:2947929"
                     /translation="MESRVPIGGDLQNLKSLVAHAPTLDRVSAAVAGWRHVLVERDHR
                     GTPVRLHRFEHALRLDNLTALQAVKAVFGHRKRMMRALFPSEAIFDSLEPLQPAETLE
                     LRAAPPVPEDDGSEIDAQETAWWLTELFNAFRAGGGSGAAPTYCLPLAEDVKHVAL"
     misc_feature    complement(67657..68124)
                     /locus_tag="BPSVgORF065"
                     /note="ORF065 virion protein; Provisional; Region:
                     PHA02685"
                     /db_xref="CDD:177467"
     gene            68111..68788
                     /locus_tag="BPSVgORF066"
                     /db_xref="GeneID:2947930"
     CDS             68111..68788
                     /locus_tag="BPSVgORF066"
                     /note="similar to Vaccinia virus strain Copenhagen D3R and
                     Molluscum contagiosum virus MC092R"
                     /codon_start=1
                     /product="ORF066 virion protein"
                     /protein_id="NP_957975.1"
                     /db_xref="GeneID:2947930"
                     /translation="MGTRDSIYYRGGTHELPVAPDAAVVVLGVAGPVAARAPSGRRIF
                     VAEYALSAAPGAPLRARLTASGFRSAAGAWASVEDFDVCGRPAAWTRVPEEGGTRVPV
                     PEDGAVAIAWSEGGATSALRACVVARAADDESALGAALKDGTFDAAAPGAALLAAVGA
                     PALGSERAALVTAPGAPHRVRLCTNRDKLRAFAVGWFGAQLSALGPENEKVFSAFDKA
                     RSCLDDR"
     misc_feature    68126..68785
                     /locus_tag="BPSVgORF066"
                     /note="ORF066 virion protein; Provisional; Region:
                     PHA02684"
                     /db_xref="CDD:177466"
     gene            68733..69476
                     /locus_tag="BPSVgORF067"
                     /db_xref="GeneID:2947931"
     CDS             68733..69476
                     /locus_tag="BPSVgORF067"
                     /note="similar to Vaccinia virus strain Copenhagen D4R and
                     Molluscum contagiosum virus MC093R"
                     /codon_start=1
                     /product="ORF067 uracil DNA glycosidase"
                     /protein_id="NP_957976.1"
                     /db_xref="GeneID:2947931"
                     /translation="MKRYFPPLIRPGPVWTTASMAETPVLRTVRLQHRPHRIEYHPDW
                     EPVVETLVDEYNAVAPWLLRDATSPAPENIFAQLAKPLSDKRVCVCGIDPYPRGGTGV
                     PFQSPDFSKKTIRAIAAAVSRMTGVQGYAGYDLDAVPGVLAWNYYLSCREGETKSHAM
                     YWERVSRVLLQHIAKHVSVLYCMGRTDFQNVRARLDVPVTLVVGFHPAARDGQFAREK
                     AFSVVNALLELNGKSQVDWARGFSFYSEN"
     misc_feature    68937..69443
                     /locus_tag="BPSVgORF067"
                     /note="Uracil-DNA glycosylases (UDG) and related enzymes;
                     Region: UDG_like; cl00483"
                     /db_xref="CDD:294330"
     misc_feature    order(69003..69017,69165..69167,69348..69350)
                     /locus_tag="BPSVgORF067"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198424"
     misc_feature    order(69006..69011,69015..69017,69282..69287,69345..69350)
                     /locus_tag="BPSVgORF067"
                     /note="active site"
                     /db_xref="CDD:198424"
     gene            69490..71856
                     /locus_tag="BPSVgORF068"
                     /db_xref="GeneID:2947955"
     CDS             69490..71856
                     /locus_tag="BPSVgORF068"
                     /note="DNA replication; similar to Vaccinia virus strain
                     Copenhagen D5R and Molluscum contagiosum virus MC094R"
                     /codon_start=1
                     /product="ORF068 NTPase"
                     /protein_id="NP_957977.1"
                     /db_xref="GeneID:2947955"
                     /translation="MAAPVCDNTHVFLLKRLGVPASCRRAEDPRFVEILTPYELSSYI
                     ERNPGCCLFETLRDEEDCSVVRIFADVDMDAAMEEEDFVAALEDLILELGSFFDRFAS
                     GSCGTVPGELKRCMLSGFTVTRSTAEHKTSFHLIFTDAYTTLDTLVAAKRPLLDLCRR
                     SDNVLLRALDTAVYRRGATLRVVGTRKTPDATAVHLMQSPDDDIKDYLFTYVELSDTS
                     VYFELSERERDCGASVVAWETSYIPFQDAMRRVSQAVVNDIVNLREITEDNFLNTPLV
                     IDYATRCALCRKPRHKHAHHITMGNGCLRIVKGGNAHNCKVKIIQLEGNRLFTAAQII
                     IASDVVKLTERGDYIVWLNNSWRFSSEESLITKLVLDVRHSLPADYANEMLCPRKRKV
                     VETNIRDMLVDVSETDVLYDKLPFTNGVLDLATGEFLTGDRAKECVCTVSTGYRFSRE
                     EYEAAADSEAMRRLVSVIDDIQPNTPENAENRALYERAMSSALCGATKTVIVFFFGDT
                     MTGKSTSKRLLHSVLSGLYIETGQTVLTDVLDKGPNPFVANMHLRRAVFCSELPDFAC
                     NNARKLRSDNFKKLTEPCIVGRPCFSNKIHNRNHATFIIDTNYRPVFDRVDNALMRRV
                     ALVRFRTHFSSAATRAAAVHNIEYSAVKDMDDSLDAKIQRNYFRYAFLRLLVEWFRKY
                     HVPQVSLDATPDAVPDFAFHRRVAELVVPSNETHRRMMETLSKLGYVLVNGNVAMPAN
                     VFQQRLAAHFNARVHGGDIEAFLFRHKKVVNVTEEYIEYVFIDDVENK"
     misc_feature    70501..70908
                     /locus_tag="BPSVgORF068"
                     /note="D5 N terminal like; Region: D5_N; pfam08706"
                     /db_xref="CDD:285868"
     misc_feature    70726..>71391
                     /locus_tag="BPSVgORF068"
                     /note="Virulence-associated protein E; Region: VirE;
                     cl23993"
                     /db_xref="CDD:305150"
     misc_feature    71563..71850
                     /locus_tag="BPSVgORF068"
                     /note="Poxvirus D5 protein-like; Region: Pox_D5;
                     pfam03288"
                     /db_xref="CDD:281304"
     gene            71837..73789
                     /locus_tag="BPSVgORF069"
                     /db_xref="GeneID:2947956"
     CDS             71837..73789
                     /locus_tag="BPSVgORF069"
                     /note="similar to Vaccinia virus strain Copenhagen D6R and
                     Molluscum contagiosum virus MC095R"
                     /codon_start=1
                     /product="ORF069 early transcription factor VETFs"
                     /protein_id="NP_957978.1"
                     /db_xref="GeneID:2947956"
                     /translation="MMSKINRRPPRPRSERMNTDVIKLFHGHDETVPGILPHQLATVD
                     FLVRRVLDDGVSVLLFHIMGSGKTVIALLFAMVASRTKKVYILVPNVNVMNIFNYSMV
                     MVANLFNAPFVIENIFVYSTTSFYSLNCNDGVVNYNGLSKYENSVFVVDEAHNIFGNN
                     TGELMMVIKNKTRVPFLLLSASPITNTPITLSSIISLMSETDVEIGDIVVQGKKVFQI
                     LLNEHGVSVLRDVLKGRISYYEMPDTDMPEVVYHGRRFLDTRVVYCRMSRLQEENYLT
                     VRRLCNNEMFEKNMNNVSMAVLGPLNLVNNLDVLFQAQEKDIYPNLRISNGVLYGNEL
                     TKLDISCKFKFFIDKVEEMRGKHFIYFSNSTYGSLIIRHVMLSNGYSEYNGSHSNNPH
                     TIDGRPKTFAIVTSKMKASLEELLEAYNSPENDDGSRLMFLFSSNIMSESYTLKEVRN
                     IWFMTIPDTFSQFNQILGRAVRKFSYTDVSLPVNVYLMAAVYSDFDEDIVSLEDYSVE
                     DINALPFDVKKLFYLKFKAKETNRVYAILQELSEAYSARPHPQLVDVVLGEIVRQFFA
                     RRCRVPAEDPKLVAVVKAVLGTREAALEYIRAVVDGHFFVTNRTFGKCLLFRHERDIV
                     TVPFELEHDAFAWAINFRKEVSVVNI"
     misc_feature    71945..72448
                     /locus_tag="BPSVgORF069"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    72002..72385
                     /locus_tag="BPSVgORF069"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    72026..72040
                     /locus_tag="BPSVgORF069"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    72287..72298
                     /locus_tag="BPSVgORF069"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    72854..73252
                     /locus_tag="BPSVgORF069"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     gene            73827..74357
                     /locus_tag="BPSVgORF070"
                     /db_xref="GeneID:2947957"
     CDS             73827..74357
                     /locus_tag="BPSVgORF070"
                     /note="similar to Vaccinia virus strain Copenhagen D7R and
                     Molluscum contagiosum virus MC097R"
                     /codon_start=1
                     /product="ORF070 RNA polymerase subunit RPO18"
                     /protein_id="NP_957979.1"
                     /db_xref="GeneID:2947957"
                     /translation="MSTFRQTVYLPVTVQPHELTLDFRGNVAEAVMREYLFKEKGGLM
                     ATDIEVCLGSEMPLGRIVGNAVVISVPCNVTFKYYRVGDVVRGTLNIEDETNVFVDCG
                     DLVCQLGKSSGAVTFNESKYCLVRNGAVYSHGSEVTAVLREARSGRESAFVFSAVLAA
                     DDREGGSPRGSPRAEK"
     misc_feature    73827..74300
                     /locus_tag="BPSVgORF070"
                     /note="Poxvirus DNA-directed RNA polymerase, 18 kD
                     subunit; Region: Pox_RNA_pol; pfam03293"
                     /db_xref="CDD:281309"
     gene            74389..75060
                     /locus_tag="BPSVgORF071"
                     /db_xref="GeneID:2947958"
     CDS             74389..75060
                     /locus_tag="BPSVgORF071"
                     /note="similar to Vaccinia virus strain Copenhagen D10R
                     and Molluscum contagiosum virus MC099R"
                     /codon_start=1
                     /product="ORF071 NPH-PPH downregulator"
                     /protein_id="NP_957980.1"
                     /db_xref="GeneID:2947958"
                     /translation="MRSYTSLLSKLVKANRRLGSTRVFRDPLQHISATAFVYRRIDRY
                     RRISICAVLTTTDGLVVACRRRLSFLSTELAETRSAARRVMLAARHADALSRIGASRS
                     RDDVMFPGGAPLPGETFVDCVTREVEEETGIRRDQMRIDERMFVHAFIDDLVTGRDFD
                     AIIFTGDLRLSSAEVERQFVPNGEVKGLLFLRPTEDAGGVMARLAAFARAAARMRCWG
                     SAATR"
     misc_feature    74389..74499
                     /locus_tag="BPSVgORF071"
                     /note="Viral D10 N-terminal; Region: VD10_N; pfam08476"
                     /db_xref="CDD:285650"
     misc_feature    <74710..>74931
                     /locus_tag="BPSVgORF071"
                     /note="Nudix hydrolase is a superfamily of enzymes found
                     in all three kingdoms of life, and it catalyzes the
                     hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+...; Region:
                     Nudix_Hydrolase; cl00447"
                     /db_xref="CDD:294304"
     misc_feature    order(74719..74727,74755..74781)
                     /locus_tag="BPSVgORF071"
                     /note="nudix motif; other site"
                     /db_xref="CDD:239217"
     gene            complement(75050..76966)
                     /locus_tag="BPSVgORF072"
                     /db_xref="GeneID:2947932"
     CDS             complement(75050..76966)
                     /locus_tag="BPSVgORF072"
                     /note="similar to Vaccinia virus strain Copenhagen D11L
                     and Molluscum contagiosum virus MC100R"
                     /codon_start=1
                     /product="transcription termination factor NPH-I"
                     /protein_id="NP_957981.1"
                     /db_xref="GeneID:2947932"
                     /translation="MTSAHAAYVDYALRRTASMPSEMQGVNGAVRLKDYQLFVARVFL
                     GLDRMHGLLLFHETGVGKTMTAVYVLKHLRDVFTNWTVVVLVKKALIEQPWTSTMMQF
                     APEVVPNCAFINYDDPRFHHRFFTFIKTSSAGSRICVVIDEFHNFISMSLTKEDGRQR
                     PARTVYNYLAKNIPLVNGKLLCLTATPVVNSVREFAMAMNLLRPGVLGQAALFDGGVL
                     ANPEDLVDKLGGVCSYLVNNEASIFDDVDGSAAFARKRVRMMYVDMTAKQTAAYRRAA
                     VMERKSGAAVFRVYRRTAATFAFEDVPDKSVLSKQEYDETVAALFADFARNVGGRTFS
                     EAATKLFRSGETISGDRMTSADVSLLTELRERSCKYTEVCLRILASPGKCLVFEPFVN
                     VTGIEMLLLYFAAFGISHVEFSSRTRDTRAKLVDAFNACDNTDGERIKVCVFSLSGTE
                     GLSFLSINDIFILDMTWNEASLRQIVGRAVRLNSHEMTPAERRYVNVHFVVARQDSGA
                     ATVDEDLLDLIKDKSRQFTQLFRVLKRSSLEWVRAAFTDFAPLADDSGWLALVSRPAD
                     AREATRAVRLTDGQSVWYSTSAALVTVRKGFLETGGKLFDDDGNFLAEIGASPTVRVS
                     GGRLVYVVDPAAIA"
     misc_feature    complement(76361..76888)
                     /locus_tag="BPSVgORF072"
                     /note="DEAD-like helicases superfamily; Region: DEXDc;
                     smart00487"
                     /db_xref="CDD:214692"
     misc_feature    complement(76406..76873)
                     /locus_tag="BPSVgORF072"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    complement(76778..76792)
                     /locus_tag="BPSVgORF072"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(76532..76543)
                     /locus_tag="BPSVgORF072"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(75518..75823)
                     /locus_tag="BPSVgORF072"
                     /note="Helicase conserved C-terminal domain; Region:
                     Helicase_C; pfam00271"
                     /db_xref="CDD:278689"
     misc_feature    complement(75074..75514)
                     /locus_tag="BPSVgORF072"
                     /note="Nucleoside triphosphatase I C-terminal; Region:
                     NPHI_C; pfam08469"
                     /db_xref="CDD:285643"
     gene            complement(76996..77580)
                     /locus_tag="BPSVgORF073"
                     /db_xref="GeneID:2947933"
     CDS             complement(76996..77580)
                     /locus_tag="BPSVgORF073"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF073 hypothetical protein"
                     /protein_id="NP_957982.1"
                     /db_xref="GeneID:2947933"
                     /translation="MHRPGTRRRARHHENLHMPSTRASLGPHIHLPRRRLVLRHRGIR
                     GYFGDSVASRREMLDPDCVQAIVFGHGFVDTYSRRLDVRLLGAYYAAARPLCERPLFA
                     IRGWRRQYPVVAASLDAVERSTRRVLRSMCRTYSAYGCRARENSAANEAVHRRWFGHG
                     AARGRRARLRRRSRNRAAKRRVKKRARFCNSRPL"
     gene            complement(77633..78505)
                     /locus_tag="BPSVgORF074"
                     /db_xref="GeneID:2947934"
     CDS             complement(77633..78505)
                     /locus_tag="BPSVgORF074"
                     /note="similar to Vaccinia virus strain Copenhagen D12L
                     and Molluscum contagiosum virus MC101L"
                     /codon_start=1
                     /product="ORF074 mRNA capping enzyme small subunit"
                     /protein_id="NP_957983.1"
                     /db_xref="GeneID:2947934"
                     /translation="MEATDAVRRSIREGLSVTLPTFETAPRLDLQLGAGHLPSLEYGA
                     NYFLQLSRVNDLNRMPTDMLRLYTHDLMTEERDVEKVLEAHGIASVRGVQRGGKADAV
                     VLDLSARNKLYRKERGMIRSNNHLTENNLYVADYHAITFAVMRPLLEISQERFVVLKL
                     PTLFGTDVVHALRVYCSLFGTVRLFKCVSDSWLKDSAVMVASDPRRQDIAKFVAHVRD
                     RAKTASWRESLAVPFRILRDPVESEFVDRFLAFAGRVYDALYVTHSLLYESMTSESKS
                     IENESQRKLKLLLQ"
     misc_feature    complement(77639..78493)
                     /locus_tag="BPSVgORF074"
                     /note="Poxvirus mRNA capping enzyme, small subunit;
                     Region: Pox_mRNA-cap; pfam03341"
                     /db_xref="CDD:281352"
     gene            complement(78547..80184)
                     /locus_tag="BPSVgORF075"
                     /db_xref="GeneID:2947935"
     CDS             complement(78547..80184)
                     /locus_tag="BPSVgORF075"
                     /note="IMV assembly; similar to Vaccinia virus strain
                     Copenhagen D13L and Molluscum contagiosum virus MC102L"
                     /codon_start=1
                     /product="ORF075 rifampin resistance protein"
                     /protein_id="NP_957984.1"
                     /db_xref="GeneID:2947935"
                     /translation="MNNSVVSLVGADDSVRRASVFTTDYRVPTMYMPQYITTQGVVDT
                     SGDAVTVTFEIRDKYISAINSLVLSIDLPEIKGMGKLCYVPYIGYKMIRHVAINSSSD
                     TIWETSGEELFDSCMENDRVMELSGFSRELNDLSTGTSPNDVIKEAVTVHAYIKTPFD
                     AERTFSTLKLGDNKIVVTVTLNPISCVMVYDEAFDMSKLAKEFPYTTELSFIGYMVKN
                     MHARPAFIEMPRRRVEQLNHTTSVITDVHACTSLSVYTKPVFADANNRFISYPGYQQS
                     EGDFVLAFVERLLEDMVIVSNCYPEGFPETAEIVEVPSSGVVSIQDTDVFVRVDDVPV
                     GMRVFLHTNILVFSTRKNSVVYNMSKKFSAITGAYSRATHRIRFTSVVHSVNIGDASI
                     PVSIWTCQRNVYHGDNRSPESRSKDLFVADPFLKGVDFKNKTDVIARMDVRFGNEVLY
                     SESSPVSRVFSEILGKTAGVRTLQFNFTPGTFFSPTALTSNVSRGKDKLTIRINTAPM
                     EAHNPLLYVPRQMVVVCNELYRISYDTGILVEKVTSQ"
     misc_feature    complement(78556..80175)
                     /locus_tag="BPSVgORF075"
                     /note="Poxvirus rifampicin resistance protein; Region:
                     Pox_Rif; pfam03340"
                     /db_xref="CDD:281351"
     gene            complement(80205..80657)
                     /locus_tag="BPSVgORF076"
                     /db_xref="GeneID:2947936"
     CDS             complement(80205..80657)
                     /locus_tag="BPSVgORF076"
                     /note="late transcription factor VLTF-2; acts with RNA
                     polymerase to initiate transcription from late gene
                     promoters; has zinc-finger motifs; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="late transcription factor VLTF-2"
                     /protein_id="NP_957985.1"
                     /db_xref="GeneID:2947936"
                     /translation="MKRIALCRVDISAPRASACPPPAAGRIEYVLPKYFNSVSSDRLA
                     LRAADGSCWFCKQRVGAAPLAVETLDGAAIGEFCSRLCRDSFAGLVKHLVALREEPKI
                     ELLPLEMYADPDRVRALINETRELDGVYGRCYVERDGRAARMALKSLI"
     misc_feature    complement(80208..80657)
                     /locus_tag="BPSVgORF076"
                     /note="late transcription factor VLTF-2; Provisional;
                     Region: PHA03073"
                     /db_xref="CDD:177518"
     misc_feature    complement(80400..80507)
                     /locus_tag="BPSVgORF076"
                     /note="MYM-type Zinc finger with FCS sequence motif;
                     Region: zf-FCS; pfam06467"
                     /db_xref="CDD:283998"
     misc_feature    complement(80208..80396)
                     /locus_tag="BPSVgORF076"
                     /note="Poxvirus trans-activator protein A1 C-terminal;
                     Region: Pox_TAA1; pfam03295"
                     /db_xref="CDD:281311"
     gene            complement(80684..81358)
                     /locus_tag="BPSVgORF077"
                     /db_xref="GeneID:2947848"
     CDS             complement(80684..81358)
                     /locus_tag="BPSVgORF077"
                     /note="late transcription factor VLTF-3; initiates
                     transcription from late gene promoters; The poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes encoding non-structural
                     proteins involved in genome replication and late genes
                     encoding the viral structural proteins"
                     /codon_start=1
                     /product="late transcription factor VLTF-3"
                     /protein_id="NP_957986.1"
                     /db_xref="GeneID:2947848"
                     /translation="MNLRLCGSCRRNGLVSDTDYDFCLFCETVFPMGIRVQKRSNFHV
                     SNKLIHLRNVLRRLLSKQCSEDVIRELREIMDRHQIRPVDVDANYVSSFLKDSDMINK
                     KDYKLVFEIINQVKNEKLNLSTEKINEVIEIFKQLVFFCQESTPSKTINYSFFLDKIF
                     EVTGVTSNLRPQTVKNYAKNNSNQLTWENFLAHMRARKRAAQIQEFGHDYVFRHARFA
                     ACSLDP"
     misc_feature    complement(80687..81358)
                     /locus_tag="BPSVgORF077"
                     /note="late transcription factor VLTF-3; Provisional;
                     Region: PHA03074"
                     /db_xref="CDD:165363"
     misc_feature    complement(81263..81358)
                     /locus_tag="BPSVgORF077"
                     /note="A2L zinc ribbon domain; Region: A2L_zn_ribbon;
                     pfam08792"
                     /db_xref="CDD:285944"
     misc_feature    complement(80765..81247)
                     /locus_tag="BPSVgORF077"
                     /note="Poxvirus Late Transcription Factor VLTF3 like;
                     Region: Pox_VLTF3; pfam04947"
                     /db_xref="CDD:282761"
     gene            complement(81366..81608)
                     /locus_tag="BPSVgORF078"
                     /db_xref="GeneID:2947849"
     CDS             complement(81366..81608)
                     /locus_tag="BPSVgORF078"
                     /note="ORF078 thioredoxin-like protein; alpha helical
                     protein with a Cxx(x)C motif in the N-terminus; may
                     facilitate the reduction of other proteins by
                     thiol-disulfide exchange; Similar to Vaccinia virus strain
                     Copenhagen A2.5L and Molluscum contagiosum virus MC105L;
                     Viruses of the genus parapoxvirus cause localized diseases
                     in large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; Orf virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="ORF078 thioredoxin-like protein"
                     /protein_id="NP_957987.1"
                     /db_xref="GeneID:2947849"
                     /translation="MGSRDASWYAAYSVTLDPPRRCTRCSLNLTRFVNEDRDNAMLLI
                     ASQPNRARILGEFLVFCRNKSMDTKVLDREIRRVLL"
     misc_feature    complement(81372..81593)
                     /locus_tag="BPSVgORF078"
                     /note="ORF078 thioredoxin-like protein; Provisional;
                     Region: PHA02683"
                     /db_xref="CDD:177465"
     gene            complement(81613..83664)
                     /locus_tag="BPSVgORF079"
                     /db_xref="GeneID:2947850"
     CDS             complement(81613..83664)
                     /locus_tag="BPSVgORF079"
                     /note="similar to Vaccinia virus strain Copenhagen A3L and
                     Molluscum contagiosum virus MC106L"
                     /codon_start=1
                     /product="ORF079 virion core protein P4b precursor"
                     /protein_id="NP_957988.1"
                     /db_xref="GeneID:2947850"
                     /translation="MASSSAFALADDFCNARIDLAPSYDYAGLSLDCDHVHIPQQTMA
                     CGVCNAMSLINREDMVSAGARAQRPVRSQSASRGASRRAPSRSTGRGAARSSSARPSS
                     RQSGSGSSSPSSTGNVLMPVDRMTSMQEWQLQIRREGEMIADYLKSTQSDARNITIQE
                     LMNIMSRLGIRSRDRSELFDLLSSVKAAMADTGVSVSNSHPLVLIYARNHPRVNKQMK
                     ELEQLHSLSSYQNLLSTTQFQSGHFKDMSSSSDLLFSFKSADSVGFVHPIIMALFGVR
                     LPGLEAAFVTGDSLSLLQQLHHNHRVRPCNYQLLVNKLTEESSIIMPGVTDTVSMEIQ
                     RAVLHTNLRRCILNLRMGIFHCNSDESIDNQLMKIIHPACSSIMSDEEQMLASIFAIA
                     SFRPTLVSVSRPTFGTGIGGMVDMSLRSVPYLVVDSRKMLTTSNAPLSIGGNFSCTAE
                     AGRVLYLPSGSSSLGATGTDVAATVCAANSYVYEKERSPVITNGLVVFLVERRSSGMM
                     QTGDCFTNYRPMISDIPIEVAQDMTLNGIMYRLMSAVCYRTGDGAADGCGAVDAFANG
                     YCTILFTDAGPWLYDPMSALSRGARESRLMRAMRNLHAQENGAGGDSQSLNDWLRGDG
                     AAALAAKQSQHMQHKTMFEDDLLTMEEAMAMISKYCTILVYAQEYDPYMSSRSMCDVL
                     C"
     misc_feature    complement(81619..83637)
                     /locus_tag="BPSVgORF079"
                     /note="Poxvirus P4B major core protein; Region: Pox_P4B;
                     pfam03292"
                     /db_xref="CDD:281308"
     gene            complement(83680..84414)
                     /locus_tag="BPSVgORF080"
                     /db_xref="GeneID:2947851"
     CDS             complement(83680..84414)
                     /locus_tag="BPSVgORF080"
                     /note="virion assembly; similar to Vaccinia virus strain
                     Copenhagen A4L and Molluscum contagiosum virus MC107L"
                     /codon_start=1
                     /product="ORF080 virion core protein"
                     /protein_id="NP_957989.1"
                     /db_xref="GeneID:2947851"
                     /translation="MDLRKRFARDLAKTSLVLAEYNSMLFTKCPQAAPAQQPVCPTEE
                     VDSMEKYTVKEMGKYFQQRLKSSSDCFARPDGRNPLAPPPCASPRASCAPPPVCPAAE
                     APVCPVQAQTCPPAPPLPCADRPVPAARPSLGQQAPPPYPADNCPSVTVAKAPESSPV
                     LETRIPDKVTESASDRVNIKRELENIAESVRDLSAESSNLTNDIEQAKNATQTAIDDL
                     RRLLSRSMDSSNATSAVDRVDNASSS"
     misc_feature    complement(83683..84414)
                     /locus_tag="BPSVgORF080"
                     /note="ORF080 virion core protein; Provisional; Region:
                     PHA02682"
                     /db_xref="CDD:177464"
     misc_feature    complement(83725..>83928)
                     /locus_tag="BPSVgORF080"
                     /note="virion core protein; Provisional; Region: PHA03041"
                     /db_xref="CDD:222963"
     gene            84455..84970
                     /locus_tag="BPSVgORF081"
                     /db_xref="GeneID:2947857"
     CDS             84455..84970
                     /locus_tag="BPSVgORF081"
                     /note="similar to Vaccinia virus strain Copenhagen A5R and
                     Molluscum contagiosum virus MC108R"
                     /codon_start=1
                     /product="ORF081 RNA polymerase subunit RPO19"
                     /protein_id="NP_957990.1"
                     /db_xref="GeneID:2947857"
                     /translation="MEESVVAGFADEEDEDEIEDYEEEEEDEEPAEGAAGTSVSDVTP
                     SATEKLVASEVPEDAAAVETNARQRVTARVEELKARYTRRMSLFELTGIVAESFNLLC
                     RGRLPLVADPTDPALDNELKVVVREIEENVCPIVIEKNGEFLSTQDFDPECLRYHLEY
                     MTDLWKSQGRM"
     misc_feature    84542..84967
                     /locus_tag="BPSVgORF081"
                     /note="Poxvirus DNA-directed RNA polymerase 19 kDa
                     subunit; Region: Pox_RNA_Pol_19; pfam05320"
                     /db_xref="CDD:283076"
     gene            complement(84972..86126)
                     /locus_tag="BPSVgORF082"
                     /db_xref="GeneID:2947858"
     CDS             complement(84972..86126)
                     /locus_tag="BPSVgORF082"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Vaccinia virus strain Copenhagen A6L and
                     Molluscum contagiosum virus MC109L"
                     /codon_start=1
                     /product="ORF082 hypothetical protein"
                     /protein_id="NP_957991.1"
                     /db_xref="GeneID:2947858"
                     /translation="MDRLRCCYARFYDISREYLQRGTGMCVDCFDFETDVDTLVAMVP
                     MLEGSVCPIAPDMADADVLALMKHCNYQALSFWFLKSDAVVKSVYNSIRSEEERREFV
                     AVFRELLLAVQTIVSLNAMYKSIRSDTEEIVDDSKKLMEIVAQIRGANGSNSIMKILQ
                     GHYSFLVKCLNKVFSDENYVLKLVAVFDSSLLSDKEKLKEYREMLLISAESAAHGIQC
                     ISDVDIASVTIDGDRAKYLKFIKKITSSMLVFQNRELRPVKFATAVCKLYVVLYNEFK
                     TNASIAQLVREVIDSLRGKLAPQDLKSAGVKNVQTLVRYVANHRTLYKDLLAGEYSTR
                     EGSLVDIVQGVISANGITYRGEPLQIRDLISLVKEKIAEAATAAPPPAAE"
     misc_feature    complement(85014..86126)
                     /locus_tag="BPSVgORF082"
                     /note="Poxvirus A6 protein; Region: Pox_A6; pfam04924"
                     /db_xref="CDD:282741"
     gene            complement(86167..88287)
                     /locus_tag="BPSVgORF083"
                     /db_xref="GeneID:2947859"
     CDS             complement(86167..88287)
                     /locus_tag="BPSVgORF083"
                     /note="similar to Vaccinia virus strain Copenhagen A7L and
                     Molluscum contagiosum virus MC110L"
                     /codon_start=1
                     /product="ORF083 early transcription factor VETFL"
                     /protein_id="NP_957992.1"
                     /db_xref="GeneID:2947859"
                     /translation="MLYTVSPQLVVLVGRHQEIERVLYLSLYDEIDQSSPIYFFAKQY
                     IQHDPVHVRRHILLTMRVQQLKGYLGHLLDLQEDIIVYSHKNNLEYSYVDNTIFNPFS
                     PTQKKTLIRTDGILYNAYADACDFLVVWVARAADTAAPEFGSFEEPSDSILKFEERLI
                     QEFAGLDLNMTVETKFNNIFRTNLRESGLRAIAQQSPERRREVGDFDILLSKTDDFFI
                     SMTGSRFLLVDEPLNLSVWDAEGALAISSDGKTLTVNDVALFTKLVASMDVKMDRVKG
                     DITYKVSLGTHITSKMKLDMETSFIFVETATNNILLSTDKRISIILAKSHVSVKVKNY
                     IPNIEKYFTFLIIAISVMFNSVKQSSDFTKVETVYWSRICQNTKTKNRKPVIVQSLDA
                     DMTKVSDNFFRSDAREVFVNSNGVMFSCMDPDGRYNSVGFLSIFHRLQRICIPCCFLR
                     SQAHTDTFKSCVYDEEVDRSSLNPYILNFGKVVTESKLSFLPIIFDKYFNEGLEADFE
                     ADNKRLRATAGYYVVHCCEGAIVRLRSVSEIVAYVNESGNILISGDMVYFPMRLSDSS
                     ATRILIQEIVHDVVCIRKDATEDAIHIAPDARSRLADMFPHKTVPRVVAEEAGLTLAT
                     DGFFVDGARFAPKLSSSFTAFVRNATVPNAVSRHFAKLFRYVVTDAPERFVKTWSINC
                     ALKMGTEPDSSRAEALLRELYPQQ"
     misc_feature    complement(86176..88281)
                     /locus_tag="BPSVgORF083"
                     /note="Poxvirus early transcription factor (VETF), large
                     subunit; Region: Pox_VERT_large; pfam04441"
                     /db_xref="CDD:282317"
     gene            88354..89277
                     /locus_tag="BPSVgORF084"
                     /db_xref="GeneID:2947860"
     CDS             88354..89277
                     /locus_tag="BPSVgORF084"
                     /note="similar to Vaccinia virus strain Copenhagen A8R and
                     Molluscum contagiosum virus MC111R"
                     /codon_start=1
                     /product="ORF084 intermediate transcription factor VITF-3"
                     /protein_id="NP_957993.1"
                     /db_xref="GeneID:2947860"
                     /translation="MFQPVPDMSVEADIKLGDVSVDATRAGAREKTVFFARNKRMYPH
                     RSKDEERKLSLGFFLQRLDFLTSKEVNLQFRSLDAVKTETVLKKNNVLVAPYILIATL
                     AGRGFRLTETMVEIYFPELYRETSKRFRFGAQIRIIQEFMGYATDSYHTYDFETYFAF
                     MALVIRGADTDVEAFDVRPESGLVRSLTEITYRLYVMQLRSDAAQWSVSTGSVVSQVV
                     NTVLTVVCELADRAEAEGAVPVCDLARENPLSVEDLRKYGTRMRALLTTMTRARSFKI
                     NRRDRDALSRFCRLAPGATSCPTSGCSASSA"
     misc_feature    88354..89220
                     /locus_tag="BPSVgORF084"
                     /note="VITF-3 subunit protein; Region: Pox_A8; pfam04745"
                     /db_xref="CDD:282584"
     gene            complement(89237..89527)
                     /locus_tag="BPSVgORF085"
                     /db_xref="GeneID:2947861"
     CDS             complement(89237..89527)
                     /locus_tag="BPSVgORF085"
                     /note="similar to Vaccinia virus strain Copenhagen A9L and
                     Molluscum contagiosum virus MC112L"
                     /codon_start=1
                     /product="ORF085 late virion membrane protein"
                     /protein_id="NP_957994.1"
                     /db_xref="GeneID:2947861"
                     /translation="MRPCYVTVIKSIGGLALFQVANGAIDLMRHLFMHFCEHRLRSNT
                     LAAVLFKTVISMIMYLLLGVALIYMFSDSDCSGGERPAPPKQTTRSTQTSGS"
     misc_feature    complement(89300..89458)
                     /locus_tag="BPSVgORF085"
                     /note="A9 protein conserved region; Region: Pox_A9;
                     pfam04835"
                     /db_xref="CDD:282664"
     gene            complement(89543..92269)
                     /locus_tag="BPSVgORF086"
                     /db_xref="GeneID:2947942"
     CDS             complement(89543..92269)
                     /locus_tag="BPSVgORF086"
                     /note="similar to Vaccinia virus strain Copenhagen A10L
                     and Molluscum contagiosum virus MC113L"
                     /codon_start=1
                     /product="ORF086 virion core protein P4a precursor"
                     /protein_id="NP_957995.1"
                     /db_xref="GeneID:2947942"
                     /translation="MTASNVQMAMHHVEGAEYMFRIVSNVLPTLCADFKPSYDLTRTY
                     VHPLDSMFLDGLEKLMGDEETEVTVKQFGINYLLDKSANSYLIPATVGPNSAEILTKR
                     LKLTDIANPVVCTLAFNDVPPFTRELLKLRTSSFEAHARVAGGYVRYPTGLQVKSPIS
                     FPALSFDNTYLLNLTYPHILGPPEIGFRARMVDGTVIARDLLMLLNIRALLTDASRAR
                     FDAAYEIPESAAKHGIVLAQTPQVDTEITTMQLKYLLTFFQYFDQHFSLRQLTFNGQN
                     LRMVKGTVASLAASIFYQSQLVRLTQLHSSVSLADHMDALTTGGAPVRIAAPGMKFVD
                     ISANVSYYTSLLSMLMRADRTSPLIAPAKSLFWDGLEYSEFKAMSTADALFLSATCYT
                     FALFDHEDVTYCSGLADALAAGKTPLRVCFYPRAVGTKTVAALVLETLSSINLISPRE
                     FPRRSTHQPNHIGLSHKAFMQFFQLLRVVDRCDPDRALKEVLMAYAGIRMTDKGPVHY
                     INKESHADFVKLLFGAMGFRVHVSSSVYGSRRQTVITVSPSVTKHTVSRILTKVCCSK
                     DEVEKIMASAHDLLQFMVTATNVRDAHTYHGQSQCRAPLYATFNWRFPRTIYGGAPGG
                     EEAETLENSSSAVVLSNNLGILDRINVRGIFSANTIDELMSVDCFMPENVAFKHNLQS
                     LIDTDQLTGESILMAMPNNLIDRLVSVGGSPDMTVSALLDDVTGSTDESCVSSNEIAD
                     AINAALKTKYVRDTSNIVNSALSIASARSEKQLEAVKRATCCVSSLFKQLTQSVYTTE
                     RIFGVPISDEVKNSILERYRVFVELSKSLYMDMIALENLKALLLIVRRSGRYVGDSEI
                     GVAEMQKAYEMVKEKISRLTGYYANIGELYWNHMKRNLNLRSSDGSVSFDSE"
     misc_feature    complement(89564..92233)
                     /locus_tag="BPSVgORF086"
                     /note="Poxvirus P4A protein; Region: Pox_P4A; pfam03395"
                     /db_xref="CDD:281398"
     gene            92284..93321
                     /locus_tag="BPSVgORF087"
                     /db_xref="GeneID:2947943"
     CDS             92284..93321
                     /locus_tag="BPSVgORF087"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Vaccinia virus strain Copenhagen A11R
                     and Molluscum contagiosum virus MC114R"
                     /codon_start=1
                     /product="ORF087 hypothetical protein"
                     /protein_id="NP_957996.1"
                     /db_xref="GeneID:2947943"
                     /translation="MTAVPVTDIPGDYGPTSFSEDNYPLNKHYEITKGQLSILRTVND
                     KLLARTVQPSDDEDEDDEDEDDGLEIEEVDDDYATSPLPPDEEEPDTCVAKVMPEADL
                     VMPKKADGYIIAAEQQRQQRINILVSDREAVVEREPVQTAFARVSAIPIHGDAGRRTT
                     ASFATTTPSLGAVFDDSKRVRLLEEEVKELRRKCAASQDNGNLENFTKVLFGKTPRAS
                     ELNKRVVIVNYATLNNVTLSLDDLEKCSDEEVDRMYSVIRRYNETRKKKILVTNVVII
                     GITILEHALVKLGFAEVRGLSADLSTELIDVEIGEDCEHIAERIGFGNSPVLNVALFV
                     IKLFVRKLNLI"
     misc_feature    92284..93318
                     /locus_tag="BPSVgORF087"
                     /note="Poxvirus A11 Protein; Region: Pox_A11; pfam05061"
                     /db_xref="CDD:282864"
     gene            complement(93325..93996)
                     /locus_tag="BPSVgORF088"
                     /db_xref="GeneID:2947944"
     CDS             complement(93325..93996)
                     /locus_tag="BPSVgORF088"
                     /note="similar to Vaccinia virus strain Copenhagen A12L
                     and Molluscum contagiosum virus MC115L"
                     /codon_start=1
                     /product="ORF088 virion core protein"
                     /protein_id="NP_957997.1"
                     /db_xref="GeneID:2947944"
                     /translation="MASDRIAQRTQSSYDDYIQTLNKIAPQLRSLLTHLNSDHVVRGG
                     ATGEEACAGGSLEAASSRRGSSSSSSRTKRTSRSSTKTSSSRSRRSGAPSRRGDGGIS
                     SSGMHACDAETVQAVSNCGRIVYGVMKDGKLEVHGTMGDVCEDLLGVECVNAGRKKTS
                     RSKTTKTCTGSRSGTCPQSSSTSSTSRRRSSGTSSSSSTATRRRRTPGLATINSVMDL
                     DGGMC"
     misc_feature    complement(93484..93969)
                     /locus_tag="BPSVgORF088"
                     /note="Poxvirus A12 protein; Region: Pox_A12; pfam04651"
                     /db_xref="CDD:282501"
     gene            complement(94050..94286)
                     /locus_tag="BPSVgORF089"
                     /db_xref="GeneID:2947945"
     CDS             complement(94050..94286)
                     /locus_tag="BPSVgORF089"
                     /note="ORF089 virion membrane protein; virulence factor;
                     Similar to Vaccinia virus strain Copenhagen A13L and
                     Molluscum contagiosum virus MC117L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF089 virion membrane protein"
                     /protein_id="NP_957998.1"
                     /db_xref="GeneID:2947945"
                     /translation="MGLLDALLTVVVISIVCYIIIMLYRKASTAPRVPGRRDQPVPGT
                     SSFDDKMTDDQVKAFHRLVTSSPEGDGGKATAAV"
     misc_feature    complement(94053..94286)
                     /locus_tag="BPSVgORF089"
                     /note="ORF089 virion membrane protein; Provisional;
                     Region: PHA02681"
                     /db_xref="CDD:222917"
     gene            complement(94319..94591)
                     /locus_tag="BPSVgORF090"
                     /db_xref="GeneID:2947946"
     CDS             complement(94319..94591)
                     /locus_tag="BPSVgORF090"
                     /note="ORF090 IMV phosphorylated membrane protein;
                     virulence factor; Similar to Vaccinia virus strain
                     Copenhagen A14L and Molluscum contagiosum virus MC118L;
                     Viruses of the genus parapoxvirus cause localized diseases
                     in large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; Orf virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="ORF090 IMV phosphorylated membrane protein"
                     /protein_id="NP_957999.1"
                     /db_xref="GeneID:2947946"
                     /translation="MDIFDTLKSYYSGLLVCGVLLLASACVFACIDFGKNTNVTDYVW
                     RALSVTCFIVGSILLVGLFVFTMYRRCSKSMPYERLNQTDIELTAR"
     misc_feature    complement(94322..94591)
                     /locus_tag="BPSVgORF090"
                     /note="ORF090 IMV phosphorylated membrane protein;
                     Provisional; Region: PHA02680"
                     /db_xref="CDD:177462"
     gene            complement(94608..94769)
                     /locus_tag="BPSVgORF091"
                     /db_xref="GeneID:2947917"
     CDS             complement(94608..94769)
                     /locus_tag="BPSVgORF091"
                     /note="virulence factor; ORF091 IMV membrane protein;
                     virulence factor; Similar to Vaccinia virus strain
                     Copenhagen A14.5L; Viruses of the genus parapoxvirus cause
                     localized diseases in large and small ruminants; the
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF091 IMV membrane protein"
                     /protein_id="NP_958000.1"
                     /db_xref="GeneID:2947917"
                     /translation="MVSDYDPAVLVLIFCAAMAANVYMTPQTKLSTIFVLQSVVFSWF
                     LFHFVHSVI"
     misc_feature    complement(94611..94769)
                     /locus_tag="BPSVgORF091"
                     /note="ORF091 IMV membrane protein; Provisional; Region:
                     PHA02679"
                     /db_xref="CDD:177461"
     gene            complement(94759..95037)
                     /locus_tag="BPSVgORF092"
                     /db_xref="GeneID:2947918"
     CDS             complement(94759..95037)
                     /locus_tag="BPSVgORF092"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF092 hypothetical protein; Similar to Vaccinia
                     virus strain Copenhagen A15L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958001.1"
                     /db_xref="GeneID:2947918"
                     /translation="MFIDDNTVIVLNSGERFPEALFDTRGRPLGPRSVRTMEYDASVP
                     RDARALLLVNPTAGQLAVVAAGAPAGARVLVLVDAEYCAPPFSIVNGV"
     misc_feature    complement(94771..95037)
                     /locus_tag="BPSVgORF092"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02678"
                     /db_xref="CDD:177460"
     gene            complement(95021..96100)
                     /locus_tag="BPSVgORF093"
                     /db_xref="GeneID:2947919"
     CDS             complement(95021..96100)
                     /locus_tag="BPSVgORF093"
                     /note="similar to Vaccinia virus strain Copenhagen A16L
                     and Molluscum contagiosum virus MC121L"
                     /codon_start=1
                     /product="ORF093 myristylated protein"
                     /protein_id="NP_958002.1"
                     /db_xref="GeneID:2947919"
                     /translation="MGDSVSKVEVIDTPAPGEYALRITHTTGVDTFNFAEESETFSDV
                     RAKEIRPRFCLLPDMDPGQCGRFLSKEVAARARLVQGPPCDSLFFRPGSLLRADYIPD
                     SAKPYLRKGSMCVFKMASGPAPTDAAMARCCTRPTPDCPSVLANGYKTAHCDLVMASR
                     CAVEPDAPECMDWLRTGRYAALDAYAGLCAKHMDARFCSEFARVARPSLFAFGDSALR
                     RYCDAHRSAPECACVTGRALGKYLGPRVCRAHECTDQSRDRKWLFFSQDVQRSRCKYV
                     GCRIDVDSLVMQNSRADMIADCGKAVAAGYADPDPGVRDNAQAFLPAVPPFAVAALAA
                     AVIFYFVAVYSRRSLETKVINVYRR"
     misc_feature    complement(95120..95452)
                     /locus_tag="BPSVgORF093"
                     /note="Pox virus entry-fusion-complex G9/A16; Region:
                     Pox_G9-A16; pfam03003"
                     /db_xref="CDD:281058"
     gene            complement(96145..96750)
                     /locus_tag="BPSVgORF094"
                     /db_xref="GeneID:2947920"
     CDS             complement(96145..96750)
                     /locus_tag="BPSVgORF094"
                     /note="similar to Vaccinia virus strain Copenhagen A17L
                     and Molluscum contagiosum virus MC122L"
                     /codon_start=1
                     /product="ORF094 phosphorylated IMV membrane protein"
                     /protein_id="NP_958003.1"
                     /db_xref="GeneID:2947920"
                     /translation="MANSYYSYYNPVEEFEGGGVQDAELFTTEEQNAFLPKDPSNPDA
                     PPLPIVPRPGPAGNVAPYSVLQYEDVRVLIGVVIFVLALTSTPVLALVMIGIASLILP
                     LPCLVVGYCAAMQIMHPNAAGNAGMAIVCTLMSIITIIVSHVTGSVGATTLMYIVLGL
                     LFAIYAFRLTGRGILRGRMSSAAPACPVYAGAKSDDLFFAE"
     misc_feature    complement(96166..96744)
                     /locus_tag="BPSVgORF094"
                     /note="Poxvirus P21 membrane protein; Region: Pox_P21;
                     pfam05313"
                     /db_xref="CDD:283071"
     gene            96765..98234
                     /locus_tag="BPSVgORF095"
                     /db_xref="GeneID:2947843"
     CDS             96765..98234
                     /locus_tag="BPSVgORF095"
                     /note="transcription elongation; similar to Vaccinia virus
                     strain Copenhagen A18R and Molluscum contagiosum virus
                     MC123R"
                     /codon_start=1
                     /product="ORF095 DNA helicase"
                     /protein_id="NP_958004.1"
                     /db_xref="GeneID:2947843"
                     /translation="MFRGVQVDDKLYAYLKNLAGYNRPLCLFRDNGEFAEVFPGSAFR
                     FVLPVGLFSDLRVRSRGVAFPRLRDSARMRGVDVGENTLPSLYPNQKIVVDEVLAARD
                     QLLAAGRCVYVTLHLACGFGKTLTACHLIATHARRAVVCVPNRMLVPQWRSAVAELRV
                     PFVVSYDGASALLRSGELDRAMVAIVVSRHFANDEFCRAVSRRFDVLVLDESHTYNLM
                     NNTAVARFLVKYPPPMCYFLTATPRRANRIYCNRVVNVSVVSKLSKVVRVVDAFFEAY
                     STPKIRNMARSLEGPQNKYHVFTEKILAEDVHRNKLIVDTVAAAFADGTSRRVLVLTK
                     LRNHMVDLHAALADRLGADLVFLGDAKNRKTPEITRALREKDRFVLVSTVFFSGTGLD
                     LPNLDALAVAAAVLNRMVMEQMIGRVCRESHSDARTLYVFPTSSVRAIRDTVAAFAQR
                     LVALATDGLGFVRERAAAGAKNDEPALYSAINGRDLAAG"
     misc_feature    96957..98129
                     /locus_tag="BPSVgORF095"
                     /note="Superfamily II DNA or RNA helicase [Transcription,
                     Replication, recombination and repair]; Region: SSL2;
                     COG1061"
                     /db_xref="CDD:223989"
     misc_feature    97101..97490
                     /locus_tag="BPSVgORF095"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    97122..97136
                     /locus_tag="BPSVgORF095"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    97392..97403
                     /locus_tag="BPSVgORF095"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    97704..98024
                     /locus_tag="BPSVgORF095"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     gene            complement(98206..98457)
                     /locus_tag="BPSVgORF096"
                     /db_xref="GeneID:2947844"
     CDS             complement(98206..98457)
                     /locus_tag="BPSVgORF096"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Vaccinia virus strain Copenhagen A19L
                     and Molluscum contagiosum virus MC124L"
                     /codon_start=1
                     /product="ORF096 hypothetical protein"
                     /protein_id="NP_958005.1"
                     /db_xref="GeneID:2947844"
                     /translation="MSSQAAPGRDAAAAGGNKKRRRKRVTTVVDGDTDCPTCSSCQSR
                     LVTVSDVTRLQTLDFIKCAGTLSCAACGSMLTPLRDLVR"
     misc_feature    complement(98212..98409)
                     /locus_tag="BPSVgORF096"
                     /note="Protein of unknown function (DUF678); Region:
                     DUF678; pfam05077"
                     /db_xref="CDD:282877"
     gene            complement(98471..98965)
                     /locus_tag="BPSVgORF098"
                     /db_xref="GeneID:2947845"
     CDS             complement(98471..98965)
                     /locus_tag="BPSVgORF098"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF098 hypothetical protein; Similar to Vaccinia
                     virus strain Copenhagen A21L; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958006.1"
                     /db_xref="GeneID:2947845"
                     /translation="MDAHGAVGATATVQYVRLAHSTSALYRSTALPVTRCRESRSRMS
                     SFNVYKSFSEVMISLFLVICYFVLIFNIIVPHIFEKLRQEEAAFDRLASAGSVYRCVD
                     GVVVSYALGATGIVARVMTDAAGAPLPCARMPQADPDKFVRCGGGRAELRDVCADAYA
                     SVFL"
     misc_feature    complement(98474..98800)
                     /locus_tag="BPSVgORF098"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02677"
                     /db_xref="CDD:222916"
     gene            98799..100079
                     /locus_tag="BPSVgORF097"
                     /db_xref="GeneID:2947846"
     CDS             98799..100079
                     /locus_tag="BPSVgORF097"
                     /note="similar to Vaccinia virus strain Copenhagen A20R
                     and Molluscum contagiosum virus MC126R"
                     /codon_start=1
                     /product="ORF097 DNA polymerase processivity factor"
                     /protein_id="NP_958007.1"
                     /db_xref="GeneID:2947846"
                     /translation="MTSENDLYTLKELIRLRDSLHLVTGSAVDRYNALVEWANRTYWT
                     VAVAPTAPCASIEQYYRAARADCALEPGEYTVSRLHFGATHAWVRGAVFDSASGAEVE
                     PPPEVRAACEALDARYADLTFVRFSVFRQVWTADDAVADHSASDAILAECAALGVRAA
                     RTMRVEIRAGDAFSRADFDAVHHALAADGDAGFGTAVCLARRGVPQRRVVDCSQRCFM
                     RVKGIDLTPVDARHHLPVLRTAGGGCVLSRGVGHLVDARVREGVFVAVRRYADCLVLC
                     DDAARCAADCSREEALRLLVRRFGRDCAVSNGYVVRVRDTDVRGIAARLGAPVACDSF
                     DALRAAIVADRTLSRRLREAGAIKMACECMGYPHRDAIELINNMRFQISDDGEVERFE
                     LSDASCLVNPTAESIFSSFSQFVTIFNLLSSILR"
     misc_feature    98799..99776
                     /locus_tag="BPSVgORF097"
                     /note="Chordopoxvirus A20R protein; Region:
                     Chordopox_A20R; pfam05941"
                     /db_xref="CDD:283569"
     gene            100084..100524
                     /locus_tag="BPSVgORF099"
                     /db_xref="GeneID:2947847"
     CDS             100084..100524
                     /locus_tag="BPSVgORF099"
                     /note="similar to Vaccinia virus strain Copenhagen A22R
                     and Molluscum contagiosum virus MC127R"
                     /codon_start=1
                     /product="ORF099 Holliday junction resolvase"
                     /protein_id="NP_958008.1"
                     /db_xref="GeneID:2947847"
                     /translation="MIVAAFDLGTKNPARTVLEVLDGTVRVVDVAKLDWSKDWEKRVH
                     RDVTAFPANVVLVERQCKMSPFSKFIYFIRGLLYDGRRRVRVIAVPPAMTGSTYRARK
                     RRSVRTFLALAESFGILDSVPARKKLDDVADSFNMAINYVLKTN"
     misc_feature    100084..100512
                     /locus_tag="BPSVgORF099"
                     /note="Poxvirus A22 protein; Region: Pox_A22; pfam04848"
                     /db_xref="CDD:282675"
     gene            100548..101693
                     /locus_tag="BPSVgORF100"
                     /db_xref="GeneID:2947951"
     CDS             100548..101693
                     /locus_tag="BPSVgORF100"
                     /note="similar to Vaccinia virus strain Copenhagen A23R
                     and Molluscum contagiosum virus MC128R"
                     /codon_start=1
                     /product="ORF100 intermediate transcription factor VITF-3"
                     /protein_id="NP_958009.1"
                     /db_xref="GeneID:2947951"
                     /translation="MLGLFSFLRSVEDSYRRTIFNFHISHSAEVGDVYGVLRDRILGA
                     TTFEEVAPAGLGASLAKVVYCDISTTKHIVNHAAFAPRARPTRRGAALSQFFDVHVGD
                     DACSRRTAEIFDQERSSLVSYVKTTAKRCKIDYGEIKRTIHGGRQSYFAGRRSDDYMC
                     TTVRTDPSKPWIKSISKQLRVDILHHSISTRGKSSILQTIEIVLTNRTCVKIFKDSTM
                     HIILSKDDSERGCADLVDKLFGTYAITFRVIAAITGTACFAEVAEASARVLALDGADA
                     KIAAIEDMRHAYGVRNFKIGMFNLTYTGAIEHTVFPSLIPADSRIKFFKGKKLNIVAV
                     RSTEEGRECVDQAQALLALMRERSARLEAVDVTAASVDFLKELLVSG"
     misc_feature    100548..101681
                     /locus_tag="BPSVgORF100"
                     /note="Poxvirus intermediate transcription factor; Region:
                     Pox_int_trans; pfam05718"
                     /db_xref="CDD:283396"
     gene            101718..105203
                     /locus_tag="BPSVgORF101"
                     /db_xref="GeneID:2947952"
     CDS             101718..105203
                     /locus_tag="BPSVgORF101"
                     /note="similar to Vaccinia virus strain Copenhagen A24R
                     and Molluscum contagiosum virus MC129R"
                     /codon_start=1
                     /product="ORF101 RNA polymerase subunit RPO132"
                     /protein_id="NP_958010.1"
                     /db_xref="GeneID:2947952"
                     /translation="MEQSLGYKFLLPDPKAEVYYRPLHFQYESYANFIKHRLKDILTV
                     RRTLLTFKNGTESIVLEIDDVKISAPDFSPIVASIKGQSYEALVTFTVNIYRQVMTKE
                     GLTVTKINSYEGNDSHLIKLPLLIGYGNKNALDPSKYVVPNSIGGTFINKQSIEKLGI
                     NMIEKITTWPKFREVKANSFTLSFSSISASHVIPARYRHYKILMDMNQLDNFVISSAK
                     TFITVNVIVMVQFLADVSLDFVVRNLCFDMPPEAAHLATALVESAKTVPTGGDIPEYV
                     NALIAAEHAKQKSPLSKDEFRYEMLNNFLPHMQDSPNQLKGLYLLSLVRKMVYCVFFP
                     DRYPDRDSLICHRVYTYGRYFEALAMDELETYIGNIRNDILANHKNRGTCTVSIHVLT
                     TPGFNHAFAALLSGKFRKSDGSFRTHPHYSWMQSISIPRSVGFYPEQVKISKMFKVRK
                     YHPSQYGYFCPSDVPERGPQVGLISQLSVLSSISNIRTADFVELTKKVCDYIRSYPQR
                     DISYFETGFAVTVENALVASLNPAIVDAFVLDMRRRKRLGFFGNNEISVALVRDRMNE
                     VRINFGAGRLTRPLLVVENGVLVMDAEMERLQRDIPAMTFSDIQREFPHVMEIVDVEQ
                     FSFSNVCDSVQRFRTLPPEERALYDFCDFPAEFRDGYVASSLVGINHNSAPRAILGCA
                     QAKQAISCLSADLRNKVDNGIHLMNAERPIVLSKALETSKIADNCFGNHVTVALMSFK
                     GMNQEDGIILKRQFAERGGLDILTCKKYQVEIPLENFNNRERVRSSAYSKIDVNGVVR
                     LNAFLEQGDAIARNVSSRTLDDDFVADNQISFDIAERYSDIYPARVERVQADLTDKVK
                     VRALTVRERRAILGDKFTTRTSQKGTVAYVADETELPYDEDGITPDVIINSTSIFSRK
                     TLSMLMEVILTTAYGHKPFAEDGSNRPICFPSTNETDFETYIEFARRCYALAHPDARL
                     DDPEVESRIFCERVLYDPETDEPFAARIFFGPLYYLRLRHLTLDKATVRCRGRKTKLI
                     RQANEGRRRGGGIKIGEMERDCMISHGAAFTVSEILRDSEEDAQEVFVCENCGDIAAR
                     INGTHVCIRCSKLSLSPVLTRMDSTHVSKVFMTQMNARGIKIKVEFEKQDPCFYGTPK
                     RFSLQPDETLFSSED"
     misc_feature    101793..105122
                     /locus_tag="BPSVgORF101"
                     /note="DNA-directed RNA polymerase subunit B; Provisional;
                     Region: PRK08565"
                     /db_xref="CDD:236291"
     misc_feature    102429..102515
                     /locus_tag="BPSVgORF101"
                     /note="Poxvirus DNA dependent RNA polymerase; Region:
                     rpo132; pfam12415"
                     /db_xref="CDD:289200"
     misc_feature    <102663..105116
                     /locus_tag="BPSVgORF101"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cl24011"
                     /db_xref="CDD:305168"
     misc_feature    order(103056..103058,103062..103070,103074..103076,
                     103083..103085,103098..103100,103539..103541,
                     103725..103733,103737..103739,103923..103934,
                     103941..103943,103947..103955,104355..104357,
                     104361..104363,104367..104369,104433..104435,
                     104439..104441,104448..104450,104457..104459,
                     104472..104474,104484..104486,104547..104549,
                     104682..104684,104706..104714,104718..104720,
                     104757..104759,104766..104774,104778..104783,
                     104844..104852,104862..104864,104868..104873,
                     104877..104879,104883..104900,104904..104921,
                     104934..104936,105048..105050,105066..105068,
                     105072..105074,105078..105083,105087..105089,
                     105093..105104,105108..105110,105114..105116)
                     /locus_tag="BPSVgORF101"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    <103320..103469
                     /locus_tag="BPSVgORF101"
                     /note="RNA polymerase Rpb2, domain 4; Region:
                     RNA_pol_Rpb2_4; pfam04566"
                     /db_xref="CDD:282431"
     misc_feature    order(103842..103847,103908..103910,103914..103916,
                     103977..103979,103986..103988,104382..104384,
                     104421..104423,104502..104507,104511..104513,
                     104721..104723)
                     /locus_tag="BPSVgORF101"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(103941..103943,103983..103985,104379..104381,
                     104688..104690)
                     /locus_tag="BPSVgORF101"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(103983..103988,104007..104009,104304..104306,
                     104310..104312,104382..104390,104397..104399,
                     104403..104408,104685..104708,104712..104714)
                     /locus_tag="BPSVgORF101"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(104007..104009,104091..104093,104097..104099,
                     104109..104117,104121..104123)
                     /locus_tag="BPSVgORF101"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            complement(105333..106895)
                     /locus_tag="BPSVgORF102"
                     /db_xref="GeneID:2947953"
     CDS             complement(105333..106895)
                     /locus_tag="BPSVgORF102"
                     /note="A-type inclusion protein; similar to Vaccinia virus
                     Copenhagen A26L; late viral gene product; Viruses of the
                     genus parapoxvirus cause localized diseases in large and
                     small ruminants; the poxviridae are enveloped unsegmented
                     dsDNA viruses; unlike many dsDNA viruses that replicate in
                     the host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="A-type inclusion protein"
                     /protein_id="NP_958011.1"
                     /db_xref="GeneID:2947953"
                     /translation="MESEDSLVARFKSLVQRHWHHPLKSVSCIPREDRKLIRDILRKY
                     IQLAPPIEGKNVANRPLNLYFRKYIEQNPMYRKIFVDDDWLSKHATTLGAHSKINIVN
                     VSTLGKLYLIVVKKLMTGHISHDELIMEFPGVGENSSRDVIDRQTTFFCLDFLNNMGA
                     LASYYTNSAIYFGVPMFWWYGVDAKSIYKKLETNWKNPATMEYTRHSLAFIQFMSEVN
                     GTRVSDKDHVKIVFEKLHIFQFVMSVPEFVMDGLCFTAWDTFSKTGTSFTMDIFIHPS
                     EHDGAVYKSVDHDVQGVLEQLSRPETIDCSAVRVSYYPSVHTSKDENDITPPGSYDLY
                     YYEYGDPNNISRNYYERRDRLTYDGRCDQRHRVWTHEDSDGTTYLRMLWDRYDGNIPV
                     SPFPQKPVGSSGSVCVLPQRVDALLKPLEETIATAKTCCEENREAGKHLEHHIETMRQ
                     YAVLVSNKTDVQTCNRPGAEVTKHAIDGSLPPPHVLGNWGVRSDCGQRRPPRVSHGGP
                     KPWWWGRHAAIW"
     misc_feature    complement(105336..106895)
                     /locus_tag="BPSVgORF102"
                     /note="A-type inclusion protein; Provisional; Region:
                     PHA02676"
                     /db_xref="CDD:177458"
     misc_feature    complement(<105942..106883)
                     /locus_tag="BPSVgORF102"
                     /note="A-type inclusion like protein; Provisional; Region:
                     PHA02896"
                     /db_xref="CDD:165222"
     misc_feature    complement(105507..105662)
                     /locus_tag="BPSVgORF102"
                     /note="Chordopoxvirus multifunctional envelope protein
                     A27; Region: Vac_Fusion; pfam02346"
                     /db_xref="CDD:280501"
     gene            complement(106921..108480)
                     /locus_tag="BPSVgORF103"
                     /db_xref="GeneID:2947954"
     CDS             complement(106921..108480)
                     /locus_tag="BPSVgORF103"
                     /note="similar to Vaccinia virus strain Copenhagen A26L
                     and Molluscum contagiosum virus MC131L"
                     /codon_start=1
                     /product="ORF103 A type inclusion protein"
                     /protein_id="NP_958012.1"
                     /db_xref="GeneID:2947954"
                     /translation="MEELVERFRTFVSSNWYQTLNNRTCIPVEIRKLVRDLLREYINH
                     APPLDDNNKNVGRPINLFYKPYVDKNPVYKELFKNNVWLYESAVAIKDFNDMGTVGRF
                     LLMIVYRIMTGSISNGMTIMDGKDPNDVAAVDTQMDYFCYNFMWYMGSISTYYKNKSL
                     VFGVPMYWWRGSGLEENVNKKINEYFNTSDQQKYASGAISFVKYMTEIYDKADTNMPR
                     INVSFNNFNTNFIATVPEFVMDGLCYTVWDKITKYGTTFYLDVFITPNRYNGAMFKSI
                     DHNKQGVLDGITKPDTIDCSALRFSYHPSFSRRVLHIPVGARARRQPREMEDTFDKQH
                     DVNKSEAIMFTRNSENNGYYLDFQHYSSVEPITDNEFERRDRLTYDRKSCRKLRFLGD
                     LDNDKTTYRRMLRDRFIGYLEIKPDVPKKDDAIGDEEPVCMDINKLDSLIKPLEDAIR
                     SIPKPCCSSKPSGVTSLASVNGSLSSVREVERPLSVARRSLLTRPFLRHHPYRFPLDS
                     TWWRGRDGNIW"
     misc_feature    complement(106924..108480)
                     /locus_tag="BPSVgORF103"
                     /note="A-type inclusion protein; Provisional; Region:
                     PHA02676"
                     /db_xref="CDD:177458"
     misc_feature    complement(107974..108468)
                     /locus_tag="BPSVgORF103"
                     /note="Orthopoxvirus A26L/A30L protein; Region:
                     Pox_A30L_A26L; pfam06086"
                     /db_xref="CDD:283693"
     gene            complement(108529..108798)
                     /locus_tag="BPSVgORF104"
                     /db_xref="GeneID:2947882"
     CDS             complement(108529..108798)
                     /locus_tag="BPSVgORF104"
                     /note="virus assembly; ORF104 fusion protein; similar to
                     the 14kDa Vaccinia virus protein A27L which mediates
                     fusion at a low endosomal pH; similar to Vaccinia virus
                     A27L; Viruses of the genus parapoxvirus cause localized
                     diseases in large and small ruminants; the poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins; Orf
                     virus and BPSV are capable of infecting humans but usually
                     infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF104 fusion protein"
                     /protein_id="NP_958013.1"
                     /db_xref="GeneID:2947882"
                     /translation="MDENDGENLLGTGVNENDGSAVYTAGAPSSESVEERLVSLLDNY
                     KTITDCCRETGARLDRLERHLESLRTALLNLNTKIDVQTGYSRYY"
     misc_feature    complement(108535..108798)
                     /locus_tag="BPSVgORF104"
                     /note="ORF104 fusion protein; Provisional; Region:
                     PHA02675"
                     /db_xref="CDD:177457"
     gene            complement(108828..109250)
                     /locus_tag="BPSVgORF105"
                     /db_xref="GeneID:2947883"
     CDS             complement(108828..109250)
                     /locus_tag="BPSVgORF105"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Vaccinia virus strain Copenhagen A28L
                     and Molluscum contagiosum virus MC134L"
                     /codon_start=1
                     /product="ORF105 hypothetical protein"
                     /protein_id="NP_958014.1"
                     /db_xref="GeneID:2947883"
                     /translation="MDAVSALCVALASAAAMFVALQMWAVYENYDNIREFNSANAALE
                     FARTAGGPRVDRRVYDPNDEVFDARKKWRCVIFKGAAVAASEFGFRSHDGVSPARFGT
                     VDACVDEIFTDVSDFRVFNPCLPPNQSSEACLFLKSIL"
     misc_feature    complement(108831..109250)
                     /locus_tag="BPSVgORF105"
                     /note="Poxvirus A28 family; Region: Pox_A28; pfam04584"
                     /db_xref="CDD:282447"
     gene            complement(109271..110230)
                     /locus_tag="BPSVgORF106"
                     /db_xref="GeneID:2947884"
     CDS             complement(109271..110230)
                     /locus_tag="BPSVgORF106"
                     /note="similar to Vaccinia virus strain Copenhagen A29L
                     and Molluscum contagiosum virus MC135L"
                     /codon_start=1
                     /product="ORF106 RNA polymerase subunit RPO35"
                     /protein_id="NP_958015.1"
                     /db_xref="GeneID:2947884"
                     /translation="MDAQPRAVTGEARVEVELPPAVASLIKHEFAFHVSWPALTQGVV
                     LENSTTCVNEEWLTALESMPTRHVFHAHVADVLDRKAGLCVHLKFAQTAAGQYVTLHD
                     LDYYLVRGDALEPVPKPAEMREMLLHTFHDYRPKSEQTIELVAFGAGTEVTEKLVDAL
                     AAFLDTEAFRREYENVRIVHPAEFRGYAPYTAIAPRGRLTFLITTYAWLDDRRQFRDF
                     LAVLERRVLEDVVAHAVSVDGTPDPRVPASVYCTASGVLYVNDILTACVVRFFGCNAR
                     MDSFHRFDVRAADTEELLRAVRAAFVKLRDAELRPRGAARADA"
     misc_feature    complement(109328..110200)
                     /locus_tag="BPSVgORF106"
                     /note="Poxvirus DNA-directed RNA polymerase, 35 kD
                     subunit; Region: Pox_RNA_pol_35; pfam03396"
                     /db_xref="CDD:281399"
     gene            complement(110230..110415)
                     /locus_tag="BPSVgORF107"
                     /db_xref="GeneID:2947885"
     CDS             complement(110230..110415)
                     /locus_tag="BPSVgORF107"
                     /note="ORF107 virion morphogenesis; viral structural
                     protein; involved in viral assembly; similar to Vaccinia
                     virus strain Copenhagen A30L protein; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF107 virion morphogenesis"
                     /protein_id="NP_958016.1"
                     /db_xref="GeneID:2947885"
                     /translation="MDEDINETALIHMLTRLTQLCSGDAAAAAAAIKMLMDLVNERIM
                     ALNKKAKKEVRNASPSQ"
     misc_feature    complement(110236..110415)
                     /locus_tag="BPSVgORF107"
                     /note="ORF107 virion morphogenesis; Provisional; Region:
                     PHA02674"
                     /db_xref="CDD:177456"
     gene            complement(110625..111404)
                     /locus_tag="BPSVgORF108"
                     /db_xref="GeneID:2947886"
     CDS             complement(110625..111404)
                     /locus_tag="BPSVgORF108"
                     /note="similar to Vaccinia virus strain Copenhagen A32L
                     and Molluscum contagiosum virus MC140L"
                     /codon_start=1
                     /product="ORF108 DNA packaging protein/ATPase"
                     /protein_id="NP_958017.1"
                     /db_xref="GeneID:2947886"
                     /translation="MDVVQEVRFKRESLTEAPFRMALVGGSGSGKTVYLLSLFRTLVR
                     RFKHILLFTPVYNSAYDGFVWPDHIQKVTTHEELEYNLSVTKRKIERYAQSKKHKFLI
                     ILDDMGDTQTRSPTLLGLMNYGRHLNVSLVLLCQTYKHIPVNGRASITHLCCCNVSDS
                     DVENVLRSMSIRGSKKRLIRAMAIMRSAGSRRVLIIEDSVFCQNQERICYDFADESVV
                     RRDLDPGILLAQFSHMKTRLADILTAAAERQQKAADKPQSV"
     misc_feature    complement(110688..111389)
                     /locus_tag="BPSVgORF108"
                     /note="Poxvirus A32 protein; Region: Pox_A32; pfam04665"
                     /db_xref="CDD:282513"
     gene            111489..111977
                     /locus_tag="BPSVgORF109"
                     /db_xref="GeneID:2947965"
     CDS             111489..111977
                     /locus_tag="BPSVgORF109"
                     /note="ORF109 EEV glycoprotein; unknown function; similar
                     to vaccinia strain Copenhagen A33R; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF109 EEV glycoprotein"
                     /protein_id="NP_958018.1"
                     /db_xref="GeneID:2947965"
                     /translation="MAHGTFGDNDSEAAANATYVASVKRQKAIRRCIKLFFRLMAALA
                     IIILAALVIILALALSDCRNTTCVIDTNSYNRTCDGINAGNRCLTLKYPDTWTNANER
                     CKELGQRLPKPSDNEKYPWLTDYLVNTWGNINERVFGTSGGLESVTMDGSTNKYFCVD
                     DN"
     misc_feature    111489..111974
                     /locus_tag="BPSVgORF109"
                     /note="ORF109 EEV glycoprotein; Provisional; Region:
                     PHA02673"
                     /db_xref="CDD:177455"
     gene            112004..112507
                     /locus_tag="BPSVgORF110"
                     /db_xref="GeneID:2947835"
     CDS             112004..112507
                     /locus_tag="BPSVgORF110"
                     /note="ORF110 EEV glycoprotein; C-type lectin-like
                     protein; similar to vaccinia strain Copenhagen A34R and
                     Molluscum contagiosum virus MC143R; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF110 EEV glycoprotein"
                     /protein_id="NP_958019.1"
                     /db_xref="GeneID:2947835"
                     /translation="MGCCKVPNRQSLRSLKKASCPVATLVTMLSLVTSLGAIIKYTGF
                     FLREACEDGWIPIKDICVLNTHHQSDTTRAHEICRYFKGTPPAIPNTSLLRGVMAVTG
                     ERHFWLGHHDKYTSVYEDAPFGRRVPYQNVEYDKAKHFCLLSADGYIHHNCALNATVI
                     CVKKMYG"
     misc_feature    112004..112504
                     /locus_tag="BPSVgORF110"
                     /note="ORF110 EEV glycoprotein; Provisional; Region:
                     PHA02672"
                     /db_xref="CDD:177454"
     gene            112527..113081
                     /locus_tag="BPSVgORF111"
                     /db_xref="GeneID:2947836"
     CDS             112527..113081
                     /locus_tag="BPSVgORF111"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF111 hypothetical protein; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958020.1"
                     /db_xref="GeneID:2947836"
                     /translation="MTNGNMSCLQILTPFGLIFAPDDVRLREIALELGITYVSRAFGD
                     MLYGEMSFTSLPMNEVPACVSDCYLAVNGNLIPCTESFRLRIPMDGVKAAYRTGTGKT
                     ILCGPEFNVVNPSGFRPALRLRELSHVAAHTEILELYSESGNYEFIMGPSARFMTSLM
                     AKESVCLFGSGWCVVDLRRISFTP"
     misc_feature    112542..113078
                     /locus_tag="BPSVgORF111"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02671"
                     /db_xref="CDD:177453"
     gene            113173..114066
                     /locus_tag="BPSVgORF112"
                     /db_xref="GeneID:2947837"
     CDS             113173..114066
                     /locus_tag="BPSVgORF112"
                     /note="ORF112 putative chemokine-binding protein; unknown
                     function; may be involved in immune evasion; secreted by
                     infected cells; similar to vaccinia strain Copenhagen
                     C23L; Viruses of the genus parapoxvirus cause localized
                     diseases in large and small ruminants; the poxviridae are
                     enveloped unsegmented dsDNA viruses; unlike many dsDNA
                     viruses that replicate in the host nucleus poxviruses
                     encode their own replication machinery and therefore
                     replicate in the cytoplasm; viral genes are expressed in a
                     bi-phasic manner with early genes genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins; Orf
                     virus and BPSV are capable of infecting humans but usually
                     infect sheep, goats and cattle"
                     /codon_start=1
                     /product="ORF112 putative chemokine-binding protein"
                     /protein_id="NP_958021.1"
                     /db_xref="GeneID:2947837"
                     /translation="MKSTYLLFALSLVLSAALSAPMNTDEQRNWCRIHKDKLYSRFRL
                     YMKITRTTVTPPTGMCMLDIENSNMDLDETDEVTNVTSTISFRDSTATFEASGVNGSI
                     TLMGDEVHIPMSYIGVSFDPSSAYVFVNVSSWTPWEKSTTDLAANDFEGLKNIINHQI
                     LAINLGCDHQYPAPKPTPKPEKISTPSTTPGPTLLETEAPTTVPPVDTSSDRKKKPDP
                     VDFSLLVDTRCIKNVDLYFELKDACLAYKSQSPFKLVGQHGTGQQVRQDMKSLGTSYR
                     TCKLKTSSTADNDMESAKDEE"
     misc_feature    113176..114030
                     /locus_tag="BPSVgORF112"
                     /note="ORF112 putative chemokine-binding protein;
                     Provisional; Region: PHA02670"
                     /db_xref="CDD:222915"
     gene            114159..114758
                     /locus_tag="BPSVgORF113"
                     /db_xref="GeneID:2947838"
     CDS             114159..114758
                     /locus_tag="BPSVgORF113"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF113 hypothetical protein; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958022.1"
                     /db_xref="GeneID:2947838"
                     /translation="MALVLIGLIVGAFYLTAAIIYLLIEIGLAVERLSKKSRAKAHMR
                     QLSTQLGSGTLASTMGTPIPVMGDIGTCSRWDSDTEGETVSTTSTSDGGTLSRQQSRF
                     QHRLYENFQSGDPGYHHRDTFQVQVRNSGTPPVDNIPPVPKVDEPPYDDAESSGVGSM
                     GSTEHIHSDGDGPEQDLPPPPAHDEVSLQDECDDFYFEE"
     misc_feature    114159..114755
                     /locus_tag="BPSVgORF113"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02669"
                     /db_xref="CDD:177451"
     gene            114805..115800
                     /locus_tag="BPSVgORF114"
                     /db_xref="GeneID:2947912"
     CDS             114805..115800
                     /locus_tag="BPSVgORF114"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="similar to Molluscum contagiosum virus MC149R"
                     /codon_start=1
                     /product="ORF114 hypothetical protein"
                     /protein_id="NP_958023.1"
                     /db_xref="GeneID:2947912"
                     /translation="MPLFKKLMVSRALIKECLTLDFRQGSRIPSRCFIPTPTGMMYQR
                     LCDTSSLVQEITKSLNQPVLCAGHVNYYYFEQGQCMIGENSCQTRILVCTRSAYVGGD
                     IVLRSTRSRADKSILCPCQGMAVVLSPFCAFDITPVESGSMIVAEISVSIPGFDHLEM
                     PAPADAGVRLFNSPHLLWPRHSSNVCFAFRLLRDARSGERVVEQLFIDGRWYTVLATP
                     GGGRICVPADVVGSTHLEEVPFCDVTPDIMRRVLAIEPAYDALAYSHRCTHGAVDVRC
                     ALESIVYGMFRSEAPARRSSSPGPELLSPTDRPSDPPAGGGAAAIAEECAKKALG"
     misc_feature    114928..>115455
                     /locus_tag="BPSVgORF114"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02985"
                     /db_xref="CDD:165288"
     gene            115859..116257
                     /locus_tag="BPSVgORF115"
                     /db_xref="GeneID:2947913"
     CDS             115859..116257
                     /locus_tag="BPSVgORF115"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF115 hypothetical protein"
                     /protein_id="NP_958024.1"
                     /db_xref="GeneID:2947913"
                     /translation="MACLLAALDSLFCRRKSRFNSEDVYTPRDPNALQSPPRSPPSRP
                     PSSNRRCRRAPSFGSGANYDSLPLNRHRMKNNRRSSDEEDDESYIDLVTTTTTTVAVF
                     AASFDYESLSICTLSLSSSSTISESPPNSP"
     gene            116254..117030
                     /locus_tag="BPSVgORF116"
                     /db_xref="GeneID:2947914"
     CDS             116254..117030
                     /locus_tag="BPSVgORF116"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF116 hypothetical protein"
                     /protein_id="NP_958025.1"
                     /db_xref="GeneID:2947914"
                     /translation="MIHFLLRHSLFLYWFIEPRYPHTNTLGKMSETAPSSSTTDSTSA
                     GTSDASTSTNDSTAMSSAPTTDASSTSTTSNTSSATTSSSSDTESSSTTANNADSGSA
                     TTTTTTTESTPTASTGSESTSSATQPTTTDPTPDPAPVPATAPTASTGSESTSSATQP
                     TTTVPTTTDPTPDPAPAPAPAPAPAPAPMPNPVTTTTTTVSTTATNGTNRCECVCTCT
                     TTMTGGNQYPPENIDLGNSASTPSPPDVEEPPAEEDEEVI"
     gene            117203..117997
                     /locus_tag="BPSVgORF117"
                     /db_xref="GeneID:2947915"
     CDS             117203..117997
                     /locus_tag="BPSVgORF117"
                     /note="GM-CSF/IL-2 inhibition factor; immune evasion;
                     enhnaces viral replication; similar to vaccinia strain
                     Copenhagen A41L; Viruses of the genus parapoxvirus cause
                     localized diseases in large and small ruminants; the
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="GM-CSF/IL-2 inhibition factor"
                     /protein_id="NP_958026.1"
                     /db_xref="GeneID:2947915"
                     /translation="MWLPRALLALSVICGTASSYRGMHDGGEFCRAHSREIFTSFQMW
                     MRIQRNVQTARNATQCALDVEAPPDMFDVVAYANTAGIAVTVATANVGRVDVRTLQVL
                     YSTNKSSMFVYLDTWSPWTKYTRPLYSNASADAHNETIDCLLEVLDLNKVHVDVGCAV
                     EDIPVDVVDPIDYPRVYDPDLLRYVIPKNRKQNPGYVFVDLSVDSYCVHSVNVKTVLR
                     DACIHHKNETPLNFYGRENFPLHKSPNSVIPTHKRGFSTCEMITGQ"
     misc_feature    117203..117994
                     /locus_tag="BPSVgORF117"
                     /note="GM-CSF/IL-2 inhibition factor; Provisional; Region:
                     PHA02668"
                     /db_xref="CDD:177450"
     gene            118278..118628
                     /locus_tag="BPSVgORF119"
                     /db_xref="GeneID:2947916"
     CDS             118278..118628
                     /locus_tag="BPSVgORF119"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF119 hypothetical protein"
                     /protein_id="NP_958027.1"
                     /db_xref="GeneID:2947916"
                     /translation="MEVDGAAADPFELAPVGAEPPDVIMQCAEPEETPRIITPANAFL
                     YLPNNPHLHVDEDVDPFFGMKPAVFGRSASGALLGQRNPVMSEAGEPPSPRSPCEADL
                     WCWETLGDSDSDSD"
     gene            118862..119284
                     /locus_tag="BPSVgORF120"
                     /db_xref="GeneID:2947959"
     CDS             118862..119284
                     /locus_tag="BPSVgORF120"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF120 hypothetical protein"
                     /protein_id="NP_958028.1"
                     /db_xref="GeneID:2947959"
                     /translation="MKYMLSVCVTCLLATLSAAAPTTTNHVTDTSNTTTSTIATTTTV
                     STPTTHHIGEDDANDESEPYKVVCAIFLIVATFIVIAVVIVMMVKRRMCDWCCVYCPC
                     CNDDEDDEENERLDAMLEHFPTTDSNDFVKMYAGTGAC"
     gene            119398..120207
                     /locus_tag="BPSVgORF121"
                     /db_xref="GeneID:2947960"
     CDS             119398..120207
                     /locus_tag="BPSVgORF121"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF121 hypothetical protein; unknown function;
                     Viruses of the genus parapoxvirus cause localized diseases
                     in large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; Orf virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958029.1"
                     /db_xref="GeneID:2947960"
                     /translation="MSGLFTTVRCVCNEIWKTMRGDGGHSGHHESCFHHRRRANSMES
                     RRKSRPSRQHRSAERTPTTASSLTHENNTAPSRHGKQHSCKASSRSSHNHQSTSSSHN
                     HHAHRGPHQSAHRRSKHDAVRDTYQPCPQSPETDLYKGRLPGETERHYETPDHIYDTP
                     ENVVCAVEPRRDLVPVNEHIHSRVAARRSVPGASGGTSRGKHNLQSDIGTLCHDIEQQ
                     LSALEKSLESEFRFYKQYIHDTKSLLTTRAANISNKALLYEDYNDIHDDDD"
     misc_feature    119398..120174
                     /locus_tag="BPSVgORF121"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02666"
                     /db_xref="CDD:222914"
     gene            120301..121269
                     /locus_tag="BPSVgORF122"
                     /db_xref="GeneID:2947961"
     CDS             120301..121269
                     /locus_tag="BPSVgORF122"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF122 hypthical protein; unknown function; Viruses
                     of the genus parapoxvirus cause localized diseases in
                     large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; ORF virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958030.1"
                     /db_xref="GeneID:2947961"
                     /translation="MDNKLVLLDFEHLAEADSIAEQCVYEPAQKKCAFTKIRTNSSTA
                     ARYTVADGCMLDDLMNASFGTRRACRLVRHVVVGSDTVLSRQAADCAPHMVLICVRGI
                     AHVSGDALKFGRCTMDRGTMFMVKSSRSSVVCGNPACELLVFFVDFFMPIPRVLLPDE
                     VLFTRDLTHVESDANSSVIFKVEFDLSENVCKLFIKGYIIRVTGMQLERRETVCDDCD
                     CCYPEAPVLALDRKKLHRSARTVPTLIPGVLDLHLKERGWLMASIDAKGHCEPALLRI
                     ALGSLRLVCGILRSAVGRYHNMLFFYGIIPVNREADAAPAEMMEIE"
     misc_feature    120301..121266
                     /locus_tag="BPSVgORF122"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02665"
                     /db_xref="CDD:177448"
     gene            121371..122924
                     /locus_tag="BPSVgORF123"
                     /db_xref="GeneID:2947962"
     CDS             121371..122924
                     /locus_tag="BPSVgORF123"
                     /note="ankyrin-like protein; although the function of the
                     ankyrin-like protein is not completely understood, it is
                     highly conserved throughout the Orthopoxvirus genus; it
                     may be critical for overcoming cellular restriction
                     factors; the ankyrin-like protein of the modified vaccinia
                     virus ankara interacts with Skp1a, a member of the
                     Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="ankyrin-like protein"
                     /protein_id="NP_958031.1"
                     /db_xref="GeneID:2947962"
                     /translation="MDRLSDHTAVFREASLYGYLSSTSTVTVEDVRRYLEFGGDANYK
                     GTYKCTPLHVYLRLPGDKSVEVIDLLLDAGADLNSRDICGFTPLHMYICYADVETDIL
                     RHLLERGARADATGNGMMTDALFAYLNTHGIDDAATPEVVDLLIRAGANVNARGEADK
                     TPLHVHSASFTVNPEVTRLLLDAGADAEALDEFGMTPADVLVKSVGANVETLRLLLAA
                     SEGIATRRDVRGRTALHHHADSFRANADIVRELLRAGCDPAATDMLENTPLHSLATFC
                     SCKRSVLDQLVAHGADINAMNVYGHTPLYYAAIYNPEACPRLIAAGADVSARTPDDRT
                     PMTGMIMRKNMRALTAALNTCPPLDAICASLDGARPGAASDATRMCVREVVLRGGARR
                     LSAPMRHMHADFIAQCEAEVAVMATVRLGDPETSLLALARRRALQPVLLQPRVNRLLC
                     RFGVYRDLLERLFREHRRKTRLVEQVARRVCPCSLPPEVVVRVLSHVPADDLAATLRC
                     PAHDASSHN"
     misc_feature    121374..122903
                     /locus_tag="BPSVgORF123"
                     /note="ankyrin-like protein; Provisional; Region:
                     PHA03095"
                     /db_xref="CDD:222980"
     misc_feature    121494..121913
                     /locus_tag="BPSVgORF123"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    order(121515..121517,121527..121532,121539..121544,
                     121554..121556,121560..121565,121575..121577,
                     121584..121586,121611..121613,121617..121619,
                     121623..121625,121635..121640,121647..121655,
                     121659..121664,121800..121802,121809..121811,
                     121836..121838,121842..121844,121848..121850,
                     121860..121865,121878..121886,121890..121895,
                     121905..121907,121914..121916,121941..121943)
                     /locus_tag="BPSVgORF123"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    121515..121613
                     /locus_tag="BPSVgORF123"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    121617..121838
                     /locus_tag="BPSVgORF123"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    121842..121943
                     /locus_tag="BPSVgORF123"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    122046..122414
                     /locus_tag="BPSVgORF123"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    order(122055..122057,122061..122063,122073..122075,
                     122082..122084,122091..122099,122103..122108,
                     122118..122120,122127..122129,122154..122156,
                     122160..122162,122166..122168,122178..122180,
                     122184..122186,122193..122201,122208..122213,
                     122223..122225,122232..122234,122259..122261,
                     122265..122267,122271..122273,122283..122288,
                     122295..122303,122304..122309,122319..122321,
                     122328..122330)
                     /locus_tag="BPSVgORF123"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    122055..122156
                     /locus_tag="BPSVgORF123"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    122160..122261
                     /locus_tag="BPSVgORF123"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    122265..122354
                     /locus_tag="BPSVgORF123"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     gene            122964..124484
                     /locus_tag="BPSVgORF124"
                     /db_xref="GeneID:2947963"
     CDS             122964..124484
                     /locus_tag="BPSVgORF124"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF124 hypthical protein; unknown function; Viruses
                     of the genus parapoxvirus cause localized diseases in
                     large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; ORF virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958032.1"
                     /db_xref="GeneID:2947963"
                     /translation="MERFGAGEPARLRNPGPWRISPPMASALEGAMLNPVVAHGTDLC
                     ANARVETRNMGVGEGRHIPADVEGLRTEVHLRYGMSRVHRTMYFAQFWHGEHVVRRPS
                     RCVFTVWVCLYGEVRVYAESCQAGQGFVLCRQLPAGHMFITEPSDMVTVSVPHALRGS
                     RRPVWLVCVFATRHFEDLPPPLYPVPAHVVLARSASELCNVSPSAPQRQHGIFFMRLS
                     GTVVRLTMAGAELEVECTSHRPDHMAVDAECRCCELRPHVPRSRVLTLVELCSGATVV
                     LAPPLPRGGTGLVAEIRLHSGHHIRVRVLRSATGNVAAFPSVVWTGVFCAAHVFLGGS
                     VPAFAACMDGGRGAYGLVFIPEGEERMSDGVTTFPTPREPVALHIDANGADARAMLNA
                     PPPMEAPREGRAPAAAGAANAPADQDVDGAPDHRDAGDAEEDDMDAQDGESDAESEYS
                     YATTSSEEDSDSDDSWDDESSSDSGIEHDDGGAGQVIEEELAEEAAVLNAVAEMLD"
     misc_feature    122964..124481
                     /locus_tag="BPSVgORF124"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02664"
                     /db_xref="CDD:177447"
     gene            124623..125156
                     /locus_tag="BPSVgORF125"
                     /db_xref="GeneID:2947964"
     CDS             124623..125156
                     /locus_tag="BPSVgORF125"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="ORF125 hypothetical protein; Viruses of the genus
                     parapoxvirus cause localized diseases in large and small
                     ruminants; the poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     genes encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958033.1"
                     /db_xref="GeneID:2947964"
                     /translation="MIGDRHRDDTDIDASAVVTAYLASEYANAVIDNLSDAERVALEA
                     LRASGDEVRHPMLQELTNAGGNHANPETSHIPATLISALLEAPASPGRMVTAIELCAQ
                     MGRRWTRRFQFLNFMRLVHVLVDRMPPTASEDLAVWLERAARVQATRHRMSRVAGLGM
                     FLAGCGILFVGARFLRR"
     misc_feature    124638..125153
                     /locus_tag="BPSVgORF125"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02663"
                     /db_xref="CDD:177446"
     gene            125230..126750
                     /locus_tag="BPSVgORF126"
                     /db_xref="GeneID:2947852"
     CDS             125230..126750
                     /locus_tag="BPSVgORF126"
                     /note="ankyrin-like protein; although the function of the
                     ankyrin-like protein is not completely understood, it is
                     highly conserved throughout the Orthopoxvirus genus; it
                     may be critical for overcoming cellular restriction
                     factors; the ankyrin-like protein of the modified vaccinia
                     virus ankara interacts with Skp1a, a member of the
                     Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="ankyrin-like protein"
                     /protein_id="NP_958034.1"
                     /db_xref="GeneID:2947852"
                     /translation="MDPDADDEASDRQAASALYRYLETADKPSVEKMFRLVRDGADVN
                     FTGPYGYTPLHVLMRCSPGTEEVRFMIAAGANVNAASLCGFTALHTYMCFGTVTPDTL
                     RAVMHGGVRVRELEYNVSAILEFFQQQGFLGIEVEVVRLLVRYGADIRAKDDVGRTPL
                     HVYLSGFFVVETMVRTMIALGADVNAKDAYGRTPLFAFLKSRNVDVDVLRTLVEAGAR
                     VTEKDLINRTALHYHCDSFKTRACVFRELIAAGCDPRGADILHNTVLHSLAIGSSCRA
                     SQIAPLLEAGVGVNARNARLQTPLHVAAAFNPRACVCLMRAGADATLADLDEVTPFLN
                     MVRHNYAHAVRAAMPGVPDSLIAGTVNRLNVLVPTDATRECVMELALRKAVDLLSDAA
                     IATHAQIIALCAEEISHMCVTRLGEPQVALVQILVEREPFTVITAKAARRATARVRVY
                     HRALSRRMEEVRRRSALVQRMVMAVSPCSLPPEVLYRIFLYVPVDDLMVTLRISSN"
     misc_feature    125239..126747
                     /locus_tag="BPSVgORF126"
                     /note="ankyrin-like protein; Provisional; Region:
                     PHA03095"
                     /db_xref="CDD:222980"
     misc_feature    125317..125718
                     /locus_tag="BPSVgORF126"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    125374..125472
                     /locus_tag="BPSVgORF126"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    125635..125925
                     /locus_tag="BPSVgORF126"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    125692..125793
                     /locus_tag="BPSVgORF126"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    125782..126165
                     /locus_tag="BPSVgORF126"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    125797..125898
                     /locus_tag="BPSVgORF126"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    125902..126003
                     /locus_tag="BPSVgORF126"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    126097..>126264
                     /locus_tag="BPSVgORF126"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cl02529"
                     /db_xref="CDD:295348"
     misc_feature    126112..126204
                     /locus_tag="BPSVgORF126"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     gene            126898..127455
                     /locus_tag="BPSVgORF127"
                     /db_xref="GeneID:2947853"
     CDS             126898..127455
                     /locus_tag="BPSVgORF127"
                     /codon_start=1
                     /product="ORF127 IL-10"
                     /protein_id="NP_958035.1"
                     /db_xref="GeneID:2947853"
                     /translation="MANVMYVVLVLNILLTQIHVSNSYCTMCSTGVCKENPHQKQECE
                     NTGHQLPHMLRELRAAFGKVKTFFQMKDQLHSLLLTQSLLDDFKGYLGCQALSEMIQF
                     YLEEVMPQAENHGPDIKEHVNSLGEKLKTLRLRLRRCHRFLPCENKSKAVEKVKRVFS
                     ELQERGVYKAMSEFDIFINYIETYM"
     misc_feature    127045..127452
                     /locus_tag="BPSVgORF127"
                     /note="Interleukin 10; Region: IL10; pfam00726"
                     /db_xref="CDD:279115"
     gene            127480..129033
                     /locus_tag="BPSVgORF128"
                     /db_xref="GeneID:2947854"
     CDS             127480..129033
                     /locus_tag="BPSVgORF128"
                     /note="ankyrin-like protein; although the function of the
                     ankyrin-like protein is not completely understood, it is
                     highly conserved throughout the Orthopoxvirus genus; it
                     may be critical for overcoming cellular restriction
                     factors; the ankyrin-like protein of the modified vaccinia
                     virus ankara interacts with Skp1a, a member of the
                     Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="ankyrin-like protein"
                     /protein_id="NP_958036.1"
                     /db_xref="GeneID:2947854"
                     /translation="MKWQASLVIWKDNMGSRASAALYEYLDESPYVSEDEVRRLLGAG
                     ASVHHRGEFDRTPLHLYMGKTSLDVRVVRLLLEAGAAVDVAESCCGCTPLDLLLMSSA
                     VDVEVLELMLTVGRLVHPDRAALASTLLKEFVVNRAFHPVLTERVVRVLVDAGADVNV
                     RSVVDRTPLHICLTGMSTHPGTITTLLRFGADVNAVDLYGMTSLAALMRSKRASVELL
                     RLLLDAGASVSDADSRGDTLLHHHMQSPRPRPGVLSELVVRGCRVNARNALGRTPLHV
                     AATYTSCKDSILAPLVAAGADIHARDNSGRTPLHAAVCNARAWRRLLARGASATARSN
                     AGVSPLALAISRHDESMLAAALATQPQASEVAAALHTAGPARETACSRACVAYVVARL
                     PPAAVPEPERGIHAAFIESCLCEVSVLQQTVCGTPSVSLLDILRGRSCTETLVPRRAR
                     ALATRLARVYREPLLERVTELRRRANLVARVRAIMGGCGCALPPEMLDRVLLCLTTAE
                     LRSCCAPRR"
     misc_feature    127501..129030
                     /locus_tag="BPSVgORF128"
                     /note="ankyrin-like protein; Provisional; Region:
                     PHA03095"
                     /db_xref="CDD:222980"
     misc_feature    127633..128133
                     /locus_tag="BPSVgORF128"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    127636..127737
                     /locus_tag="BPSVgORF128"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    127969..128070
                     /locus_tag="BPSVgORF128"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    128059..128424
                     /locus_tag="BPSVgORF128"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    128074..128175
                     /locus_tag="BPSVgORF128"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    order(128179..128181,128185..128187,128197..128202,
                     128209..128211,128218..128223,128227..128232,
                     128242..128244,128251..128253,128278..128280,
                     128284..128286,128290..128292,128302..128307,
                     128314..128322,128332..128337,128347..128349,
                     128356..128358,128383..128385,128389..128391,
                     128395..128397,128407..128412,128419..128427,
                     128440..128442,128449..128451)
                     /locus_tag="BPSVgORF128"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    128179..128280
                     /locus_tag="BPSVgORF128"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    128284..128385
                     /locus_tag="BPSVgORF128"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    128389..128475
                     /locus_tag="BPSVgORF128"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     gene            129107..130654
                     /locus_tag="BPSVgORF129"
                     /db_xref="GeneID:2947855"
     CDS             129107..130654
                     /locus_tag="BPSVgORF129"
                     /note="ankyrin-like protein; although the function of the
                     ankyrin-like protein is not completely understood, it is
                     highly conserved throughout the Orthopoxvirus genus; it
                     may be critical for overcoming cellular restriction
                     factors; the ankyrin-like protein of the modified vaccinia
                     virus ankara interacts with Skp1a, a member of the
                     Skp1a-Cullin-1-F-box (SCF) ubiquitin ligase complex; The
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes encoding
                     non-structural proteins involved in genome replication and
                     late genes encoding the viral structural proteins"
                     /codon_start=1
                     /product="ankyrin-like protein"
                     /protein_id="NP_958037.1"
                     /db_xref="GeneID:2947855"
                     /translation="MDRNMDHEFDISPESALYDYFITQSEHACVGEVVALLAEGADVN
                     YVGHFDKSALHLYLHTRHPRTDVIYALMEAGAFVDAPERCCGATPLHLYVLNADVLDL
                     TLLEAMLVWGARSGNSPLSERFLSSVLREAVVHRPFSEQTEPLMDMLIRLGANINFKV
                     GVDRTPLHACLTGACTDPRVIDALLARGASVRDLDAYEMSPLAVLLKSARATVELVRR
                     LVAAGSDLFTVDFCRNTLLHQHAQSPRPRQQIMRELIRLGCDPMTTNVFGNTPLHVLA
                     MQSTCRASIIRPFIEAGVGVNVLNPRYGISPLHMAAGYNNTAACEKLIVQGADPSVVS
                     NTGRTPLANMIINHNHAAAVAALNTHPATSVVAASLTQAVEAGVSDASRLCVAYVVAR
                     AGARALSEAVRAEHAELILECETEIARLREIRVGFPAMSLRDVLVSATVPDTIVTSNA
                     MRLCKESSRIYRPQLCAAVEKLRYKSQLVSSIKKEVGPCSLPSELVDLVLSKVPVADL
                     RRSCGKQ"
     misc_feature    129116..130651
                     /locus_tag="BPSVgORF129"
                     /note="ankyrin-like protein; Provisional; Region:
                     PHA03095"
                     /db_xref="CDD:222980"
     misc_feature    order(129182..129190,129194..129199,129209..129211,
                     129218..129220,129245..129247,129251..129253,
                     129257..129259,129269..129274,129281..129289,
                     129299..129304,129314..129316,129323..129325,
                     129350..129352,129359..129361,129365..129367,
                     129377..129382,129389..129391,129395..129400,
                     129410..129412,129422..129424)
                     /locus_tag="BPSVgORF129"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293786"
     misc_feature    129203..129466
                     /locus_tag="BPSVgORF129"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    129251..129352
                     /locus_tag="BPSVgORF129"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    129449..129586
                     /locus_tag="BPSVgORF129"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    129590..129691
                     /locus_tag="BPSVgORF129"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    129596..129940
                     /locus_tag="BPSVgORF129"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    129695..129796
                     /locus_tag="BPSVgORF129"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    129791..130129
                     /locus_tag="BPSVgORF129"
                     /note="ankyrin repeats; ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    129806..129901
                     /locus_tag="BPSVgORF129"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    129905..130006
                     /locus_tag="BPSVgORF129"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     misc_feature    130013..130108
                     /locus_tag="BPSVgORF129"
                     /note="ANK repeat [structural motif]; Region: ANK repeat"
                     /db_xref="CDD:293786"
     gene            130698..132137
                     /locus_tag="BPSVgORF130"
                     /db_xref="GeneID:2947856"
     CDS             130698..132137
                     /locus_tag="BPSVgORF130"
                     /note="Ser\Thr kinase; transfers gamma phosphate from
                     triphosphates to Ser or Thr in virion proteins involved in
                     assmebly; The poxviridae are enveloped unsegmented dsDNA
                     viruses; unlike many dsDNA viruses that replicate in the
                     host nucleus poxviruses encode their own replication
                     machinery and therefore replicate in the cytoplasm; viral
                     genes are expressed in a bi-phasic manner with early genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins"
                     /codon_start=1
                     /product="Ser/Thr kinase"
                     /protein_id="NP_958038.1"
                     /db_xref="GeneID:2947856"
                     /translation="MSPPGAEDKKPRRARRKTPDCADDEAAALDAQVPCDREWADCRS
                     SALTGPDSVSLGDEIYLRYVASQVDFAQTWAPPVRLLRFFGNFSKDTLDRMSKRGYVN
                     RSYYQMAHARFSPTNDDMYHMATGGYGIVCRFDRYVVKFVFEHRNGMSEIDASTEYTV
                     PRFLRSNLKGDEREFVVCALAMGLNYRLGFLHSLYRRVLHTLLLLMRAEEGQRPSVEM
                     AKKPLLRWFESRKDSESFVRLVSYFYPSAVQSNVNLVNNFPHLVHFFEHEKRARYVFD
                     RGAVIVFPLARGSADSVSAEAALGLGFSSHAEFLKFVFLQIALLYLKIYEMPGCANFL
                     HVDLKPDNVLIFDSSRALSVEAAGATFRFEEPVRAALNDFDFARVANIENRKIAGSIR
                     VPQNWYYDFHFFAHTLLRAYPNIAAEDPAFHSVLSELTISCSRSTCDRFRLRVSSTHP
                     IEHLARIVRRDLFSRWINAATDAPDPAAA"
     misc_feature    130803..132101
                     /locus_tag="BPSVgORF130"
                     /note="Ser/Thr kinase; Provisional; Region: PHA03111"
                     /db_xref="CDD:222989"
     gene            132100..132774
                     /locus_tag="BPSVgORF131"
                     /db_xref="GeneID:2947921"
     CDS             132100..132774
                     /locus_tag="BPSVgORF131"
                     /note="ORF131 putative membrane protein; unknown; Viruses
                     of the genus parapoxvirus cause localized diseases in
                     large and small ruminants; the poxviridae are enveloped
                     unsegmented dsDNA viruses; unlike many dsDNA viruses that
                     replicate in the host nucleus poxviruses encode their own
                     replication machinery and therefore replicate in the
                     cytoplasm; viral genes are expressed in a bi-phasic manner
                     with early genes genes encoding non-structural proteins
                     involved in genome replication and late genes encoding the
                     viral structural proteins; Orf virus and BPSV are capable
                     of infecting humans but usually infect sheep, goats and
                     cattle"
                     /codon_start=1
                     /product="ORF131 putative membrane protein"
                     /protein_id="NP_958039.1"
                     /db_xref="GeneID:2947921"
                     /translation="MPPPTLPTPPQPDPVRADTGSLYDAFLARFLRALAARAAPASAA
                     CAVRVGAVRGRLRNCELVVLNRCHTDATEALALASSALADTLASIPREDRIAVAKELG
                     IDPDKPQLTPDPACTAAEGALAQSIDLQTLDIGDCGVPGGRRVRIALVNSGHAATNCA
                     LAKVASALTKRVPVRRQEGLAAGGMPPWSVLLSVAAVVVVGTVAVSLLRRALRLRFRF
                     ATRLRV"
     misc_feature    132142..132663
                     /locus_tag="BPSVgORF131"
                     /note="ORF131 putative membrane protein; Provisional;
                     Region: PHA02662"
                     /db_xref="CDD:177445"
     gene            132821..133270
                     /locus_tag="BPSVgORF133"
                     /db_xref="GeneID:2947922"
     CDS             132821..133270
                     /locus_tag="BPSVgORF133"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /codon_start=1
                     /product="ORF133 hypothetical protein"
                     /protein_id="NP_958040.1"
                     /db_xref="GeneID:2947922"
                     /translation="MASLRRLVASTLFVVFLIALNAMVGNTPQEALPYAHIEVGRADA
                     NGSATFTCTIAGIHHVSNVVIADEQTLSAVYPRSDDASAEFNYRRRGLVHVHLVVVTV
                     HDVSRLHTDDWIGCQAITGAFVASSAYAAPVAAWMQEIRALREHIEL"
     misc_feature    132821..133267
                     /locus_tag="BPSVgORF133"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02708"
                     /db_xref="CDD:177484"
     gene            133476..133919
                     /locus_tag="BPSVgORF134"
                     /db_xref="GeneID:2947923"
     CDS             133476..133919
                     /locus_tag="BPSVgORF134"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="hypothetical protein; contains a twin-arginine
                     translocation (Tat) signal; The Tat pathwayis involved in
                     transporting folded proteins across energy-transducing
                     membranes; Viruses of the genus parapoxvirus cause
                     localized diseases in large and small ruminants; the
                     poxviridae are enveloped unsegmented dsDNA viruses; unlike
                     many dsDNA viruses that replicate in the host nucleus
                     poxviruses encode their own replication machinery and
                     therefore replicate in the cytoplasm; viral genes are
                     expressed in a bi-phasic manner with early genes genes
                     encoding non-structural proteins involved in genome
                     replication and late genes encoding the viral structural
                     proteins; Orf virus and BPSV are capable of infecting
                     humans but usually infect sheep, goats and cattle"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="NP_958041.1"
                     /db_xref="GeneID:2947923"
                     /translation="MSALRRLAAAAALVALGLLLGALFRPAAPALPAAFVEPGPARAD
                     GSAELVCLVVGGAQHMAAVEAAGAALSPAYPAAAGVRASFASARKGPLLLQEVTVAVQ
                     DVAALDADAEFACVAFAGGFRAAAAYARPVAEWRRQLERLRREEL"
     misc_feature    133545..133880
                     /locus_tag="BPSVgORF134"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02708"
                     /db_xref="CDD:177484"
ORIGIN      
        1 gaactcggga ggcggtcgtg cggacgcacg gacgcacgga cgcacggacg ggctgactcg
       61 agaactcggg aggcggtcgt gcggacgcac ggacgcacgg acgggctgac tcgagaactc
      121 gggaggcggt cgtgcggacg cacggacgca cggacgcacg gacgggctga ctcgagaact
      181 cgggaggcgg tcgtgcggac gcacggacgc acggacgcac ggacgggctg actcgagaac
      241 tcgggaggcg gtcgtgcgga cgcacggacg cacggacgca cggacgggct gactcgagaa
      301 ctcgggaggc ggtcgtgcgg acgcacggac gcacggacgc acggacgggc tgactcgaga
      361 actcgggagg cggtcgtgcg gacgcacgga cgcacggacg cacggacggg ctgactcgag
      421 aactcgggag gcggtcgtgc ggacgcacgg acgccttgac aaaaataagg taagaaagat
      481 aaggtcgggt gaggccgaat cagaaaaacc gatcagagct cctcgcggcg caggcgctcc
      541 agctgccggc gccactccgc caccggccgc gcgtacgccg cggccgcgcg gaagccgccg
      601 gcgaacgcca cgcaggcgaa ctccgcgtcg gcgtccagcg cggcgacgtc ctgcacggcg
      661 acggtgacct cctgcagcag cagcgggccc ttgcgcgcgg aggcgaagct cgcgcgcacg
      721 cccgcggccg cggggtacgc gggcgagagc gcggcgcccg cggcctcgac ggcggccatg
      781 tgctgcgcgc cgccgacgac gaggcagacc agctccgcgg agccgtccgc gcgcgcgggc
      841 ccgggctcga cgaaggcggc gggcagcgcg ggcgcggccg ggcggaagag cgcgccgagc
      901 aggagcccga gcgcgacgag cgcggcggcg gcggcgaggc ggcggagcgc ggacatgctg
      961 gcggcggcgg ggctggagcg gcggggctgg cgcggcgcgg cggagggcgg gcgtcgcctg
     1021 gaggccgtcg aatttcactt tgcgcgggag gcgggcggcg ggaggccggc gggggcggac
     1081 tgcgggacgg agcgggctac agccggcgca gcgccgccgc cgggagcagc cgcagcacgc
     1141 gcgcgaccag ctccgcgggg agcgcgccgg cggagcggcc cgctaggcgg tgcgcgagcg
     1201 cggcacgggc gcgcatttcg accacgcgct ctcggagatc gggcccgtac acgacgagcc
     1261 gggcgatcag ccgcaggatg gcccgcggag gcgggtcggc gggcaggttg tccatccggc
     1321 ggcgcaggag gtccagcgcg ctgcagagcg ggtcgccgaa ggtgacggtc ctgaggacgg
     1381 cggtgtcggc caggcagatg cggataaagt ccgcgtgtgc gtgtttgtct gggtctgcga
     1441 gcgcggcggc gccgaggtgc gcgaccacgt acgccacgca ctgcctcgtg gtctcggtgg
     1501 gcaccgtcac ctcggcgcgc gccagcgcgt ccgccacttc gtgtgcgggc ggcgaccgct
     1561 tgatcaccgc gcgcatggcg cggcccaggt tgtgcgcgac gatgttgtcc aggggcgtga
     1621 tcccgttcct cgatcggagg tcgatgcgcg cgcccgcggc gacgagcttg gccgccgccg
     1681 cgtcgttgcg gtgcccggtg gcgaagtgca ggggcgaggc gccgtaccgc acgttcagcg
     1741 cgtcgatgtc caggcccgcc cggacgaagg gctgcagcag cgtgttcttg caggaggaaa
     1801 tcgtggccat ggagtgcagc ggcgtgttcc cgaacacgtt ggtggcgagg gggtcgcagc
     1861 cgcggctgat gagctcctcg aagatcgcgg gccggggccg gtacgactcc gcgtgctggt
     1921 gcaggagcgt gttgcagcgg aagtcggtcg tgcgcatgtc gctgcccgcg tcagcgagca
     1981 gccggacgag ctccagcgtc gcgtcggacg accgcagcag cacggccatc ggcgtcatcg
     2041 agtacacgtc catcgagttg aggtcggccc cgtgccgcag cagcaggcgc acggtgtcgg
     2101 cgcgcgccgc gagcccggtc aggcacgcgt gcagcggcgt tctgtcaacg acgccccggg
     2161 cgttcacgtc ggcacccagc gcgaccagcg tgtccacgac gcgctcggtg gtctggtcga
     2221 agggccgatg caccaccgcg ccgtagagga ccttggagag gaactcgcgg aaggccgtgt
     2281 ccgtcctcgg gccgaacagg agcttggcga acagctccgc gtcgaacgac ttcgagttga
     2341 gcaggtacag ctccggggcc agcgcgccgc agcaccggtc gaccgcgtcc acgtgcgcgc
     2401 ccgcctccag gaggcagcgg acgacctcgg ggtcggggcc gtcgtagtgc aggtacgtgt
     2461 gcagcgccgt gttgccgaag ccccccgtga agttgacgtc cgcgccgagg ctcagcagct
     2521 gccgcacctc ggaggcccgg acgtccgggc cccgggtgaa gaagtagtcg tacagcgcgg
     2581 actccatggc ggccagcgcg gttattgccg gtgctcagca ttcccacgtt tttattcagt
     2641 tattggcgac acgcctcagt tcatacaaaa agagtcgtcc agcccgcagg acgtccggag
     2701 ctgcggcgtg gggacgcgga ggagcacgag cgcgacgacg tccgccggta gcgggcacgg
     2761 gcctatccgc atgacaaggc tgtccacgag cgcggaccgg tgccgcatgt gcactaggcg
     2821 ctgctgcagg acgtcacggt agatgctgag gatcttgagc gacttggccg atcggcgcct
     2881 caccagcgtg gccggcggcg tccggctgca gaccacgtcc aggagcggcg tcgccggagt
     2941 gccgacgcgc acggcgcgca tgagcgcggt ctccgcctcg cactcggcga cgaacgccgc
     3001 ctgcgactgg cggacgggct ccggcagcgc gtgcgcgccg atgtgcgcga ccacgtacgc
     3061 cacacaccgg cggctagcgc ggactccgcg cacctcggcg acggccagcg actccgcgac
     3121 cgcgaccgcg gccggcctcg cgtccagcgc gcggtcgatg caagtgatgt ggtcgttgac
     3181 gatcatgtgt gcaaggggcg tcttccccgt gaacgagcgc agggtcacgt ccgcacccag
     3241 ggccaggagg cgcgcgcacg ccttgtcgtt gcggtgcgcg gcggccacgt gcagcggcgt
     3301 cgtgtcgtag cgcgcgttgc gcacgtccac ggccacgccg gcgtccagga acggctggat
     3361 cagcgaccgc ttgcaggagg tgtgcgcggc catgaggtgc agcggcgtgt tgccgctgga
     3421 gttgagggcc gtcgggtcgc agccgagctc tatgagccgc ctgatcacgg cggcactggg
     3481 tcgtcgcgac tgcgcgtgct ggtgcaggag gttgttgtgg cgggcgtcca cggtgcacac
     3541 gtcggaccca gcggccacga gcagctcgac gagctccacg cacgcggacg gggacttgag
     3601 cagcgccccc agcggcgtag cgccgtagac gtccctcgcg cgcacgtccg cgcccagctt
     3661 caggatagag ttcaccatga agacgttggt acgcacgccc atgcacgcgt gcagcagggt
     3721 cctggtgaag ccgatcccgt cgttgacgtt ggcgcccgcg cgcaccagga actccatgac
     3781 ctcccacgag caggcgctga agtcgcggtt gagtacgtac tcgcggagga ggctggacat
     3841 gaaccggctc gacaggagga tgtcgatggt ctggcaccgg ccgcgcatga gcgtcttgag
     3901 gacgcgcagg tccacgacgg ccagtcggag gtacaggtgt agcggcgtcg agctgcagca
     3961 gcgctcgtac acgtccacgt acgcaccggc cttgagcagc gcttggacga tgcgcacgtc
     4021 cttggggcca ccggtgtgca ggtacgcgtg cagcggcgtc ttgtcgagcg ggcccgtgta
     4081 gttgacgtcc gcgcccatct tcagcagcgt cctcaccgcg cgcgcggaga cgcgcggaca
     4141 gaggcagaag tagttgtaca gggcggcctc aacgccgtct tccatgacgg cgtcctccat
     4201 caccgggtgg tccattccag cggcgtcggt gcaaaaggtg cgctattcac acatccaact
     4261 tcactttgtg ccagcacact gataaataaa aataagttag caagagagtg aacctgtcaa
     4321 agcaattcag ttaaatttta ctgattccgc cattgattcc tccgcttact ccgcctttca
     4381 caccaccaca tatgccacca gatccaccgc taccaccgta catgcctgcg aatattcctc
     4441 cacctccgcc tccacaatgt tttttagcgg gtggaccacc ccacatagaa ccccatccac
     4501 taccatcaga cgatcctccg ccactagaca aggagtgtgg tcttttacac gcaccaccag
     4561 gatcattagc agtgcctttg tagttgcctc cctggtcgta catgccgtat cgtggggttc
     4621 cagacatttt gttgtttggt ttgattggat ctctatcagc tgtttttatt ttaaacagtt
     4681 tgctgattag aggtttatat ttatatttta gcgaggataa tagtagcttt acaagttcct
     4741 gcacgagtgt cgatcaagtt ttaaaaacaa ttatttaaaa aggaggaacc aacaaaaacc
     4801 tccatcatgg ctcagttcat ttcataaagt gcaaagtgca ttgactcaaa cacgttttgc
     4861 aacgtagtgt gcattatacc tcagaggtta ttgcaaatac acactatcgt ctgtgtgatt
     4921 cctcagtggt ttctggggga ggtgttgact tgggtctgca ctcacatttg ttatgttgta
     4981 ggaaactcat ttcacgcatt ccactactaa taccaccact ggtcccaccg tcgttgtatg
     5041 ctgatgttgt catgatttgc attgttacgt tagacgtttc cgtgggaaca cattccaaac
     5101 tttcatcgtt acagcatccc ccacaacgca tcaaagtaac gcacggagga ctatgtctat
     5161 catttgtatt atcagggtat tcgtctgaca cctttacagg tgttttcata ggctggcaac
     5221 ggctattgtc gtaaacgtca ctccactttt ctacttcatg attaccatta cttgatgttg
     5281 gtgcagcctg catccacttt acacattgga ggcagagtag taacgcgagg ctccattgca
     5341 tgcacactat taagcacttc atgatgtttt gttggtttgt gtggtttatg atctggctgg
     5401 acgtctttcg tacgtccctg ctcgacaaaa aggtgttaga atttacattt ttcggggcta
     5461 gttgacgtac cacacggtgg tgcggcaccg ctcggtgcgc acgcccgtgg acccgaatcc
     5521 gcctgcgcct ctttccgtat cgtccaggca cgccacctct tccacatcgg ggaacgcagc
     5581 gcgctcgcag atcagctgcg ctattcggtc gcccgtcttt acctcgaaat cgttgtggcc
     5641 gaagttgaac agcaccacgc ccacgttgcc gcggtagtcg gcgtctatca cgcccgcgcc
     5701 cacgtcgatg aagtgcttga ccgccaggcc ggagcgggga gccacgcggc cgtagcaccc
     5761 atcgggaagc tgtatctgca ggtccgtgaa caccactcgc cgaccgcccg cagggacgat
     5821 gcagtcgcaa gcgctgcaga ggtcgtaccc ggccgcccgc ggggaccccc tggtggggag
     5881 cgtggcgttg ggggacaggc ggaccacgcg gagcgcgtcg caggcgaagt ggttctcgac
     5941 gaactccatg gcgacgaagg tagatagctg cgcaaatcgc ggtacctttt aagttttaag
     6001 gcggtctccg tttataaaaa gcggtcaccg ggcgggcgcc agcagggccg tgcgcagccc
     6061 catcagctcc tcgtaggaca tgtacgagag gatggaggtc acgatctccg gcggcagtgc
     6121 gcacggacac agcagcccgg cgacatgctc ggccagggac atgcgcaggc gcatcatgca
     6181 gaccttgccg aagagcgcgt tgccgtacac tttgaaggcg tgcaccctgt ccaggagggc
     6241 gttgggcacg tgcacggcct tggccgactc gtctgcgcgg agcacgtcca gcagcgtcgt
     6301 gtcggcgttg cagcgcacct cgcgcatggc gcggatctcc gcctcgcact cgcgcaccgc
     6361 gtccgcgtac ttgcccagca ccggctcggc ccgcacgcgc tcgccggcgc cgcgcgccac
     6421 cagactgtgc acgcacagca gcgcggcctc cgagtccggg aagaagaacc cccagttggt
     6481 ggcggtgacc agcgcgcgga cgaggaggtc gatcggcggc ttccgctcga gcagggccgc
     6541 ggcggacttg aagtcgttgc gccggaagac ttccgctacg gcgcagaacc cggtcgcggc
     6601 caccggcgcc aggtcggcgc ccatctggat gaggcgccgg cacgccgcag ggttgaagac
     6661 cgccgcgcgg tacaacgccg tctgtccggc gtcgttttga cggtccatgt ccaggccctt
     6721 ctcgagcagg aacgagacca cggggcgccg gcaggtaccg tacatcgcca tgtagtgcag
     6781 cgcggtgttc ccgccggtgt cgatgcccgc cggatcgcag ccgctgtcca cgagcgtgcg
     6841 catgatggat tccttggccc gcggcacggt cgccaggtgg tgcagcagcg tgcgcccgtc
     6901 catgtcgcgc gcgcgcgggt ccgcgccggc gcgcagcatc atcgccacca gctcgtcgtt
     6961 cactcccgtg gagcttagca gcacggccag cggggtgacg ccgtgcttgt ccatggcgcg
     7021 gacgtccgcg cccgcctcca gcatcaggcc gagcacgtcg gggcgggcgg cggggttgcg
     7081 cgcgtagacg tgcagcgcgg tcatgtcgta cgcgtcagac tcgcggacgt ccgcgcccgc
     7141 gcggatcagc acgcggacga tgtccgcctc ggaccccgtg gacccgcagg aggccaggaa
     7201 ggaggagagc acgttgtcgt agaagacgaa cccgccttcg gtgcgcacct ccgcgcccgc
     7261 cgccagcatg gtctccacga cgcgcagctg gacgtagtcg tgctggacgt agcagtgcag
     7321 tggcgtgtac ccgcacacgt cgcgcgcgtt cacgtccgcg cccgcctcca gcagcgtctc
     7381 gacgatgtcc gcgcagttgg cgttcctcgc cacgagcacg cagaggtgca gcggcgtccg
     7441 gccatactcg ccccggaagt tcacgtcggc gtccgtggcg acgagggcgc gcacgacgtc
     7501 caggtccacg gggctgccgg tctccaggta cctgaagagc aggtcctcgt gcgacgagaa
     7561 caccgactcc ctcgacagca tgttgtgtat acgttagcta ctagttgaga gcttttttca
     7621 ctcatcggtg gctggattta taaaaacggg atggcgtatc aaactgggac tacaaaaagg
     7681 tagaaaacgg gcggctggaa agggtgggcg ggttacacag ggactccctc tccgctaccg
     7741 gtgagccggt agccggatcc ggcgagcatg gtgagccttt gcactaattg gttgcgctca
     7801 atgccggcgg gggaattgca gacctggagg tggatgaact tctccagaac ttcggtgcgc
     7861 gggagcgtgg agtccaggtc ggccgccttt tccagcaccg tatcccagag ctcggtgaac
     7921 ctggcgtaca tgtcctgcag gtccttctcc atgcgcgcca tcagggagtc ggggtgaggg
     7981 gttccgttgg cgcactgcgc gaacatggca aacagattgt tgaggccgat gttcaggagt
     8041 gagtgggacc tgttcatcga aacggacacg ggcctcctcc gcgaccgcga ggacgcgcga
     8101 cggcacagtg cgactgcgct ggcaacacca tcgacttcgc agttctcgcc gcccacatcc
     8161 accgatccca tgcctttggc gatagcgtca accgactcag tgatcatctt ggctccaacg
     8221 ttgctgtaca gatccccgaa ctcagagatg acgatcatga gcttgcaaat cctgtggtag
     8281 cactcctcca gttctatgcg gagggttata agatcactaa ctagtacgca tgcacgcttt
     8341 ctagtttcag cagcgcttgc agttctaatc tgtgcgtcct ggtcaacgga tggtgagaac
     8401 acgtcgtacc cctgatccag gaggtcctgg gtcggcgtca tcgtcagtat gatgtactcc
     8461 gcttcaccgc cgatgtgcgg cagcaggaac atcccccgca cggcggggaa tacgatggcg
     8521 cttcccacgg ttatgttggt gttcagatac ttggtgttgt tcacggccag cgcagcaaca
     8581 ccctcgttcc ttatgcatat gagggcgacg aacgacgcca tgtccggcga gaccttctga
     8641 cgcatgtacc actcgccgtg ccggagcttc agcgcctggc agtccttgac ttcgaacatc
     8701 gcctcggcgt cgtagatgta cctggccagc acgcttctgc acacgcgcac gggggctcgg
     8761 tggaacggcg actcgaagag gcgtatctcc gtccactccc cgagatgcgt caccaacgcg
     8821 gagacgtcgg ggatgatccg ctcgaacaca gagtccacga gcacggggcg actggccccg
     8881 ggcacggtca ggaccaaggg ccgcgccaca ggcgcggccg cgtctacaga gtctgggtcc
     8941 ccgccgtacg ggacattgtc gtcgtactcg gagtcctcat cgttgcttcg gatccgcggg
     9001 cgccgcatag gcatgcatcc tgtcctgggc acgcacgatg agcgtccgta gctgaggcgc
     9061 cgaaacaagc tggtaaacga cgacatcctt gccagtccac accaagtcat aaaaacatat
     9121 tttatcagtt atttgactgt ttaatgctac cgcgcgacgg ccgggaggac ctcctggatg
     9181 ccggagaccc cggtcaggtg cttggccacg cggtcgcgga cccagaaccg gtcgtacccg
     9241 tgccgaacga cgaagttccc cgagaagtgg ctgtccacgc gctctatgag gctgtggatg
     9301 gtgctccggc agtagctggc ggcgaacgca cggacgacag ccgagctgcg tccggaggga
     9361 ctgctgtcgg ggtccagggg caggggcatg ctggcgatgc gggacatgag gttggaggtc
     9421 tgggggatgt tgagctcgcg ggtggcggcc atctgcgcct cgatgcccgt gcggagcacc
     9481 tcctcgctgc ggccccactc cagcgcggcg atgacgcgga tggagtagcc cttgagccgg
     9541 ttggcggtct cgatgtccac cgaggtcagc acgacgctga accggagctg gtcctcgtcg
     9601 tcggggtcga agagcacggg gatcctgacc tcggggctgc gctcgacctc gcagagcgcg
     9661 atgctgagca gcccgcgcgt gagctcggta acgaaatggg gcttgcccgc agggtagcgc
     9721 ttggacgcgg cctcgcgcag cggggaggag agcctgaagc agcgcgcgtc ggccggcgcc
     9781 gggttggcac cggcctcctc gatgaacagg gcggcgttca ccatgtccag ggcggatgag
     9841 tgcatggggc aggccccgca cccgcgcgcg gcgttgccca ggaccatctc gcgcagaccg
     9901 ttgaacgcgg ccatgtcgca ggaggggaag atgcgggcca gcgcggcctg atgcgatcgc
     9961 gccgcgtcca tgagcgcctg cgccgcgacg gaggccgcgt cctcggccac ggcagggttc
    10021 tcgtcgtccg ggacgatgtc ctcggggacc tccacgcagg cgccgcccca gaactcgcag
    10081 tactcggaga acagggtgcc gggcgcgaag cgggcgaggt ccacgaaggt cacgcggttg
    10141 ccgagcttgg agagaagcgt gttctcggac aggcgcgtcc agcccttgcc ggcgagcgcg
    10201 aagacctggc ggctgtcgaa gaaggagctg tagaagccgt acacggtcat gtgctccttg
    10261 caggtggcca gccacatcag cagctcccgg accaccatcc tggcggaggg gcctcggaac
    10321 accatgcctg tgttcatgac gatggagtgg agctgcacgc ggccgtcgcc gccgcagcgg
    10381 tagcagaacc aggcggccac gcagctggtg ctcgggctgt ggaggtgcgg ctgcgcccag
    10441 gaggacgcct gcgcggcggt gcgcgcgtcg tgcgccagga cctccgtgtc cggacgcgtg
    10501 taggacgcgg ggtccttcac ccagatggcg tagacgccga cgtaacacac gttcatgatg
    10561 tccagcagcg tctgcttccg cacgggcgtg cccagccgcc gcacggcgtc cgtggacacc
    10621 atgcggaggt ggtacaggcc cgcgtcagag agccactggt tgagttcgtc tatggaccgc
    10681 gcgccggccg gcggcgggtt ctcctcgaag gcggccagga gctcgggctc gtcctccgac
    10741 cggcgccgga ggatgtcgag gaaggggctg ctggactcgg ggatgtagca ggcggggtcg
    10801 tccctggata cgatagcgaa ccgctgcgtg gacgccgcgg gcgggtctag cgcatctctg
    10861 tgcgggtcta caaacgtgca cgttatacgc gtggacttga gggatggaag cacgatcgcc
    10921 gcgtcgcgca cgctctgcgc gtcgaagatg atcgttttcc cgtccctggc tttagcgagc
    10981 gcgtattctc caggaacgag gtcggtcgcc accagctgct cgtcccaggc ctgcttgctc
    11041 gtcaaactgt tgcatacttt tccccagaac cccagcatcg cgaggccgca gatcggtcgc
    11101 cgccgcgacc gcagctggag aggtaccggg tgattggcct tccgtgcttt atttttaatt
    11161 tattggtttg cagtactggg agcgccagtc ccgctcgaat acggcggaga gctggttcac
    11221 gatatcgccc ttctcggcgt tgacactgac gaacgcgtgg tacttgtagt gggtgccgtc
    11281 catgttggcc accgttacgt gcgcgaaggt gtcgtccacg atcagcagct tggtgttgtt
    11341 ggcggcgtcg tcgcggccgg ggatggagaa gagccgcgtg gagatgtcga tgctccccac
    11401 gccgaagtcg ttcagcgtgc gcgcggccga cacggacagc gggtctgcgt tcttccactc
    11461 cgtcacgatc acgcggacgc gcacgctgcg gtcgatggcc gcgcgcagca acgcgtccat
    11521 gatccgcggc cagtactcca cgcggtcggc gtgccggatc acgggcacca gggacagcag
    11581 cgacaggtcg atgctgttct tcgcggagtc gatgcggtgc agcaccaggt cctcgtccag
    11641 cgtgcggtag aagcccagga acttctcggg cgcgtccgag aagaacacgc cgccgcccgc
    11701 gtggtccagg tggaagtccg ttgccgtggg cgtgatcatg gcgcagcaca gccgcgagaa
    11761 ggggaccttg ggctccacga tcatggagta gaaggtgttg taccggttca tcaggtccgt
    11821 ggccaggtgc cggttggtcg agtacacccc caggttcttg atgttggaga tggagccgcc
    11881 cgtgagcgag gcgctgccca cgtaccactg ccccgcgttg gagatccaga agctgcccag
    11941 caggttgccg acgtcgtccc ggccggagac cttgaccttg tagtagttca cgcccgcctc
    12001 gcggagctcc tccgcgtccc ggtccttgct ctggacgtcc acgaggacgg tcacgttcac
    12061 gcccgacttg gcgagcgtgc acagcttgtc cttgacgtcc acgccctcgc gcgtggaccc
    12121 gaggttgcag cagaagctgg cgatgtacaa aaacttggtc gcggactcga cgatcgcgga
    12181 gaagcactcg aaggtgctca tgttgcccac ctgcagcgac gacacctccg cgggcagcgt
    12241 ctccacgacg cggcactcgg caccgacggg gatggaggag aacggccaca ttttatttat
    12301 ctcacaaaaa gttacgactg cttcatcccg tcgctcagca gtttcatcat gtcctcgatt
    12361 tccaccaaca gctcgtccat ctcctcctgc gaaaggagac aacactcgtt cttgtaatta
    12421 atgtcttcta gaaaattatc gagcgcgtca accatgtcct ccggcgtgca gtcaggtact
    12481 tcggggaaaa tatcgccgtc gatctgcatg tcatcgagca gctggtcgat gacctcatcg
    12541 aggttcctgc gagctccgtg aacgcgcatt gtagtgttta ggttatgtag tgtacgttct
    12601 ttacgtcgta taacgcaaga gccaacgtaa acgaacaccg cgtacaattt caataattga
    12661 caaactcccc ctcgtcctgc agcatgagct cctccagctc ctcctcccgg cgcgcgtaca
    12721 tgcggtgctc ggcgaaggcg acgtacgcct ccagccccag cgtgcaaagt ccgatcgcgc
    12781 cgaagaccgc cgctgccgcg atgacgaggc ccacgatcat cgctcgattt aggcactgat
    12841 ttttgatacg tttgcgccgg aattggccta tttaaccgtt tcgggcacga ttaatagcgg
    12901 tcgggcaaca tgtgcttgtg cggcatcttc ttcccgtgcg ccgagtggct ggtgcggcgc
    12961 gtcaaccgtc tcatcatttg ggtccgaagg cgggtcggag gcgagccggc gtatgtctcg
    13021 gtcgtgcagg cctgcgacga ctacttcacc gaggacgagt tcgatgccca gcagtccgtg
    13081 tcgctgctgc gcgcgggcgc ggaagcggcg acgccaatcg cgcgggtgtg acgataatca
    13141 cataattcac atatatacac atatcataca caaaaataaa tatcacccgc caccaattca
    13201 ccttcacacg gctatagcat gaactcacgt atcaccgcat cggacgccgt ctcgtctgga
    13261 atgtccgcct tttgcagcac cgatcggcac acgaagcaga cgtccgtgtt cgccggaccc
    13321 aagcagtgcc ggtggtaccc gtggccgcac accatgacca cgaacgggca cgcgccggga
    13381 cacgcggcgt tcagacatcc ctccgaggcc ttcttgctgc aaatgtagca caccggcgga
    13441 cacgccagcg agcacttgac ggcgaccttc cacgacttga cttttatggg catgtcggct
    13501 cagatgaaca ccagtaccgg agagtcgagc acttctcggc gagtgttcag cgtgaaccgc
    13561 ttgacggagt caacggttct tctctttgca attttatttc tgcacaaccc caggagcgcc
    13621 atctccgcca gccgggcgtc gccgccgagg gacagggcca cctcctcgat cgtgacgccc
    13681 gtcttgccgg cctcctccat gagcgcgagg cagactaggt gcgcggtgga gcagatcacg
    13741 tccaggtcgc cgtggctagt ggtgagcgtg atctccgcgc gcccgaacgc ggcgaggggc
    13801 gccaggtcgt agctcgtgtc cgcgcgatcc agcgcgcgct cgagcgcgcc ccgcagggac
    13861 tcggggggcg tgagctccgc ctccgggacg gtcgtgggca gcgtgtacac gttgacgggg
    13921 accagcgtca tcgtcgggtc gtgggcgggc gcagccccgt cgtgctccat gggcgagggc
    13981 ggggacagga gggggatgcg gagcgtgccg gccatgtact tgcgcgacag gtcgttcagg
    14041 ctcggagaca ccatctgcgg gtaccgctcc atggcgatct tgagggacag gtgcttctcc
    14101 agccccacct ccgtgtacag gctcttgact atgcgggcgg tggccacgcg gacgaagtcc
    14161 gcgagctcgt ccttcggcag ccgggcgatg tacgacagta gcgtgtccgt gtcgcagggg
    14221 tccgccgaga tagcggcgga gtacaaggcc tttccggaca gcttggtcaa taccgtcgca
    14281 tgcaggccct cccttacgat ggcggagtgg aagtggatgt acaggctcag cgcgcgctcg
    14341 aggttccgct cgttgatgtg actgtctatg cactccacga cgatgcccgc caggtggtcc
    14401 ttgatgacgt ccagcagtcc gccggcgctg aaccgcgccg ccaggagaca cgtgcggcag
    14461 taggtcttca ggccctcaat gtccatctcc accaccctcg ccaccaccgc accgaccacg
    14521 cgcggccaca tgcgtatctt gctcgcgtgc tgctggcgca ccatgtccgc gagttcctcg
    14581 tgcgatccgg cctcgcggct ccggtccacg atggcgccgg ccatgttccc cgagtaccgc
    14641 agtatcgcgt tgacgaagcg caccgaggcg tcctccggca tcagcgcggc gagacaggag
    14701 ttgcagcgct cggcgaccag gtgcgggtac ctgctctcca cgacgcccat cgccagccgc
    14761 tgcaccgaat cgccgaagag cgcttccatc gcctcgcgca tgcactcgtc gaagatgtcg
    14821 gcgttgtgcg tccactggac ggtgaccagg tagggctcga tgttctcgcg cgcgctatcc
    14881 acctcgctca ccacgaactc aagcagccga acgtcgtccg agatgtccgt tcccaggatg
    14941 ctgccgctgg ggagccaggc cttgcgcagg atggcctcgc gcagacacat gatcacggcg
    15001 aacgagttca tgcgcagctt ggtgagccgg cgccgcagtt tgttcatgtg cgacagcggc
    15061 atctccgagt ccatggcaaa gccaaggagc aggatcagct cttcgtccat ggctgcggcg
    15121 gtgttgcggc acagacacgc gagacgggag attgacgaac actcgataaa ccgtgctatt
    15181 tcatttttgg acaaaaacta ctcgtcgccg tcgagggtca tgcagtccag gctgcgacac
    15241 accgcgagga ggtcgaaccg gtcctggcgg cgccggcgcc gaacgttgtg gcgacgcgcc
    15301 tccgcgagca tctggttgta cgtctccgtg tccgcgtacc cgtggaatat cgcgcgacgc
    15361 acgctgcgcc cgcgcgacgc ttccaggcgc gcactcggta cctgggagtg cacgcccgtg
    15421 aagtggttgt acatggccag cagcccgccg aacgggacga gataccggtc caggagacac
    15481 tggctggcca ccgacggcgc gcgcggcacg acggcgccgc cgccggcgtc atctaggacg
    15541 tcgcgcagca cgcagcgcag catcgtctcc atgccgtcca ccggcttgaa cggcgaggcg
    15601 gagccgtcgt agtggaaccc gtcgacgacg aaagagaggg tgtatatctc acacagcttg
    15661 tccccgaact ccaggaagag ctcggcgatc ctccagtcca cgacggaggc cttgaacagc
    15721 acgacgtgcc ggacgtcgtg cgagcgcgcg aggtcccacg tgtcctggcc gatggcatcc
    15781 gccgacacga cgccggtcac ccgcacggtc accgccggga acatgccgtg cttgctgcag
    15841 aactggcggc aaatctcctc ctggcggatg gtgtcgccca tgctctgcat gcgcgacgtg
    15901 gtgatgatca tcgccatcct ccgcgatatc tcatcgcttt cgtccatggc tgcaccgaac
    15961 gtccgtaagt cgacatatcc aatttacatt ttagcggacg cagaaaaacc ggagtcgcag
    16021 ctgcgagacc gtacgcgcgg ccggcaggta cacgcgctgc ggcgcctgcc gccgcgcggg
    16081 ccgctgaagt agagtctacg aagctcgtcg ttggttaggt cgctgcagct tacggaccgc
    16141 cgcaggacga cgatgtacgg cgacgtgacg gacgcatcgt gatgtgaatc gcggcagcgg
    16201 gcccgctcca taacgtaacg cttggtcaga gtggggctta tattttcaac gtaattaaat
    16261 ggaggccggc ggtgtccata aaaggccgtt catcgtcaat gtcgagggac aagggcgggt
    16321 gctggtgctg cggtacgtca agctgtgcga ggtccccgag gccagatgtg aagcacccag
    16381 aacctcctgc gtgctcaagg tggacccgcc aaagtcgccc gtctgcgaca gacgccccgt
    16441 ccccttgtcc cccaccgcct gcgtgcgcac cccgcccggg tccccgggcg ccacgccgtt
    16501 catgcccact aacatgctgg agagcctctt cacccgggcc aagaccaacg gagagcaggc
    16561 gtgtcggcgc cagtaactac cgcgacgccc tggatcagtg ggtgatgacg tttctggtga
    16621 tatcgatgac gccgtgcgtg cccgacttct tcgagcgctc caccacggcg gtgacgcggc
    16681 ggccggtcga gacgagggtc gacagcatct cgcgcacggc ggcctccgct gccgggtgac
    16741 gcgtcagtag caggaacatg acgatgtgcg cggtcacggc gcgccggctg atgtcgtgca
    16801 ccgcgtcgcc gtccatcagc accgtgttcg agaagtgcgt gtacagcgtg tccccgtgca
    16861 ccaggaaggc cgagttggac acgctctcga agtccacgat gtcgtcctcg gggacgccga
    16921 ggtccaggat cttctggacc agcacgggct cgtcgaggaa gaccacggcc ctggagaacc
    16981 cgaacgcgtg cgcggaggcg tccacctcca gcacgcggga ccccgccgac tcgtcggggt
    17041 ctgcgggccg cgcgaaggcg cacggcagcg gcatccggtc ggagggctca gcgacaggcg
    17101 ggcggcactc cagctcttcc atggcgaacg cgaggagcgt ctccatgcgc gcccgcgcct
    17161 tgtcgaagtt ctccaccagg tcgaagatgc ggtccgtctg cgagaacatc ttcagcgcgg
    17221 ccatgagctg cacgaagggg tgaaggatgt agatgttgtc cacctgcagc gtcggcagcg
    17281 cccggagcgt ggcctggcgc acgttgaagc tgtcgaggat gtgcccgccc tcctcgtcct
    17341 gcagcaccac gtagctcttg aggtacggca cgcgcagcag caccgtctgc cgcccggtga
    17401 cgaagtagat caggaaggcc aggttgatga ggaacgggcg cgcgttcgtc tgcaccatgt
    17461 cgatgtcccc gtactcgatc tcggggttga gcaggtgcag cgagtacgag ccgtagcaca
    17521 cgcagcgctt gttgttccgg cgcaggtgct ccttcatcag ccgcttcacc acgtccacga
    17581 ggtcggagtg cttgtgccgc gccattgcgg ccggctcgcc cgcgggcggc tgcagcacca
    17641 tgtaggactc cagcgcccgt ctggtgaggt ctttggcggg cgacacgtcc acgcgccgca
    17701 ccgcggcgtt gatggcgggc atgggcgagg tcagcgagcc cacggtcttg gtgaactcgg
    17761 tcacgatcac gctctgcagc tccagcaccg tcaggatctg gcccagcttc tccaggcgcg
    17821 tctgtcgcgt gaagtactcc tcgatgcgcg cggcgatctc cttctcggac ccgccgagct
    17881 tcttgaagaa gcggcggcgg ctctttacaa caagagagag aaaaagcttc ctgtcgaagt
    17941 tgaggacgcg ggtcatggcc cggcgctgcg cccgcagcag cacgcaccgc tccatggagg
    18001 ggcgggagcc gaggtactcc tcgatcaccg gcggagccat ggcagctctg ctatttttta
    18061 aacacccgat tattgtacat cgcaaactgg gcgcacacgc gctggcagag gagcgtggtg
    18121 ttccgcatgc acaccttgga ggactcgatg gtgcgctcgt tcggccccca ggcgcgcagc
    18181 tccacgagct cctgctcgac gaactccacc gtgtcggtgt agcgctccgt gcagagcccg
    18241 tccgtgaacg cgttgatcac ctgccgcgcg aggacggtca cgtccacctg ctcggtgagc
    18301 cgcacgccca gcgcgatgtg cacgaacagg cagcggaaca gcgcgtccat ggccatctgg
    18361 tggtccgagc acgggcccgt ggccgactcg taccccagcg agaagcgccc gatgccgcgg
    18421 tactcgacca tctcggacgg cgagaacgag agccgctccg ccttgagcac gggcggggga
    18481 ctggcgggga gtccgcgcgc catgtccagc accggcgtcc agccgggcgt gaacatgtcg
    18541 ggcagaagga agaggccgta ccgcgccatg cgtgcgacgt cgaagatgtg gtccacgacc
    18601 ttgttgacgg cgttgtccga cttgtgcgcg cggagtatct gcaggatgac gttgccggag
    18661 gggtggtgtg tgatcgccag gtcggcggtg gcgtacccgc gcagcccggg cagcgagtac
    18721 acgctcagac acgcggccag tcgcgcgctg tgctcggagg agaacacttc ctgctcgtag
    18781 ccctcctcca ggtcgtcgac ctcgcgaggc cggcgcacct cgtggttggg cttcaggcgc
    18841 atgtctccgg ccgacaccag gaaccccagc gactcccgga cggccggcga gacggcgtcc
    18901 tcggagcgga gcgtgtcgta cacgcgctgg agcgtcgcgg gcttgagcgc gtacccgaac
    18961 agcaggcggg acatccgctc cccggagaac gagaagcggc gcgtgtactc ctccgcgagc
    19021 tcgggccggt cgttgaacca cgccgtccgg aagacgtagt cagaggcgaa ggggtccgcg
    19081 cccatcttca gcagcgcccg cagcggcacc gtgtccagga ggtccacgat gtcagggagc
    19141 ttctgtcgga cgcaggcctc cgccacgcgc gtcgtgtgca cgcacatgtc ggcgacggcc
    19201 accgggtgtc cggactccac gatgcccacg cagacgtcgt ccgtgacggc gtccacgtcc
    19261 gcgagtctga tgagcttggc cagcacgtcg tggtagcctt tggcgagcgc cgtgttccac
    19321 atgaacgtag cgtcgaactt gttggggaag tctgcgatgg ccagcagctc cgcgtggctc
    19381 agggcgtcca tgttgaggta ggtggcggct tccacgaaga tggggccgaa ggcgccgatg
    19441 tcggagacgc ggtcgcggag gtagtcctcg gcgtagtgcc ggtacgcctg cacctccccc
    19501 tgccggatgc gttcgatggc gaaggccttc acggtctccg aggagagcac cgagtgccgg
    19561 agcccgtcca gcacgcgccg gacgtcgtaa acggcggtga gccgcgcgag gatctccact
    19621 gcgtccagcg gagaggcggc ctcgaggccc gcgttcaccg gggggatccc gtggtcgcac
    19681 agcatcctct tgaggaaccc tatgtccagc ggccgcgtgg cgtacagcgc cggcgccatc
    19741 tgcggccgcg cctccacgat ggcctccatc atctcgtccg tgaacacggc gttaatgttg
    19801 tgcacgctgc gcgcgttgac gttcacgagc acgtcgtcga cgtcgtcggg gaaccgctcc
    19861 tcgatgagcc ggacgtcgtc ctccgtgatg tccatgaagg ggatgcaccg gcacaggagc
    19921 gcgtagtccg cgtgctggac caggtagggc gtgtggtacg cgatgtgctc agcgaagagg
    19981 gctccgcacc ggcgccgcga gagctcctcc aggaggtcct cgggcagcac gtgctgcggg
    20041 cggaagaggt ggaggtacgt ctggaaccgc tcggagaccg gcgcgtacat cttccgaggg
    20101 aggtgcttgg ggtggatgcc gtccgccatc agcgagagcg cgtcctccac cgagaggtcg
    20161 gcgaaggcgc gctccacgct gccgcaggcc gcggcggagg ccacgaagct cttgacgttg
    20221 tgaagcatag cgatggcttt cgcggaaggc gcttatttta atgttattcc gcgtcgcgat
    20281 aaaaataatt agaaactgac tccgcaattg tttatgagga tggtgagcgc atctgtgcag
    20341 gcggcgttgc gcgctgcctt cttgctgcat ccgctggcgg tgctcacggt cttgttcgag
    20401 accaccaccg tgcatgtgaa gagagggcag tggtcgtgac caccggtgcg gcactcttgg
    20461 aacacgagcg gtctgtggac gcgcatgcag tactcgttga cagcgctgac ggggttgagc
    20521 gttttcagat gcgtgaccgc accgacagtg agcacgtcga tgtcctcgcc gaatagcgag
    20581 gcgccgaggt acgtgcactc cgtctccatg ggctcagggt cggacccgga cccgcctgtc
    20641 gcttcatcgt cgccggaggc cgtgtccttc ttttcgtcgg cctcgcacgg cgcggaccag
    20701 aggggcgggc acccgtcgac gcatgataca gcgtcggact cgagcagctt gtacagacag
    20761 cggttggcat cgtgtttgga tatgcccagg gccgcggcca cgcgcttcgc ggggacgggc
    20821 gtgccggagc tggacaggaa ggtcaggatc ttggactcgc gatcgcagga cgccatcgtt
    20881 atttacggat ccgacgtttt tttaggattt tgcggaggct tcttgtcgca gaacttggga
    20941 ggattgaaac tcttttggca atttttgcag gcgtatttga tcaagggcgg ctcgtcggcg
    21001 gaccgggtct ggatcatcat gggcatggtg ttcttgctcc ggcaggaggg gcagggcagg
    21061 ttgtgctcct cgtccaggac gttgaagtac tcgccgtagt cgtggtcccg gacgtcgtcg
    21121 atgtcgtacg ggacgccggc cgccacgcag cgcaccgcga acagcacgta ccgcagcgcg
    21181 tcctgctcga cgccgttcgt cgcgcggacc tgcgcgcgca ggtccgcgta ctcgtcccct
    21241 tcgacgacct cgaggctgcg cttgttcttg tacgagagcc ggttcttcgt gtccttagag
    21301 tactcgatgc cgatgttgtg cgccgggtcg aagttcgtgt cctcggtgtt cgaggtcttg
    21361 gtgttgacga tgttcttgag cgcgaacttg tgtgcgcaga tcagcgccca agacgcgatc
    21421 tcggcggccg cggcatcgtc gacgtgggcc gcggccagct cgcggagctt cgcctcgtcc
    21481 atcgatttag gtccggtatc aaatctcagt attatctgcc ctctttagta taccgcgcgt
    21541 tattgcagca gcgaccgcgc gcggcggcaa atttggcgtt acaaatggac ttcatccgga
    21601 ggaagtacat gatccacgcc atcgaccgca acctggactt catgcgcgcg gagttccagc
    21661 agaaggtctc catcttctcg ctggggcacg tgctcgcgct gcactacctg gtcacgacgt
    21721 ttccgcacgc cgtggtgacc aaggacgtgc tcgccagcac caacttcttc gtcttcgtgc
    21781 acatgtcgca gcgctgcgag gtcttcgacg ccgtgctgcg ggccgccttc gacgcgccgc
    21841 agctcttcgt gcgcgcgctc tcccggaact tcgaggcgtt ctcgtccgcg atccaggcct
    21901 accgcacggc ctgcgcggcg ctcctccagg acgcgcgctt catggaggtg gccgcgcgct
    21961 ccgccgagct cgcggaggtc atcggcgtga actacgacct cgcgagcaac ccgctgttcg
    22021 cggacgggga gcccatccgg gacatggagc tcgtgttcgc ccggctgttc cggaagaccg
    22081 agttccgcgc ggtgaagcgc ctggccgtac tgcgcctgct cgtgtgggcg ttcctcgtca
    22141 agcgggacgt cggcggcgag tacgcggaca acgaccgcca ggacctgttc acgctcctgc
    22201 agaaggccgg gcccgtgcgg cacagcgggc tcaccgagag catccgcgag tacatgttcc
    22261 ccggggacaa gcccagctac tgggtgtggc tgaacgcccg cgtcaccagc gacgcggacg
    22321 tgtaccggga caggaacgcg cgcacgctct acgagcgcgt gctcagctac gcgtactcgg
    22381 aggtgaagca ggggcgcgtg aacgccaaca cgcttaagct cgtgtaccgc ctggaggacg
    22441 acaccgacat ccggggcctg ctcctgcagc tcatctacga cgtcccgggc gatatcctgg
    22501 gcgtggtgga ctccgccgac gaggagtggc gccagtactt cgtccggctg taccgcgaga
    22561 acttcgtgga cgggaagacc ttcaccgcgg acgcgcggtt cagggacgac ctcttccggg
    22621 tcgtcgccgc cgtggacccg gacttcttcg agccggcgcg gatccgcgag gccttcggcg
    22681 cggacgcgcg gctgcgggag cgcttcgcgg acatggacct gaacggcgcg ttcatgtcgc
    22741 acctcgtcta cggcaccgcc gaccccgacc tgcacgcggc ggagcgcggg ctcggtatgc
    22801 ggctgtacaa cgaggactcg gagttcttca tccgcgagta caacacctac ctcttcctca
    22861 ccgaggacga cccgctcgtg ctggaccgcg gcgcgctctc gaaactgtcc gacgtgccgc
    22921 gcgagcggca ccgcgagctc ttcagcgaca gcgtcctccg ctacttcctg gacgccaagc
    22981 tgggcacgct ggggctcgtc ctcgaggact acagcgacga cgtggttgcg agcatgctgc
    23041 ggcacttgcg ccgcgtcgag gacgtgtcct cgttcgtgac gcacgccgcg cgccggaacg
    23101 cggcggccgt gcccggcatc gtgcgcgcgg tggtcagcaa cttcaacccc gccgtggtcg
    23161 cggccatgcg ccccttcctc cgggagaacc tgacccgcgt ggaggcgctg ctggacggcc
    23221 tggcgcacct cacgcccgcg gacaagcagt acatccgccg cgtcatcctc caggggaggt
    23281 cgtgacggcg gcacgttacg gcccttaaat cgcgatggtg gacgtcaaca cgcacgacgt
    23341 cgacgcggcc gcgcagctgc gcacgcccaa ccagcagacc ttcttcacca aggggctcag
    23401 cccgcggatg cgacacacct acatctacaa caactacgcc tacggctgga tcccggagac
    23461 cgcggtgtgg agcagccgcc tgggcgacta cagcgtcacc gacttctacc cgatctccct
    23521 gggcatgctc aagaagttcg agttcatgtt ctcgctgctc gcggaccccg gcggggcctg
    23581 ccccgcgtac acgcccaagc tgaacaccga gttcgtcaac caggggtcct tctcgggccg
    23641 cttcgtgaac cccttccacc gcttcgcggt gctgcccgag cgcgagtaca tctccttcct
    23701 gctgctgacc tccgtcccca tcttcaacat cctcttctgg ttcaagggcg agaccttcga
    23761 cacggcaaaa cacagcctgg tgggcgccgt gttcaccacg cgcgagcgcc acgtcgagct
    23821 ggcccggtac ctgcgccgca cgggcgacta caagccgctg ttcagccgtc tggggaacga
    23881 cgagaccttc gaccgcgcgt tctcggggtt cacgcgcatc agcaacccca cgcccgtggg
    23941 acggctgccg ccctccgact tcgagacgct cgccaatctc agcaccatcc tgtacttcac
    24001 gcgctacgac cccgtgctca tgttcctcgt gttctacgtg ccgggcatgt ccgtaaccac
    24061 gaagatcacg cccggcgtgg agttcctcat ggagaagctg tcgctgaccg ccgaggacgt
    24121 cgtgttggtc tagccgccac aaacataaaa tgtaatgcgc ctttcccaac acaaccacac
    24181 gcagccatgg cttcctacga caataccgcc ttctacggag aacgcactgc ctcacagacg
    24241 cgctgcagat ccccgtaccg ctacgcggac cctgttcccg ccaacatcat gctcccgacg
    24301 ctgagtctgg agcagctcat ggaggaagac tcgttggaca cgcgggacat cgtcgacggc
    24361 agcacggaga ccgcggtgca gtgcctgctg gaggagttct ccgcgctgtg tccgggcgac
    24421 cagatcacca tgctccggtg catggcggcg gccttctacc ggaactacac gttcgtcccg
    24481 tacgcgtgcc tgcaaatcat cacgagtcgc ctgcgcgtca tgtacgcacg cgaggtcgtc
    24541 cacaccgcgg acgacctcgc ggacgtgctg cgcaccgccg actgctcggc gttccggcgc
    24601 catcgccaac ggatcctcga ggacatgctg gacgaggaga tggacgtgta ccggtacctg
    24661 atgagcgcca acgaggacat caccgaggac aacctcctca ccgcggtgga aacgctgctc
    24721 aggcgcttca agcacctggg ctgctaccgc tcgctgtgca tgctgaagat cctcgcgctg
    24781 cagcacgagg acctggcacc gttcataaaa aacaggatcg ccgagatccg gaagcgcgcc
    24841 cacgcgcgca cgcacacggt ttacgtgtga cctagctggt gaacacgggc ttgcacccga
    24901 acagcttctc gaagaacagt gttgacatag ccttattgtc cagtagattg actatctccg
    24961 tgcatagtct tttgaagtat acctcataca tgatcctctc gtttttctcc agagcgaacg
    25021 tcttgtcgac gacccgctcg tacgacttga tgttcgtgag gcgccgtcgc cacgggccct
    25081 cctcgcagac gtacgcaaag aagtaccgct cgccgatctc gatggactcc gcgttctcgg
    25141 cgttgtactt cgtcaccagc gcgatgttgg ggttgtccgg cgacttgaag ttcttgtggt
    25201 gcacgcggct gagcgtgaac cactccagcg gcatcgcgcg ggactcgaac tcgaaggtga
    25261 gctcgtcctc cagcgaccgc aggatctcca cgcccacgtt ccgcgagccc tcctcggcca
    25321 gcgtccggca gagcatgtcc ttgtacttgc ggatcatgaa cttgtggaag ggcgccacgt
    25381 cgcggcgcgt ctcgctggtg cccttgctca cgcgctcgct gccgccgccg tcgacgaccg
    25441 cgtacttgag cgtggtgtac ttcttcttgg actgcatgat caggttgcag tacacggcct
    25501 cgaactccac cttgaagttc tcgaagagca cgtactcgtt gatgacgcgc tccaggcagc
    25561 ggcccacgcg ccgcgagaat ccgatgtccg ccgaccccac ctccaggaac acggagtcgg
    25621 tgtcgccgta gacgctgcgg aaggacacgg tttcgtccgc gcggtcgccc gccacggccg
    25681 cgtcgatctc cacctcggcg ccgcggccct cgaaggcggc gtcgcgcagg agcgggttgt
    25741 ccggccgcgc cgccagcgtc aggcgcgcgc cccgcaccgt cgcgccgtcc agcgtgcgct
    25801 ccaggtacat gatcatgttg cgcccgatgg ccgtgcagct cttggcggag gcgtacgaga
    25861 agagcgcgct gttccggaag cccatgagcc cgtacacgga gttggccgtg atcttgtacg
    25921 tgtactgcat ggagtcgtag atggcccggt ccaccgccgt ctccgcgctc ttcatcagct
    25981 tcttgtactt cgcccgcgcg tccaggaagg agcgcagcag catggggatg atgcccttcg
    26041 cctcgcggtc gaagatggcc acctcgctca cgaactccgg cgagcgcggc tcgcacgcca
    26101 ccgcaatgta gcgcggcgcg gggaagcgcc gccggatgtc caccgcggcg atctccgcct
    26161 ccagacggtt gtcggacacc accacgccga ccagcgtctc cggcgagagg ttcccgtaaa
    26221 tgcagacgtt ggggtacagg ctgttgtagt cgaagatgag cacgtgcttg tcgtacatct
    26281 tctgcttggg cgccatcacg cgcccgccct cgtagaagta cttggacttg gtgtcggagc
    26341 gcaccatgac ggtccggttg tccagcagca gccgcatcag cgggcccttg atgcaggtgc
    26401 tcgcgcggta ctcgaagacc accgactgcg gcagcaggta cgtgctcgcg gcggccgcga
    26461 tcttcgtctc cacgccgtag tgctcccaga ggtacagaca gaggcacgcg tcgtggagac
    26521 agtaccgcgc catgtccata cacacctcca gcgagtagtt cgcgtacatg tccgccaggc
    26581 tgacgtcgtc cttgccgaag gacagcgtga cgacgtcgcc gggggagcga cacgcggggt
    26641 cctccagctc cacggtgaac ccgccgtcgt ccacgcgctt gtggaggaca cgacacacgt
    26701 gctcgtccac cgtgacgtag ttgcccgtgg acagcacgcg ggcgaagacc gcggcgttgc
    26761 cgtccttgtc ggtgctccgg tcgccgcgaa acgtggtcgt cgtgcgaccc acgtcctcga
    26821 cgacggccgt gcagtggaag gagttcttgg agatggcgtc cagcttgtac gagtccagct
    26881 tctcggtgcg ctggatgaac gcgtacaggt cgaagaatat ggtcccgttg ttgttgttga
    26941 tgtggaaggt ggtgctggag acgccgccca cgcccttgtg gctggtcttc gtgcgctcgt
    27001 acacgcagaa gttcacggtc tcggacccgt ccggcagccg gaagcggatg tgctccccgg
    27061 ccagcagcga cagccgcgag tccaggtacc gcagatcgaa gttgtggccg ttgaaggtga
    27121 ccacgaagtc cagcggcatc tccagcagcc gcttggccac gcgcagcagc gtgacctccg
    27181 gacacagcgt caccgccgcg tcgaagacga cgtcttgagg ctccgcgcac agcggcaccc
    27241 cctggcgcgc cgccgccgcc aggtcctcgt cggacagcat ctccgagttc gtgagcgtga
    27301 accgcgtctc tgcgcccgcc ttgtccacga cgcagaagct tatgtgcgag acggggttct
    27361 tgaacacgga gggaaacttt ttgtcgaagt ggcactcaat gtcgaggaac aggcacgact
    27421 tgacaacgtt gaaccgcggg atcttctccg caaagcacgc gcccgggtcg tcgcagtgga
    27481 agcagttgtt ccccaggtcc cgcagcgccg acgtgtccac gcggtagcac ccgtcggggt
    27541 cgatgtcgtg cgccacgaag aaccaggaca cgttcagaaa gtcggacatg aacgtctccg
    27601 gcagcgacag cttgtgcacg ctcgccacga ggcacagctc ctcctcccgc cgctcgcgct
    27661 ccgggatctt ggcggagcgc gccacgatct cgtcgatact cactacggac atgggcccca
    27721 ggtcgcgcgt ccacgccacc ggctgcacga tctcccgcag cgcgctcttg cgcacgacgt
    27781 agtaaaagtg ctgcacgaac cgcaggtaca ccacggagtt gcgggagcat cgcgccttca
    27841 ggaacaggta ccggctgtcg ttgctgcggt tctcgaacca gttcaaacat ttcagctcca
    27901 tttcaaagaa cagaataaca tttcatttaa atggaaccca ggttctgggg gcgcgcgatc
    27961 tggacggtca tcttcatcgt gctgcgccgg ttcgaggagc accggaacct ggagctgtgc
    28021 aagcggcagc tgtacgtgat ctgctccacg ctgccctgca tcgcctgccg ccggcacgcg
    28081 accgccgcca tggagaaaaa caacgtgctc tccagcgacg accccaactt cgtgctgttc
    28141 ttcttcatct cgctgttcaa caacctggcg ttcgacgaca ggttcaagat agacccttcg
    28201 aaggtgcgtc cgctggtgcc ctagagcatg ccctcgtacg cccgcgagtt gtccgagtac
    28261 acgatcaccg aaacgccgtc gcgcggcacc acgcgcacgt gcgtggtgtc cgtgatcacg
    28321 aaccccacgc cggtgacctc ctcgtcgcgc gcgtcgtcca ggaacagcag cccgtggtgg
    28381 aacaggtaga actcgttgtc cgccagggtc agccgcccct tgtcgcacag gtagtagaag
    28441 atgtcctcgt cgcggatggc cagcgtgaac gtggactcct tcacgacgat gtacttgtcg
    28501 agctcctgga gcacggatgc ggccgcgcgg cgcgcggtcg cgcggcactg cgtggggcag
    28561 gcgcactcgt cctcggagta gaggatccgg acgcgcccag aggcggtctc tagaaaaacg
    28621 ttaatcgctt ccatggtgca cgagctcctc caggatggtg agcacggtcc ggagcacgag
    28681 cccgacggtg cagaacggca cgccggcccc gacctcggcg aagtcccgga cctccttctc
    28741 cacgcggtcg tggactttta tgggtggcgc caccgttcca gtcgcgtcca tggcggccgc
    28801 gatgatctgc gccacgaact cccggatctt gctcatgcgc cgcagcacga ccacccggaa
    28861 gaagatggcg gccagcatgt actccgcgat gcacccgacg gcgatcagcg cgcgcgagtg
    28921 gtccgtgttg aggatgctgg cctccgctac gaagtcggag gccttcacgc gcgacaggcg
    28981 caggaggttg ttggtgttct tgacgccgtc ggccgagagg ttcgcgaaga tgagcttctc
    29041 gtactcgagc gcctcgacga ggcgggcctc gtccatgagc cgggcgcccg cgagcgcgca
    29101 gctcagcggc ccccaggccg cggaccccgc gaagcagggg tcgaccacgc cgtgcagcgc
    29161 cagcagcacc atgtcggcga cggccgtccg gagcgccgcg tcgtccagct ccggagacgc
    29221 ggcggcgccc gtgccgaagg aggcgctgcg cagcgccgcg cggccgggcg tcgcctgccg
    29281 gtcgcagaac tcgcagccgc aactcggggg cagcgggggc ttggagagca gggtcatcac
    29341 gccgctcacg tgccggtagt cggtgagcag caggcccagg atctggtccg tggtgccctc
    29401 gacggcggcc gtcgcggcgc tggtggggtc ccccaccgtg tgccagttgc agatcacctt
    29461 cagaattttc ttcttgagct cgttgggcgc gtcagagcag agcaccagcc gcgggaacgc
    29521 gaggttcagc cggaagtcct ccaggagctt ctccagcacg gcggtcttcg cgcggcggcc
    29581 gtgcacccac tcgctgctca ggtggcacag cagctcctcg gcggtgtccg acgcggacgc
    29641 catgacgacc ttgggcacgc gcccttcgct gctgatcacg ggctccgaga tgcgcgtgct
    29701 cccgcggtgg cgccgtatgc tcgccgccga cgaccggacg gacgcgcgag gcgcgcacgc
    29761 gcgcgcggtg ttgcggcgga ccagcgggcc gggctcctcg aacgactcac tgtctggact
    29821 gtcgccgctg cgcgtgctcc gcgtgctccg cgtactgtgt gtgctgcgcg tgctccacgt
    29881 gttgctgcag gagtcggtgg tgtccgactc gtcgtagtgg aagtccacgt gctcctcggg
    29941 gagccggcgc gactgcgact ttgaaatgcc cacaaggttg tcggcaccga cgggacgcac
    30001 gcagagcgcc gccgcgccct cgcggaccgc ccgcgcgaac tccttgctgc ggaccatgtc
    30061 gacactaagg aacttcataa tgttaaagta gggccattca cacacgagtc gggcgcaggt
    30121 gcaggcgtcc tccagctcgc agagggcgcg gttcagcggg gggatgtttc ctttatcggc
    30181 aagggcaacc aggtcctggg gggagatctt cagcttgggg atcatctcgt tcacgttgga
    30241 ggggtcgatg gcgcgacaca cggtctcgat ctctgtgcgg gtcaggcgca ggcgcgggca
    30301 ggcggtccac ggcgcgcagg tgagcgccag gacggccggc acctccccct tctccaccag
    30361 atcgacgacc tcgggctcgt acaccagccc cgcggacagg agcacgcgga gcacgtccat
    30421 gtcgcgcgcg gccagcagct ggcgcttgtt caggatcacg acgggggtca tcttcttggg
    30481 gacggtcttc acggtcttaa gggcggtgat gaggtcggtg agcttgacgg tgtgcggggg
    30541 gaagtacatg acgttgagag gacaggcagc cacggcctct tcgtagacgg actcggggag
    30601 ctccccgtgg aggccgtgcg ccaggaggca ttgcagctgc gagcgggaga gcttctccgc
    30661 gcagaagctc ttcttggcga gggaggctgc cgcgtcgcgg gccttccggg ggtataacaa
    30721 catggcgggc tgtaaaaacg aaacaaaaac acaggactat accatttcaa ttttgcgcac
    30781 tttgcgcgtc ctcgcagagc ttggcgaggg ctccggtcac gacggcgtcc acgaagaggt
    30841 cggcctcggt gaagcggtgg tggcagcgcg tcgagaccag cgcgttctcg gtgaccacaa
    30901 gccccagctg ctgggccgcg accttcgggt cgtagcgacg gcaggcgagc cctgcgccga
    30961 tggactcgtc gatcacgcgc aggatgtcct ccagccgctc ctcgcggtag ttgtagaacc
    31021 acatcaggat gaagtaggcc acgtacgtgt agaggtagtg ggccaccgcg cgggcgcgca
    31081 ccagcggcag gttgcagcgg gccatgcagt tgccgacacg gagcatgtcg tcgtccagcg
    31141 tgcagtagtt gccccagtgc agggtattga actggacgct gtagagcgcg cgcacgatgc
    31201 cgcactccgg gaggtcgatg tcggccgacg agccccaggt gaccaggcgg tagacgatgc
    31261 cgcgctgcag cagcatcagc aggtcgcggc tccggcagcg gatgcggtgc gccagggagg
    31321 cgaaggccat cttccgctgc tcgaagcgca tccccacgac cacggtgttc tcgcactgca
    31381 ccagcaccag cttgtggtcg caggagctct cgctcttcat gccgccctcg cggcgcatca
    31441 tgtccatgac gaacatgcac ttcctggcgc gcggcccgac catgacgcgc gtcttgttgc
    31501 ccaggcgaat caggttgtcg tccaacaggc tcacgccttc gacgcgctcg acctccgggt
    31561 ggatggtggg ctggtagttg tacagcaggc gcggggacca gctgtaggcg aagctgaaga
    31621 tggcggactc cagcatcgag atggggaagg ggccgccctg catggcgcgg gcgaagatcc
    31681 ggagcttgag cgacacgggc atggagctcc ccaccaccgc cccgaagaac atgtggtggt
    31741 tccggaactt gagcgcgtac gcggtgacga cctcctcgcg caggaagatg gactccgtgg
    31801 cgtcggagct gctcgggagg agcacgtcct ccacgctgag cacgcggtcg aggtagggca
    31861 ggaccatgtc caccgtggac gcggagaacc actccatgtc caccgcgtcg cgctccacga
    31921 tcatctccat ggtctccgcc gtgatggtct cggcgaaggc gctttgcagc tccaccaggt
    31981 tctcggtggc ctccacgcgg agccccaggc gcatggactg ctgcaggatg tcgtttatgg
    32041 agttggcgta catggccacg gtgacgcacc cggccgtctg cacgcgccac agccgggcgt
    32101 acgtgtcggg gtccgtgatg cgcagcgtct ccagcacgtt gtacatggcg gcgcgcatgt
    32161 ccagcgtgtc cacgtacacc tcggcgtact cgaagatgat gtccagctcc gagttcgcga
    32221 gcggaagggc caccgagatg ttgcaggcct cgaagaggtc ggaggcgtgc tccgggaagc
    32281 aggcgtacgc gatcacgccc gcgcgctgca cgatgtactc gggcgtgaac tcggccgaga
    32341 ggaagcggaa cagcgagcgg caggccacgt gcgggcgcag ctcgtccagg acggtctcca
    32401 ggaccagccg gtgcttcagc atggagtggt gcaggaactg cgtgaagtcc acgctcgtct
    32461 cgttcatgag gctggggatg atgtccagca gcatccggaa gtttcgcacg ttccgaagcc
    32521 cggagttgag cggggggatc ccgtgcaggt tgtgcacctc caggaggacc tcgtggctca
    32581 gctcccggca cgtcagggca gtgcgggcct ccgacacggt gcactgccgg aagaaatcgc
    32641 gggtcttctc ttcggtgtcg caaagggcga cggcgtacgg gatcttggac aggtcgcaga
    32701 gggggctgct ggcggagagg cgtcggagcg cgtagtccat gaagtgcgca aaggggcgcg
    32761 acacgctgag gctctgcagc tcctccgttc cgtacagaca caggcggaag aggcagtcca
    32821 catccagcat gttggacacg cagtaggcgt gagtgtcgag gtacgggacc atggcgggcg
    32881 tgacatccgt ggtgttctgg agcatggtgc acactaggtc gggagtgacg agttcgggcg
    32941 atacgagggt gacgcaggag ctggagaact tgctaagctc ggaggctagg cggtggaggt
    33001 tgtagtcggt tcgctcgctg aattgcgcgt tgacggttcc cgtgaacccc atgaggaccg
    33061 ccagcggcag gtcatcgcgc tcgatggccc agaggtcgaa cccggacgcc atcaggcatc
    33121 gcaccagcga cgcggcccgc tgccctgtgt ggtggttcat cgtggtaggt gtgaatacgc
    33181 gaattcgcat tggtcaataa tgcttcattt ttatgccccg cgccggacgg gccctcccga
    33241 cggcggggcg cgcctctcag aggagttcgc ggagcgcaga aacgggccca cgcgagtcca
    33301 cgccatccag aggcccgcga gcgtggcgac gagccagacg aagaagacga tcatggtgcg
    33361 ccttttatgt agtctgaact ctgggcgcgc gctactcgtc tccgctcacg acgggcgaca
    33421 gaccctgcac cggctgctcc atgcgcgtca tcggcacggt gagcgcgtcc acgagcttag
    33481 tcacgttcat gcgcgagttc tcaggcacga cgtgcgccag gcgcacgtag acgtcctcgt
    33541 gcattcgctt gttgcagcgg tcgatcgcgg cggagagcgc ggacaccaga gccgtgtact
    33601 tcacgtacgt gaagtcgccg agacagaccg tctcgagccc gagcaccgtc gcggacgccg
    33661 ggtccttcag gcccacgtat atccgatgct cctcgcgcgt catggcgcgc atgaggtagt
    33721 cgtgcagccg cgagcgcgag atgaggccca tggaaatctg agggctgcgc atgaaccgcc
    33781 ggcgcatggc gcagagcagc tcctcgtcca cgcagtacat gctgtccttg agcgagctcc
    33841 gctcgtccag cgagatgagt ccgtcgcgaa gggccgtgtt tatgaagtcg tccacgtggc
    33901 gcgcgtcgat ctcgtagcgc gcgcccgcgc actcgatgca cgaaggcggc gacttcaggc
    33961 gccccgcgag cgccttcacg tccgccacgt cgatgtagag cgaggactcg cgggggacgc
    34021 agcccaggat gcgcgtctcc agcggcgtca ggaggagcac ccgctcggcg ccctccacga
    34081 gcttgccgtc gacggaggag aaaaagttgt tctcgacgat gctggtgacc aggctcgaca
    34141 gcaccccgtc cttgtatgag tccagggaga actcccgcac gaacgcgggg tgcaacaggt
    34201 ccacggggat gcgcagctcc acgcggcgcg ccgcggactt ctttttctgc atgtgccggc
    34261 ggtcgaccat ctcgtcgacg atctcggaaa tgcgcgcgca caggtacgcc ttgaggacgt
    34321 tggcgttaac cttattgaac acgagacgtt cctcctccat ttacctgctc aaacgagctt
    34381 taaatagtgg aaacacagca gcacgaggag cgccgccgcg gcgagccaga ggagcgtggc
    34441 ggtgctccag ggcaggcccg accgcctggc gggcggcttg tcggccatga cgctgcgcac
    34501 cacgttcaga aactcctcga aatcctcgtc ggagttggat aaaaacgagc cgaagacgcc
    34561 cgcgtacagt ttgtccattt actactagat attaaacggg ctttcggcgt cctcctcctc
    34621 gaaggtcgcc gggtccacca cgcccaggcc gcggacctcc tgctcctcgt tgaagacggc
    34681 gggcgtctcg ctcatcttca cgctggtgct ctcgccgtcc aggcccagca cggtcagcgt
    34741 gcactcgcgc ggcatggtca ccttctttag cgcgaaggtg accttggcct cgttgcccgc
    34801 ccggtacagg acgatcggcg acaggatcat ggtcgccatc tgcgcgtcgc gggtggccag
    34861 cgcctctatc tcccgcatga tggggcatat atgcggcggc gcgccatcct ccgacgtgaa
    34921 ctctacgagc gcgccggtca ggcggttgac gtagatgcag ccgtttttga aggtggcgtc
    34981 ggtggacgac tccacgttga aggagcgcag cgagtgcgga acgcgggttc cctccaggat
    35041 gttggtgtag atgccctcca gcagctggta cagcatctgg ctggccgaca cgggctttat
    35101 gcgcgcgaag aagccgctgt cggggccctg gcgctgcatg tcggtcttct tgctggtgtg
    35161 gatcttgaac tcgcccttga gcatgatgag cggcgcgacg agccggctcg cgaggctatc
    35221 gacgagcgtc acgttgatgt tggagcagct cgggtactgc gacggcgtga gcgtgacgga
    35281 ttcgatggcc ctggtctggc tggtcgacag ggagcgcgcg aactccacgg cctcgatgca
    35341 cttcatcgcg cggcaatcga actttttcgg ggcctgggcc gtgttcggtg agtcgtcgga
    35401 cggctggcgg gcggacggtg acttggtggt tccggtgcta gcgcgtttca tatttgcgct
    35461 gattttagag tacgtgtata ttttcagttc ttttgccgga cgccctccag agctgctgca
    35521 tgcagaggaa gtacaggatg atggtgcagg gaatggtggt cagcatcgcg aggaagtcca
    35581 tgacggtcag cacgcgcagg gcgccgcgcg agcggatgcc tagcgaggcg gatccccgcc
    35641 ggagcaccgt ggctccgccc agcaccacga tgacgagcat caggagggtc gcgccgacgg
    35701 cggtcccgag gtcccggttg ttcatcgtat ttataggacg gtatatagcg atcgcgtgac
    35761 gaagtcccgg ctggcaagca cgcggccgtc gggcgggctc cccccggcct tgccgcggaa
    35821 ctcggggacg tcgaaggtgg acctcgtgat gcggtacgtg tacttcccgc gccagacgag
    35881 gttctccttc tggaagacgc cctccatggt ggtccccgcc atgaacccgt ccttgacgat
    35941 gaccagcacg gcgtccagct tccgcccgtc cacgtgcgtg acgaagtccg tgccgttgcg
    36001 gctcgcgcag cggatgtcga cgccggaggg caggtcgatc acgaacacga agcgcttggg
    36061 gacgtagagc gcgaggtccg acgagggcga ggcccccggg gccgagggga actggcggtg
    36121 gtcgaagtgg tgcaccacgc cgacgatgga ggtcacgcgg tcgtcgggga aggccgccac
    36181 ggacccgccg ccgcggtgcc tggtcacggt ggaccggccc acgtcgtcgc agaccacgtg
    36241 catctccgag accacgggca tgagcgtggc cagcatgcgg tccgtctccg tcttcgaggc
    36301 acactggtac gcgatgccgc actgcgcgtc ctgcgttcgc ccgaagaaca gcaccagcag
    36361 gctcgcctcc tgatcgaagg gacacaccgc catcacgccc acgggcggcg gcccctggct
    36421 ggagtacgcc gacgagaact cctgcacctc caccacggag tcctcgcgcg cctcacccgg
    36481 ctgcagctgc gcgggcggac gcacggtctt caccacctgc cgcacggcct tggccgcggc
    36541 cgcggcgctc ggcgcgacga tcctgaacgc cgcgggcgtc cccggcggct gggcggcgcc
    36601 ggcgagccac cccaccggcg agaagaagac gtccaccacg tgcacgcccg cggcctggag
    36661 cgcgcgcgcg accgagcgca gcgactccca ctcgtcccgg aaggtgccgg cgatggccag
    36721 cgacttcagc acggcgtcca cggagttcag gggcttgtgg aagaggttct cgttgttgta
    36781 gaagaagccc ggcatctcca cgggcacggt gtgcacgcgg acctcgtgcg acccgctggg
    36841 cgtcagccgc gtcgccggtt tcctgattcc ggaggctatc tgctttacga agtggttcat
    36901 tcggctggcg gttctggctc cggcggcagg agggtattta ttcgttcggt tatcctttcc
    36961 gctagcaccc gcgcggactt tcgcgtccag cgctccatct tcatgtactc cttcatgccg
    37021 tcgctcatga tctccgcggt ctccagccgc ggggacgtgg ggtcgaagag gatgctcttg
    37081 agcagtgtca tcttcttgtc cgcgagaaat cggaagtagg tgtagatgca ccgcagcgtg
    37141 cggaagttgt cggggggcct gatggtgcac aggatcatga agatgcaggt gaacatgccg
    37201 cactcggact ccatgagctg gttgacctcc aggtttatgc acccgcggcg cgccttgaag
    37261 gagtccacga agaagcgcat gagcacgtcc acgtcgcagt tgcggttgtc caggtccgcg
    37321 gaccccgagt tcacgttgaa gccgtccgag aaggagtaga agtagaagta cttgcacggg
    37381 tggaactccg cggggctgtt tccgccggag tcgtagaagg agaccaggcg cgacaccgtg
    37441 tcgaagatgc agcacttcca gtggaacatg tagcagaacc cgaacatgac gtaccgcgtc
    37501 tccgcgcgct cgatcttgtc cttgagcgtg aggtgcagca tgttgctgcg gaagcgctcg
    37561 gacttctcgt ggatggcggc gccgttgagg aagttgaggt tgaactggcc caggtaggtg
    37621 acctcgctcc ggaacgcgaa gggcgcgacc aggttctgga tgctcacgtt gctcatccag
    37681 gcgccgcggt cgggcttcac cgcgatgggc accaccttgc tgttcacgcc cgtgtggacg
    37741 cccgcgcgcg tgaggtcgtc cacctgcagc ggcatctgcg agaagtcgac ggcggcggag
    37801 accttctcgc gcagcgaggg cttgaagaag tacatgagcg gcacggtcca ctccagcgtc
    37861 acggcctcgc ggaagctgaa cttgcgcttg aggttctcca ggagcacggt cttctgcgcc
    37921 acctcgtcct ccgccgcctg ctcgggcgcg accgggtcga tcagcccccg cttcgcgaag
    37981 tccagcagcg ccgccagcgg gaggcaggtc accttcccgg cgctggccga cgtgtcgaag
    38041 cgcttgacca cgtacccgtt gcagttcgtc ttgaagttgg acacgtccag gtacgcgctc
    38101 agccccacca ccgagtagat gtggcacagc aggttggtga atcccatctc cgggattttg
    38161 ctcaccacta aatccgtgta cctgtccatt tatcatggag aatcctctgc cggaaatgct
    38221 gctgtttccc aactgcgtca ccgtgtttcc ctttgagtac gcactcgagg acgtgctccg
    38281 gctgcctgac gagacgcggc gcgcgttcgc gctcgcggcg ttcccgctcg tcaagcaccg
    38341 gtggaggggc gcgcgcgtcg agcgcaacga ccgacgcgtc tggctggacg tggagcgcga
    38401 ggcgcgcgcg gccgccgtcg ccgcgagcac gagcgccctg ctagacgatg cgatggacag
    38461 gctggtggac gaccaggggc gcgtcatcac gcccgaggcg tacgccttca tgcggtgcgc
    38521 gccgggcgcg cgcgtcgccg agctggccga cgacgtcgcc gcgatcgcgg ggatcgtgca
    38581 cggcgggaac gcgctccgga tcttctcatc ggactccgtg cacgccaagg aggcgtggcg
    38641 cgagcgcagc gtgggcgtgc tggggaaccc ggagcccctg gagcccgtgc ccctggcatc
    38701 gctcaaaccc gacgtgcagc agacgctgtt cgccgcctgg tgtcggcggc ggcccgtcgt
    38761 cctgacgggg gacaccggcg tcggcaagac ctcgcaggtg cccaagctcc tgctctggtt
    38821 caactacctc ttcggtggct tcgaccgact ggacgcgatc cacgagttct ccgaacggcc
    38881 ggtagtgcta tcgctgcccc gcgtgacgct cgtgcgggcg cacaccgcga cctacctgcg
    38941 gtcgctgggc ttcgtcggca tcgacggctc cccggtgtcg cagcgccacg gcgcgctaac
    39001 cgacgacgag cgcaacagcg cgccgcgcgc ctacggactc gtcatgtcca cccaccggct
    39061 gaccctgaac gccatccggc gcttcgacac cgttgtcgtg gacgagatcc acgagcacga
    39121 ccagatgggc gacatcgtgg tcgccgtggc gcggaagctc gcgggcagcg tgcgctcgct
    39181 cgtgcttatg acggcgacgc tggaggacga ccgcgagcgc ctcgaggagt tcctcgacga
    39241 tcccgccttc gtgcacatcg gcgggggcac gctcttcgca atccgcgagg tgtacgtgaa
    39301 gaacgcgcag cagccgccgc tgtcgcgcaa gtacgcggag gaggaactgc ggaacgtcac
    39361 ggaggccctc gggaccttcg tgcccgacca ggggaagtgc ggcatcctct tcgtcgccac
    39421 cgtggcgcag tgcgccttgt tcgcggagaa catatccgct aaacacccgg gcctgctggt
    39481 gcgcatcgtc cacggtaaga tcccctcagt ggcggacgtg ctcgccgagg tctacgccgc
    39541 cgatcgaccg gcggtgctgg tgtccacgcc ctacctggag tccagcgtca ccgtcaagaa
    39601 cgccacgcac gtctacgaca ccggccgcgt gttcgtgccc gagcccttcg gcgggcggga
    39661 gcggatcgtc tcgcgggcca tgtacacgca gcggcgcggc cgcgtggggc gcgtggcccc
    39721 gggcacgtac gtgcgcttct tcgacacgcg gctggccgcg cccatcaagc gcatcgactc
    39781 ggagttcctg cacccgtacg tgctgtacgc gcgcgtcttc gacctgaaac tccccgacga
    39841 cctgctagtg cggccgagcg acccggagct gctccgccgc acggaggagt acgtcgacgg
    39901 cttcggcatc agcgtctgcc gctggacgga gctgctgaac agacactaca tgcacatgct
    39961 cgagtacgcg aaggtgtacg tgcgcggcgg gcgcctcgcg cgggcgctcg acgcattcga
    40021 gcgcgacggc gtgatgacgc aggaggccac ggaggccatc cgcgcggtgg agatgctagc
    40081 gggcgtcgtc gcggtgcgcc gaaccgggga ccggtaccgc gcggagtgca aggtgctgtt
    40141 cggacccttc gtcggcaagc ggttctccgt cgtggggagg cgccgccccg ggaaatacgt
    40201 gctcatggtc accgaccgcg tgttcatcga gtcggaggtc ccatcctgag caccaccttc
    40261 ttcgtcagcg cggagaagtc gtcggccgcg ccgcgccgcg ccaccacgag acagtaggac
    40321 gtcacaccgg ggcatttgga aatgcaccgg aacgtctcct cgggggacag cgagaacgcg
    40381 aacacgtaga aggtgcacgg ggacttgagg ggcgtgtggt ctagcgagta gatgatgccc
    40441 agccgcttca tccgccacat gagctcgtgc aggcgctcct tccggagcgc acggcccttg
    40501 acgacgccgc agacgaaact ggagcacgcg accacgtcgt agcgcgtccg gcgatcgaag
    40561 acgaggtgcg gcatgcagcc gccgcggcgc gcggtggtgc ggttctcgag gatgtcctcc
    40621 atggaccgct cgctggcgaa gaagtccagg aacatgtact ggtacgccgc ggccggccgc
    40681 gacttgctga acttcatgaa gacctcggat tccatgatcg cgtccatgtc ctcggcggag
    40741 agccggtgct ggaaccggat tccctcgtgg gtgcgccgga ctcgcgtctc tgggtgcacg
    40801 gccgtcgcca gtgttacgaa cctgagcagg tccgcgtctc cgaggcgcac caccacgttc
    40861 ccgccggcgg gcgtcttccg catgagccgc acgggacacg cgtcgccgtg cccccggtgc
    40921 agagggcggc cgtcctggtc ctgatgcagg tcgagcatca tcacccggtg gcgctgcgcg
    40981 tcctgcgcgt tgaagatcga ggacgtgaag cccgggtaca gcgccacgca gtcccgctct
    41041 gccacggcgg ccaggatgtc ccgcttgagg cccgccacca gccgctccgc gttgtcgcgg
    41101 aagtagtcct cgtagtccag gaggtcgtgc gacatccacg ggaagttgag gtacgcgttc
    41161 atagcgtggt cgtctgagtc cacggcgaga cgcgcgtccg ggaccgtctc caggggcagg
    41221 tccttgatgc cgcggaggag cccgtcgtag tccgtctcgt ccacgaagga gagcaccacg
    41281 tacaggtcct cgcccatggt ctcgtagtcg aagaggtggt acgtctcgcg cagcgccatc
    41341 acggccagcg cgttgtccag cgtggcgtcc acgcgcacca gcacgctgta gaacggcgtc
    41401 gccatcatca cggccttgcc gccgacgccg gcaaccgcgc gcgggcagat gacgtccggc
    41461 gtccgcggga gcgtgccgaa cgtcgcgttg agcagctcca ccgcgggagc gctgatctgt
    41521 cgcagaaaca cgacgatgga ggggcccgcg atggagcgca tccgcgcggc catccgctcg
    41581 cggatgtcgg tcgcggccac gaggtcgtcg aaccgcccgc cgttgtagag gtcgccgccg
    41641 cccaggaagg tgagcacgtc gaagcagtgc agcacctcgt tccggaagta gtactcgttc
    41701 tccagctcct tggcgaaggc gcggacgtcc acgtcgtcga agcacgtccg gagccggccg
    41761 tcctcgaaga accaggaggc gagctcgcgc accgcgtcca tggggcggcc gcgcaggctc
    41821 ttgcaccaga agctcatgaa gttgcgcgcc gtcgaggcgt tcgccaggaa ccggcggtgg
    41881 tcgaaggaga tgagcacgtg ctcgagcagg tgcgcgagcc ccagcacgtc cccgacgtcg
    41941 cgtccaaaac cgaagtttga tatccccagg tagatgtccc gtttcatgga cggcctcagg
    42001 aacaccctga caccgtttcc cagcacgatc atcccgagtt tcgtatttac ttactcagaa
    42061 gtagtatagg gattagtgtt tgaacgtccc cgcgcctttt taaatcaaat acggacttgt
    42121 ccctaccgtg cgccacggtc acgcgctcgt tccgggagtc catcgagacg aggacggcgc
    42181 tggcccgcgg cgcgtccggg gtctggaaga gcaccgactc ggacaccgcg tccagctgcg
    42241 cgtccagccg ctgccggtac agccggtcgt ccgcgagttc gcgcacggcc agctgcatct
    42301 tgtttgtggg gagcacgttg agcgcgtaca tcagagccag gaagcccacg aagagcgcga
    42361 cctcaagcac ggcccatgtc atttagggag cttattttgt tccacgcggc gacgcacgtc
    42421 gtgaccggcg acccggaggc gccgcggcgc gcggcctcgc tgtgcgccgg cttcggcgtg
    42481 agcttccggg ccgagtacgg ggagttcgcg aagcggtacc cgcgcaccgc cgccgccgtg
    42541 gagcgcgcgg aactgctccc ggagacggac atggtgttcc cgccggacgc gctgcgggcg
    42601 ctggtgcggc tgcggctgga ggccgcgggg ctctccgtga aggcgtcgcg gctgctagcg
    42661 cccgccatgt gcggcaccgc ggtggtcgac ggctgctccg tgcgtgtctg tggcgcgaac
    42721 gacgcgctcc tggacttcct cgccaagcga tacgaccccg aggtgtaccg gtacgtggcc
    42781 acggccgcgc cgagcgtgcg gtgcgggtcc cgcgcgttcg tgtgctcggg cggcagcgtg
    42841 accttcgtgg cggcgcacga gagccggata acggccaacc gcccgctgcg cgtggtggtg
    42901 acggacgcct gcgtgacgaa ggtgctggag cggggcgccg ccgaggtctt cgagcgcggc
    42961 tccggcgtgc tgctccgcgc gctcagggac atgttctacc gcctcaggga ggacgaggac
    43021 ggcgcggcga cgggccagac gttgaacttg gcggagagga tggcctcgcg cagctgatcc
    43081 aggtccacct ttttctcgtc tatctgcgcc acgaccacga actgtcggat gtccaccgcg
    43141 gccatcgcct ttaaagcggc gtcgtacttt aaaaggagga cgtactcgtt gccgaagtac
    43201 tcggtgatct ccgtgatcag ccggtacacg cccatcccga gcacggtcac cgcgccgtcc
    43261 ttcgcgaaga gggagaggat attcacgcgc ttcaggtcga actcgctctc gagcgccgcc
    43321 agcatccggc tggtaacctc gcatactgaa caaagaggct tacctagtaa gataagcgtt
    43381 ggctttgcac ccactgccgc gtcggtcgcc atttatgggt atcaaaaact taaaggctct
    43441 acttatgagc caggggtcgc tgaaaccgta cgagcccgcg gacggcgagc ggcaccccgc
    43501 ggtgttcgtg gacgggttca gcgtcctgat gacgatggcg tactcgtgca tggacgagga
    43561 cgagttccgc agctccgtgg aggagcgcat ccagcactgg acgcgggtct ccgccacaga
    43621 gaagctggtc gtcttcctgg accgcgggga catccccatc aagcagccgc tccgagatca
    43681 gcgccgccgc gcgatcaagg aacgggtgaa caggcaccgg gaaatcgtgg cccgggcgga
    43741 cgccgacgac ggaccggccg acgacggcga cttcgccgag gagatccgca ccgagaagca
    43801 gctgaagctg cagcgcatcc ggttccagct cagcatcgcc aaccacgacg tggtgcggtc
    43861 gctcatcacc tccacgctgc agcgggccgg cggcgcggtg gagatcgtgt actgcgacgg
    43921 cgtggacgcg gagatggtga tgtgcacgcg cggccgggaa gaggccgcgc gtaacggccg
    43981 ctggccgctg ctcgtgacca cggaccagga cgcactgctg tttacctcca ccgaccgcat
    44041 ggagaagttc gtgagcacgg tgtccgcgtg ctaccggtac ctgcccacgg acgagacaga
    44101 gtacctctgc aagctggcgg cgctgacaaa cggatgcgac ttcttccccg gcctggcagg
    44161 gatcagcgtc ggcgtcgagt ccgtgcggcg gatgacgctg ttccgagagt tcaacgcgcg
    44221 gaacgtggcg atgagtctct gcacgcgcgc aatgcgtctg gccgccgcgg agcgggcgag
    44281 cgccgaggcc gtcgcggaca tgatttcgtt catcgaccgc tacgcgcgcg gcgacgaggg
    44341 catttacggc gccgctcccc cgagcgcgtg ctgcggccgc gcctttatcc gcgcggccct
    44401 ctgtgaggag tggggcgacg ccccgccgcc caccgggatg gggcctgtgg cggacatgat
    44461 cgtgggtctg ccggagcgcc gggagccgcc gccggaggac gtcgagcgcc tcgccgagct
    44521 ggaggccagt tcgaggcgcg gccgcgtcac cgacgcgcaa ctcgcgctcg cggcggagct
    44581 cctcggctac cgcgtggcgg agggcgacag tgacgacgcg gccgccgcga tcggcgtctc
    44641 cgccaagggc gtgttccggc gcctgggagc ctctcgagtg ttcttcaacc ccgagcacgt
    44701 ggaaattgaa agcgaatcca gactcctaaa actgctgtga tggtgtttcc ggtggtgtgc
    44761 tcgacgtgcg gccgggacct ctccaacgag cgcttccgcc tcatcatcag acaggagcgg
    44821 ctgaaggtgg ttttgcgcga cgtgcgcaac atctgctgcc gcataaagtt ggccacccaa
    44881 atagagccgc acaggaacct aactgtgacg cccatgctgg acataagcta gtttttatag
    44941 gaatggaggc acggatgctg cgggagatcg tggacacgtg tccgcgcgga tcgctcatct
    45001 tcgtgtccag cgccgcgtcg atgaccgact gcttcaaccc ctcgaagtac aagcacgcgg
    45061 ccatctacgt ggggagcgtg gactgccgca cgatgctccg caagctgggc gccggccggc
    45121 cggagatccg tgccgacgtg ccctacgtaa tagacgcctc ggcgccacac ggggctcgcc
    45181 tcacgccgct cgaggatctg ctgcggaact gcgtcgtggt caaggcgtac cggctggccg
    45241 tgcccggggc gctgtcgctc atgagtctcg cggcggacgc ggccttcgag ctcgtcggga
    45301 cgccgtacgg gttcaaccac ggccgcacct actgcttcaa gctcgtcgca gactgtttcg
    45361 ccagcgtcgg ggtgcccacc aagaccaggc ggatcatggg gcgcgaggtg gtgctcagcc
    45421 aggacttcct ggaggacggc gcgtggacga agatcctgga ctcaaccgag gatctggacg
    45481 tccccgtctc tagccgaacg gcgttgtctt tgtccccgtg atgggcaggc tctgcagccg
    45541 cttctggtac gcgcggacct gcgcctccgg gtcctcggcg tcgggagccg gtgctggagt
    45601 cggcgccgcc gtggtggtct tgaacggaca ggtgttcacg gctattcgga tcttctcgcc
    45661 cgacgaccgc tgggatatgc agttcgccag cagcttcatg atgtggaggt actccaggag
    45721 cacgaacctc tgcagggtca ctccatcaaa ggggctctga ccaaccgcac cgagcgggct
    45781 ggtgacggcg ccgtctagca cggccccgcg ttcgtaccgc gcggcgctgt ccatgacggc
    45841 agacagcttg gcgagcgcgg agttctgctc ctcgacggcg tgttccgcga ccggcgcgtc
    45901 cgcgggaagc tcctcgatct tcagccccgc catgtactcg gactgcgcgt gggacgtggg
    45961 cgtccccctt tggaccagga agtcgcagag cctggagagc gcgccggagc gcacgggcat
    46021 ttccaggagc cgctccgcct ccatctcggc catgtcctcc gcggcgcccg ccggcgcgcc
    46081 ggcacgcacg acgtcttcgc agcagcccgc ctcctcgagg aggccgggga tgagcttgta
    46141 ctgggccagg tttatgagcc cgtacttgag ctccagcagg tccgcgagct ccgacgccat
    46201 ggggcggttc ttccggaaga cgacccgctc cacggcgtcc accatgtcca cggcctgcat
    46261 gagctcgccg acgagcacgt acgcgatcag cgtggcgagc gtgacctgga tggtgggccg
    46321 gcacaccatg aagaaggagt tgcagtgtgt gaaccgcagc agcgccccgt gcaggcgcag
    46381 gaggtccggg ctgccgccgg cgtgcacgaa gcgccggcgc aggcgcgcca gcgcgtcagc
    46441 caggtcctgc cgcgaggtca cccgggtgtt ggcgatgcac cggtcgtgga tgatgttcgc
    46501 gatctgcgcg cggcgcgccg gcgagctccc gggcagcagc cgcgccttgg cctctatgtc
    46561 cgcggtgtcc gtcaggcacc ccgcagtggc cccggtgacg atgaacctca gaagcgagtc
    46621 gaatatgcgt ccccccgcgc gggaggccgc gtttgacgcc tccatttaac tttaaataat
    46681 ttacgagatc aaaataaaat ggctctccgc ataaaactcg agaagctcaa gcagatcgtc
    46741 acctacttct cggagttcag cgaggaggtc tccgtgaacg tcgatgtggc ggacgggctc
    46801 atgtacatct tcgctgcgct cggcggctcg gttaacatct ggacgatcat cccgctgagc
    46861 gcgagcgtcg tctacgacgg cgaggtgagc cgcgtgttca acgtcccggt gctcaaggtg
    46921 aagtcgtgtc tgtgcagctt ccaccccgac tcggtggtgt gtctggagcc cgacctcgag
    46981 gacaacgtca tccggctctc cagccaccac gtggtcagcg tggactgcga gaacgagccg
    47041 atcgcgcacc gcacgaacac ctccatctgc ctgggcatca accagcgcaa gtcctacgtg
    47101 ttcaacttcc ggcgctacga ggagaagtgc tgcggccgca ccatcgttaa cctggacctg
    47161 ctgctcgggt tcatcaagtg catccaccag taccagtaca tcacggtgtg cttccgcgac
    47221 aagaagatgg tgctgcacac gcccgggaag gtggacaact acttccgcga gtactcgatg
    47281 acagagtggg cccccgacct ggagcgcttc tccttcaaga tccccatctc ctccatcaac
    47341 aagctccgcg gcttcaagaa gcgcgtggtc atgttcgagg cgcgcgtggt catggacgcc
    47401 gacgacaaca tcatcggcat gctcttcacc gaccgcgtgg gcgtgtaccg agtcaacgtg
    47461 tttatgtcct tccaggaccg gtgtctttcg tgcgactaaa tcgaccgacc atgggcgggt
    47521 ccgtgtcgct gccgtcgcgg gacctgccgc cgcccgtgcg gacgccggag atggccatcg
    47581 tgccggagcg ggacctcgtg ggcctgatgc cgcgactgac caccgccgac gagccgcagc
    47641 cgctgggcgt gggcgacgcc gcgcgcgcgg ccgcgctgaa agccacgttc ccggagttcg
    47701 ctgtgacgag cccggcgccc ggcatgctgg cgggcgtccg cgtgcggtac gacggcgacc
    47761 ccacagtgtg ctgcgggggc ttcggaatct cgcactactg ggagaagggc gcccgccgcg
    47821 ccaacgcgta cttcgagggc ggggtgctgc gcacgtgcga cccctcgcgc ttcgacgccg
    47881 gcctctgcga cgaccgtctc ttccgcgagt gcacgtcggg cgcggcggac gcagacttct
    47941 gcgcgcagtg gataaacgcg gccgtcacca aacgcaccga ccggcgaagc gtggagcgac
    48001 tgaacgccat gttcgcgcgc gagtgcggcg cggacgcgtc caggccgcac tgcgtggcct
    48061 ggatccgcgc gctgcggagc acgaacacgg cggcgaacga cgcgcggata gacgccgtgc
    48121 tctccgtgca gagcccggag ttcaagcgcg cgcgcatgcg ctgcagctac ccctcccccg
    48181 ccacgctgga gatggcctcg tacgtggacg agccccgcga gtgctgggac ccggagtgcg
    48241 tctccgggga cgtggacttc atgctcagcg acaactacac caacctgggg ctctgtcgca
    48301 tctccaggtg ctccatcggc gtgacgcacc tgcggctgga cccgcggtcg cgcctccgca
    48361 tgcggtgcgc gggcgcgctg acgggcatga gccgggcgcc ggtgaaccag gccgcggtgg
    48421 tggacgagaa cgtcagccgc gccttcgagc cgcgcacgga gacgctcggc gtactggcgc
    48481 tgtgcgtggt gtatctgcta attgtatggc tctaaatggg ggccgcggcg agcatacaga
    48541 ccactgtcac gaccatcaac gagcggatac gcaatgagct gcagcagacc gcgtccgcgt
    48601 ccgcgacggc ggactgcgac gtcacgatag gcagtctgat catccgcaag aacctgggat
    48661 gcagcgtgtc tgtgcagaac atgtgctcgg cggacgccag cgcgcagctg gacgccgtga
    48721 tgaaggccgt gagcagcacc ttcaacgacc tctcggcaga ccagaaggcg tacgtgccgg
    48781 ggcttctcac cgccgcgctc aacatccaga cgacggtgac caccgcggtc aaggacttcg
    48841 agaactacgt gcgacaaacc tgcacggccg actcggtgat ccacaacaag atcaaggtcc
    48901 agagcatcgt catggacgag tgcgcgtccc cgcccggcgg ccagaccacg cacctggagt
    48961 tcataaacac gggcaccgcg tccggcaact gcggcgtgaa ggcggtgatg gacgtgctgg
    49021 ccaaggcgag caccaccgtc aaggaccagc aggtcgccgg caaggggtac cagaccatca
    49081 tcatcgcggt ggtcgtcgcc atcctggccg ccgtcttcgc ctggtacgcc aggcggatgc
    49141 tgtttacgtc caccaccgac aagatcaagc tcgagctcgc caagaagccc gtggtgcact
    49201 ggaccacgta cctggacacc ttctttactg aatttccgcc gtccgtatag atgaccggca
    49261 aacattgaaa cattacacag gtactttgac gcgccgacat gcttaggcag ctagtcctcg
    49321 agcgcgtgaa cggcatcggc gaacgcgccc gggcggaccg gcgatacctg gaggccatcc
    49381 agcgacacgc ggagggcaac tcgatgcttc tgcggcgcgt gcggcggcta ctgttcgacc
    49441 tcgtgctcac ggtcttcgtg atcatgtaca tcgtgcttcg gatggtgctc cgaaacgcgg
    49501 ccgcgtgcgc gatgctggcg ttgctggccg ccatcatcta cctgtttttg tgtctggtgt
    49561 acttctagct acaagcacac catcgcgcgc gcgcgggaga ccagctccgg cgccgggaac
    49621 acgtcgtgta cggggaagtc gtccacctcg aacacggccc cgtccgacga ccagatcacg
    49681 cggacgttgt cgctgatgga gacctccgtg agcgtgacgc ccagcaccac ggcgtcgctc
    49741 gtggtcaccc acaccagcgc cccgggctcg gcgcgccggt tgagcgggac gccggacacg
    49801 gtgcgccggt gcgtgcggaa catgtccacg aagtgcttgg agagcaggtc caggtggttc
    49861 cggatgatcc actcgaagaa gtacgagcag ctgtcgcacg cgaaccggga cgccggcggc
    49921 atcagcagcc gcacgatgtc catgtagcag ctctggggca ggctggctcg gtacaggcgc
    49981 gagcgcgggg acagcacgac caggctggag gtgttcacct ggaacacgag ctggctcacg
    50041 gagaaggtga tggtgcacga cggaacggtg accacgtcga cgcacacgtc gtccaggaag
    50101 atgccgcgct ggaacaggtg gtacatgatg gccacgatct ggaagaccac ggcgtcgctg
    50161 atggaacacg ggcgctcgct ggcgcgcatc tgcgcggtgg acagactccc gaacgactcg
    50221 aaacagacgg cgaccgcgcc cgtgtccgcg ctctgcggcg cgcgtctgca cacggggaac
    50281 cccacagctt tccggcagcg caccatggcg gacagctcga tccagcaccc cgcctcctcg
    50341 tccgccatgg agaccaccac cggcgtgaac gccgtgacgt tgtcgcaaat ccgcttctcc
    50401 aagaacccca cgccggcgga gacgggcccg ggcacgggcg cctggcgcgg gggcgcgccg
    50461 cgcgtcggtg acggagcggc gggcgcttcc gcccgggatt cgggcggcgc gtgttgtcct
    50521 ggcgcgcccg acgggtggcg ggtctcggtc ttcgcgaacg tgaccgtctt cctagaaggg
    50581 tgtacgtagg gctctgtgga cccggtaggg ttcttgaact tcttgccgcg cctgaaggcc
    50641 tgtcgcgacg cgccgaagcg gcggaagccc cctccccccg ggtccctttt ttcctccatg
    50701 atatttatca caaaaaaaac ttctctaaat ggccagtctc ctttcgttgg tggacgcgga
    50761 ccccctgttt tgcgcgggac tgccgtcccg cgacgagacg atgctcgtga tcgcgggcgc
    50821 acgcgtgcgg ttcccgcggt ccctgctctc gctgttccac gtggtgcccc gcaccatgac
    50881 gcggtacgag accgagcttg tcggcaccga gatgctcgtg ggcgccatct tcagcaccgc
    50941 ctacaacgtg cgccggaacc tggggctggg agaggaaccg gtgaccatgc gcgacctgga
    51001 gaggtacttc ctggactcgg agaacgaggt cctgacgctg gtggtgaata acacagactt
    51061 ctccaacctg tctggcgtga agaagcgcgg gcgccgcatc cccaaccccg tgatcttccg
    51121 cagcggctcc atccccatcc tcatggtcct ggagtcgcgc aagaaggtga acatctaccg
    51181 cgagcgcacc gacgagcagg cgaactcgtc gtacaaggag gtggggtcca acctggccat
    51241 cgtcacccgc tacgccggac tgcagctggt ggacgtgcac acgcccagca gcatgctgac
    51301 ggtgtccgcc gtgtacggcg tcaccgagga taaggcgctg aagaagatag gcaacgacaa
    51361 ggagctggcc gactaccagt ccacgccgct ctccgacccc atacgcctgt cagacttcac
    51421 caagctgttc gacggcgtga agaagagcat acagctgacc aacgtgcccg ttcccgccgc
    51481 cgcggataca gtctcctagg ccttttacga gcgataaatc gccggcgcga tggcgactga
    51541 taaggcggct cccgtcgtca acctcacgcc ggtgttcgtg gagcccacca tcgcacactc
    51601 gctgctccgc tcggagccct acctgactct ggtggtcttg gagctgcttc tcgcgctggc
    51661 gctgacgtac ctcttcttcg gcgacgagct gcggtcggcg ctccgcggtc gccagcgccc
    51721 gccgtcgccc ctggacgcct acggcgaggc cagtctggcc tgcgacggcg acgcgctgat
    51781 gatcgagctg cctggcggca ggctgcccgc cctggcgctg gacggccgcc ccgtggcgtt
    51841 ccccgggtgc gacggcgttt tgcgccgcat aaatggaaca cgaaaggtac gtcttgtcga
    51901 tgttcttgga agaggatgac tcgttcttct cgttcgtcgc ggggctcccc gacgacgagg
    51961 ccctcggcgc cgtgcagtcg gcggccacgc tcctggactt cctgttggcg gtggtgctgc
    52021 ggggcaagga gaagctggcg gcggcggggc accactacga cgccgtgacg gacggccgcg
    52081 cgcgcgcggt catggagttc cgggacctgc gggagctggt tcggctcttc gaccgccggc
    52141 cgtgcgcgcc cggcggccgc gtgcaggtgc gcgacgggcc ggccatggcc ttcgtggacg
    52201 cgtgtcgcgc gctcatgcgc cagcgcggct tcgacggcgc gcagacggcc gaccgcgtcc
    52261 gctacatcac gccccgggac gtggccgcgc tcgacgccat ttccgcgacg ctgtcgccca
    52321 acatataacg taaaaaatat taataaattt caacagacca gactcccgga tagccggggg
    52381 tgaatcgccg cggatcacaa acccgtcgct taaatggagg gggtggagat ggaaaaaccg
    52441 ctcctgtact tcgacgagct caccggcgag cgcgacttcg acgccgcctt cgccgaggcc
    52501 aacgagccag cgaagctccc ggcgcagggc cagctgaagc tgctcgtcgg cgagctggtg
    52561 ttcctgaacc ggctgtaccg gcacggcatg ctggacggga gcgtcatcgt gtacatcggc
    52621 tcggcccccg ggacccacat ctgctgcctg cactcgcact tccaggagct cggggtctcg
    52681 ctgaagtgga tcctcgtcga cgggcgcaag cacgacgcct gcctgatggg gctgcggaac
    52741 gtgaccaccg tcacgcgctt cgcggacgag gcctacctgc gcgagctgcg cgccgagctg
    52801 aagcgcgcga aggtggtgct catctccgat atccggtcca accgcgtgaa cacggagccc
    52861 accacggcgg acctgctgcg cgactacgcg ctccagaacg tgatggtgag cgtgctgaag
    52921 cccatcgcct ccagcctgaa gtggcggtgc ccgttccccg actcctggga gaaggacttc
    52981 tacgtgccct gcggcaagga gatgctccag cccttcgcgc cgccgttctc cgcggagatg
    53041 cggttgttga gcgtgtacgc ggacacgccc gcccggctgc ggctcgtgac gctgagcgac
    53101 gcggtgaagt atgaaaaaag gatgttctac ctcaatagcg tcgtgcgccg cagggtaatt
    53161 ttgaactttg actatcccaa ccaggagtac gacttctttc atatgttcta cctgctgtcg
    53221 agcgtcgtgt gctccaagga atttaaatcg gccaaggaca aggtgctgag cctgcagcag
    53281 ggcttcttca ggttcctgcg catccccgcc atctccacgc ccggacttcg cgcgcccgac
    53341 gatgaaccgg cacaacgtgc ggtacctggc aaaaattctc tgcctaaagg ccgaggtaaa
    53401 aaacgatccg ttcgcgacca taagtaggga cacggtgaag cggtacgaca tagacgtgga
    53461 gtacggggac ctggtgagcg tggtgacggt gacgcacaag atcgagagct cccgcacggt
    53521 cttccaggtc ttcaacgaga cgtccgtgac gtactccccg cttcccgacg actacgggga
    53581 acccatagtg cttaccacct acatgcagcg cgagcacacg cgcttccccg tgtttatgct
    53641 gtacatcgat gtactggcat ccgacatgtt ccccgtcttc aagcgcccca ccgaggagga
    53701 gtgcgccgtg atcgccgcga tgcagcgcgt cggcggccgc aaggaggccg cgctgaagct
    53761 gccgcgcatg ctggacacgg agctcgtgta caagatcctc ttccgcccgg agatgcagct
    53821 gcgcgtcgtg cggttcctgc ggcgcaacat gttcaccggc gtggagatcg cggaccggtc
    53881 tgtgtccgtg gtcctcgact gacgagcgcg ggcacgacca gcgacgccac cgcgagcaga
    53941 cacagcggca gccacacgac cgggtccgcg accggcgcga acgcgtgctg gttcaggtat
    54001 cgcgcctgga accgctccgc ggtggcgtct agcttggacc cgcacgcgtt tgtgagccgg
    54061 atcaccgcgt cgcgcacgcg cacgtcgccc atcgatatca cgcagtcgga gacgttgcac
    54121 ccggctatgt ttttcttcag cgcccgcggc aggagcgcgt ccgcgcgccg gcacggcccg
    54181 taccagcagt agtacgggag ccgcgtgtcg cgcccggtgt ccacgaccgc ctggctcggc
    54241 ttcaggcacg cgcaccggac gtcgtccggg ttcgcgtcgc agaaggcgta gatctcctcg
    54301 tccggcgcgt ccgggccggg tgcggcgctt agcgccgcgc ggcgacgaaa aaacatgctt
    54361 tgtgaaaaat tactccgacc aagaacgagc gcccggatct tatttcaaag ataaaaatac
    54421 tattaatacg tcatatattt gcgccatgtc gatcgtgcat cgcgtgtcct acagcctcta
    54481 ctcgcagagc gagatcagcg ccacggatgt ggtcatcagc cagatgaaga acgaggacga
    54541 cctcggcacc gtgaaggacc cgcgcctggg ggcctccgac gggtccatat gccgcacgtg
    54601 cgggctcacg gagatggagt gcttcgggca ctggggcaag acgcgcatct acgagtcgta
    54661 catcgtgcga cccgagtaca tctccgaggt gatgcggctg ctcaaccacc tctgcatccg
    54721 ctgcgggctc ctgcgctcgc gcgaccccta caccacggac gtgacaacgc tgagcgtgca
    54781 cgagatgcgg aagatgaagg accgcatgat gtccaagaag aaggcgtgct ggaacagcaa
    54841 gtgcctgcag ccgtaccaga agatcgtctt ctccaagaag aagatctgct tcgtgaacaa
    54901 gatcgacgag atccccgtgc cgaacgcgct catctaccag aagctgacgt ccatccaccg
    54961 caagttctgg ccgctcctgg aggtgtacca ggaccccgcc aacctcttct accgcgagta
    55021 catcccgatc ccgccgctgc tcatccggcc ggccatcagc ttctggatcg acaacatccc
    55081 caaggagacc aacgagctca cgtacctgct gggcatgatc gtgaagtact gctccatgaa
    55141 cgccgaggag caggtgatcc agcgcgcgat gatcgagtac gacaacatca agatcatctc
    55201 gtcgaactcc agcagcatca acctctcgta catcatctcc ggcaagagca acatgctgcg
    55261 cagcttcgtg gtggcgcgcc gcaaggacca gaccgcgcgt tccgtcatcg ggccggattc
    55321 gtcgctctcg gtgcgcgagg tcggcatccc cgactacatc cgcaacacgc tcacgcagaa
    55381 ggtcttcgtc aactacctga cgtccaagcg cgtgcgcgcg ctcttcgagg agcgctccgt
    55441 gaagttctac ttcaacaagc gcctgcgtca gctcacgcgc atcaaggacg ggaagttcat
    55501 caaagacaag atccacctgc tgcccggaga ctgggtggag atcgccatga ccgagggcac
    55561 gaacgtgatc ttcggccggc agccctcgct gcaccgacac aacgtcatct cgtccaccgc
    55621 gcgcgcctcg ctcgggtaca cgatcaagat cccgccgggg atcgccaact cgcagaacgc
    55681 cgacttcgac ggcgacgagg aatggatggt gctggagcag aaccccaagt ccgtgatcga
    55741 gcagagcgtg ctcatgtacc cggtgaccat cttcaagcac gacgcgcacg gcgcgcccgt
    55801 gtacgggtcc atccaggacg aaatcgtggc ggcgtactcc ctgttccggg agcgcgacct
    55861 gacgctggac gaggtgctga acctgctcgg gcgctacggg cgcgacttca caccagagcc
    55921 cggcaagacc aagttctctg gcggcgacat cttccggttc atgataagcg cggacatcaa
    55981 ctaccgcggc atcctggagg acggacgcgt ggtcgccgcc aacgtggaca gcgacctcgt
    56041 cgtggctatg cgggcgacct cgctggcggg gctcatcgcc gactactcca cgaacgtgca
    56101 gggcgtgcgg ttcgtggaca cgctctcgta cgtgctcaag cggtacctgg ccatctacgg
    56161 cttcggcgtg acgttcaggg acctgcgtcc cgacgcctcg ctcgtgaacc gcctgcacgc
    56221 gctgaacacc gagaagatag agcagatcaa ggatgcgtac gcgcgctacc tgcaggacgt
    56281 ggcggagggg cggatcgtgc ccatgtcgcc ggccgacgag gccgacgcgg tggagtcgct
    56341 gctgtccaac ctcacgaacc tgaacgtgcg ggagatcaac gagtacatgc gcgagacgct
    56401 ggagaacaac ccggacaaca acctgctgaa gatggcgcgc gcggggtaca aggtgaaccc
    56461 caccgagctg atgtacctgc tgggcaccta cgggcagcag cgcgtggacg gcgcggtggc
    56521 cgagaccaag gtctacgggc gcgtgctgcc gtacgcgctc cccaactccg cggaccccga
    56581 ggcgcgcggg tacatcatca actcgctcat gaacgggctg tccgggtccc agttctactt
    56641 cgccatgctg gtggcgcgct cgcagtccac ggacatcgtc tgcgagacct cgcgcacggg
    56701 cacgctggcg cgcaaggtga ttaagaagat ggaggacacg gtggtggacg gctacgggca
    56761 ggtggtcagc ggctccgtgc tcctgaagta cgcggccaac tacgcgaaga tcccgggctc
    56821 gacgaccaag cccgtggagc tcatcttccc cgacgagaag atgacttggt tcctggagat
    56881 cagcgcgata tgggaccgca tccggcacgg cttcgtgcgc atgcaccgcc agcgcatggc
    56941 gacgaagatc ctggcgccat tcaacttcct ggtcttcgtc aagccggctc cgagcgcgga
    57001 ggcggccatc tcgccgcggg acctgtacca catgatccgg cgcgtgatgg acgacgtgcg
    57061 cgagaagtac ttcttcacgc tggcgagcac ggacttcatg gagtacgtct tcctgacgca
    57121 cctcaacccc tcgcgcgtgc ggatcacgcg cgagacggcg acgctgatct tccggaagct
    57181 gtaccacaag ctgaacgcgc tgctcggcgg cggcacgccc gtcggaatca tgtccgcgca
    57241 ggtgctctgc gagaagttca cccagcaggc gctctccagc ttccacacca ccgaaaagag
    57301 cggaggcgtc aaggtgaagc tgggcttcaa tgagttcagc aacctgataa ccatgagccg
    57361 caaccacacg gagatagtct cgctcacctc cgcggacatc aacaagctca tgccgctgaa
    57421 gataaacttc gagttcgtgt gcctcggcga gctgctgccc gagatttccg ccgagccgtc
    57481 cggacgcccg tccatctacc gcgtgcgcgt gcgcatccac cgcctgcgca tcaagcgcgc
    57541 gcacctcact gaggtgctgg tggacagcat catcgagcgc ttcgtctcct tcaacgttct
    57601 ggtcaaggag tggggcagcg acatgacggt ggacggcgac cacgtggagt acacgctgct
    57661 gctgcgcttc gtggagcccg agcagctcaa cttccacaag ttcatgctgg tgctgccggg
    57721 cgccgcgaac aagggcaagg tgagcaagtt caagatcccc atcaccgagt gcgcggtgca
    57781 cgacgaccac aacgccacgc gcaaggcctt ccgcatgaac atcgagctca tgagcctgaa
    57841 ggagctgggc atcttcgacc tcgaggacgt gaacgtggtg ccgggcatgt ggaacacctt
    57901 cgacatcttc gggatcgagg cggccagggg acacctgtgc gagagcatgc tggacaccta
    57961 cggagtgggc ttcgactacc tgttcccctc gtgcgacttg ctggccagcc tgctctgcgc
    58021 gggatacgag cccgagtcgg tgaacaagtt caagttctgg aacgcgagcg cgctgaagaa
    58081 ggcgaccttc ggggacggcc gtgcgctcct caacgccgcg ctgcacaacc gcaccgacac
    58141 cgtggcggac aacagcagct gccacttctt cagcaagacg ccgggcgtgg ggaccgggta
    58201 ctacaagtac ttcgtgaacg tggagatgtt catgcggatg gagaaagaga tccaggcccg
    58261 cgtggccgag cggaagatgg gcgagctgga ggaggccgcc gaggaggagt tctaggcccc
    58321 cgttacgaac atctttatca actggtacct gaagttgttg ttctccagga acgcgccgcg
    58381 cgagtcgcgc agctcgtagt acgtcttcag gaagaagacg aacctggcgg ccggcgacac
    58441 ctcggggtgc tcgctggtcc agcggtgcat gatgtacgcc atcgcggcgg cgccgctcct
    58501 gtttatgccc gcgacgcagt gcacgagcgt gggctttttc tcggcctcca gccgctccag
    58561 cagcttaacg agcggcggaa tcacgccctc gatgctggtg acgttgtcgt cccgcagcgg
    58621 gatgtggtac acggcgatgc tctccggcgc ggagtacttg gccgtggtca tgttcaccac
    58681 gcacttgaag tcgacgccgg acgcgcccat cacgacggcc cgcgcgtcct cggcgctccc
    58741 caggtacacg tactcggtca gtcgcgtcat cgccgtcggc aggtagatgg gcgcgccggc
    58801 gcgggtgcac cggagcagca gcttcgcgta ccagtcgttc ttggcctcca tattttattt
    58861 atatgataca aatggcggac gtcactacgc tttcggtgaa cgggctcgac ctggacttcg
    58921 cgcgctcgcg cgccgtccgc agcatccgcg cggccaagac gtcgacgctg gtgtttttca
    58981 ctcttactct gctgacgtcg ttattcattc tttggctcca gctgacggag tacccgctcc
    59041 tggcggagct cggtcgctac gcgcgcatca agagcgccgt gcggtcgtgg cgcccgctgg
    59101 tggacgcgaa gacagagatc gagtccgacc tgggccggca gaagaccgtg gacaggccgg
    59161 acctgttcga gttccggtgc gtggacttcg ggaagttcta cctgcccgtg cggtacagcc
    59221 ccacgacgtt cctcccccag gccgtgcgtc ggggcaccgg cgacggctgg atggtgcaga
    59281 aggccgcgga caccgacctc tccgccaagc agttctgcga gtcggtgctg cgccaccggg
    59341 cgaacaacgt catcacctgc gggtcggaga tgatgcgact ggtggggtac agcgggtact
    59401 tcgaggacga ccactggtgc gcggccgcct ccggagttct tatgtgatcc gccggctcac
    59461 acgatggccg tgaccagcat gcccgcgacg aaccacagga accgggagtg cggcatcagg
    59521 atcagcagca ccagcaggta cgccaggatg aagatgtcgg ccacgttgat gtcgaatacg
    59581 cccaggaagg agaacagcgg cgtggtcagg aagtagattc ccccgggcca gtacttcgcc
    59641 agccacgcgg ccagcatggg ccacaggccc ttcgcgttgc cgagccgctt cttcacctgc
    59701 aggtagtact ccgggtgcac caccttgtcg gcgcccgcga gcacgacccg ggagagcccg
    59761 agccgctttt cgagcatgga aatctccgtc agcatgctgc tacgcacgcc gccctcctcg
    59821 atgagggagg cgtacagcct cttcagggac cctacccgca cgatgtacgc gtccagcgag
    59881 acgtcgaacc cgccggggta caccatgagc tcgggctcgc ctgagttcgg gatggcggtg
    59941 gccagagccc cggagatgta cgtctcgcgc agctgcgcca tgtaccaact gttctttttc
    60001 atggcctcga tcaggggctt caccacctcc gggcgtctga acgtcatgtc gttgttcacg
    60061 accagaatga acgcgtcgtc cgggaaggtg gtggcggagt tcgggtcggc gatgtgctcc
    60121 cacaggttca ggtggtgcgc gaccctgtgc tgcatctcct gcggacaggc ggacttgcac
    60181 atgtccgaga agtagtgctc gtagtccttg gacttgacgt cgtaccaccc ggtcacgtgg
    60241 atcacgtggt caccctgcgg gtgcggcgcg gggggggacg gcttgggcgc gggggctggg
    60301 gctggggtcg gagccggagt cggagccgga gtcggggcag gcgcgggggt gggagtgggc
    60361 ttggggtcgt cggctacccc cttcagcagg taggtcagcg tggggaagac atcgttctgg
    60421 ggtctgccgt ctaccacccc gatcacgtac gcgttgatga cctcgggcga tggatccatt
    60481 taattattga aattaatcat atacaactct ttgatggccg tgatggattt gtctatccag
    60541 tccttgacgg agcccacgag tcccgacagg aacaggaaga acgcgaactc caggtccacg
    60601 cggctgaggg agtcgctgaa gtacacgaag aggtcgctgt ccgggaagaa gttgcgccgg
    60661 aaggcgttgt agccgttgac cttgtgcgac acgtgctcgg gcccgagcag cgtctcgtcg
    60721 aaggggtacg ggtcgctgaa ccggaacacg tacatggcgg ggttcgcgta gtagtacttc
    60781 atggtgtttg tcacgaacag gctcgccagc gagatgatga tcttcttctt ctcgatctcg
    60841 atcttgatgt ggtcgtcgaa ccgccgcatg ttgtacgcgt tggtgtcgtg cacgcggatg
    60901 agcacgcgcg tgtcgctcat gatctcctgg aactccgacc gcgcgtccgg cgtttcgtcg
    60961 ggcgtgtgtg cgggcacggc cacggtcggg cacgcgacgc gccactgccg cgccggcatg
    61021 cgcatggggc gcgcgcccac gcgctgggac tcgaagaact cgatgctgcg ggcctcctcg
    61081 cggtccgagt acgcctccac caggtagttg cggctcctgg tggtccggcc gatggtgttg
    61141 agccggtgca gctcggcgac gaggcggtgg tagtgcgcgt tgagctcctc cggcatgatg
    61201 gccgtgtaca cctccgtgag tagcacgacg gtgtcgaagt cctccttggt gcacacgcgc
    61261 gtcttcacca gaaagtggtg cacgacggtg gcgatggaca gccgcagcgt gccctccgtg
    61321 acctcgacgg gcctgtcctt cttcttcgcg ccgcgcgcca tcatgaacga gaccaggaag
    61381 tccgcgctgc tgttcagcac gatgaccagc gccacgatga agttaaggtt gagcgtcttc
    61441 gcggactgga agagctccgt cgcggaggcg tgcacgtcca gcaggttcgc ggacagccgc
    61501 aggaagaaga cgcccttctt aatctcggcc gcgaaccggc gctcgtactc ctgccggcgc
    61561 gcgttgatcg cgatgaggaa gttgaggatc agccggttga tgttgtactt gacggaccag
    61621 gtctgtgttt tcatgatggt gtcgaaggac ataacgatgt tgaagatgaa gcgctggctg
    61681 tgcgagaagt agctgtacgg ctcgctgagg aagatggact tgttcgtggc gggcaccacc
    61741 acgcccgcgc gcgacccgga ggcgtcggtg ttcaggtccg ggatgttcat cccgcagatg
    61801 ttgcagtacg ccatgccgtc ctcgaagtac acgtactcct ccacgaactc gttcaccttg
    61861 gcgaagtagt ccacgtccac gcgcatggcg gcggcgagct tgagctggtg ctcgcacggc
    61921 ggcgactcgt agtgcacgac gtcgcgccac cccgggggct cgctgaccgc gacggccgtc
    61981 cgcgcgatcg cgcggaactt ggcgttgcga gggttcagca ggtccgtgaa catgtcgcag
    62041 aggtgccggc tggacaggaa cacgtacttg tacagcagcc gccgctcgtc gtgggccatg
    62101 gcgtctacga aggcgcgccc ccactcgacg atgcccgggt ggtcgtcggc gaagttgttc
    62161 aggtacacct tccccgtggc ctccaggaac accttcttca cgtccaggaa gtcgcggatc
    62221 acgatgggga tgcggacgcc gtcgaggtcg tacatgaaga cgtagcgcag gttcagtttc
    62281 cggcgggaca cggggatgcc gatgtgccgg cacaggtacg cgaactccag gtacttcttg
    62341 gagaagcgga tgcggtcgat gttcttggac acgtactgca ggaggttgcg catgttgaag
    62401 gggatctcgc gcacctcggg gtccacgctg tcgtcgaagg cggtgcgcag gtcgctggtg
    62461 cggttcacca ccgccgcctc gcccgtggcg tcgtcgtgca ccagcacgtt gacgcgccgc
    62521 tgccggatga tcatgtcgaa gcggttgaag aacatgtcgt acatgctgtg cttggtgtcg
    62581 tccgcgatgc gctcgcccac cgacaggctg accgtcgcgt cgtcgcgcac ctgcttctcg
    62641 aacttgtacc cgatgtagga gaagatggag atcagcgtcg cgtcgtccgc gtcggggttc
    62701 tgctccatgg tggcgaagag caggcggatg tcgtcgtccg tgatcgcgtc cacgttgtac
    62761 aggttcacca cgaagatgga cttgttgtcc gcgatgaagt ccgtgtacga cttcgcggcc
    62821 gtgttcgggt cgcgcatgta cgcccgaatc ttggggatga tgctcgacag gatggcctcc
    62881 ctggaatcca tttaaggacg ggcaaggctt cgatctccgt ccaaaactga aatcatatag
    62941 agtcttaaaa gattggtatt gaaagtaaaa atcacaccta aagcgagacg gagacatgtc
    63001 ttcgtggcga ctcagcatga acaagtgctc cagcggcgtc cagactctcg actccctccg
    63061 acagcgcctg aagacggagg ccatgctgtg cgacgaagca accgagcagt acgaggtgcg
    63121 cgacagcctc ttcccctgcg acgaggtgtg tctggagatc gacgggcccc gtgccaccga
    63181 gcccagcgac gacatctgcc aacaggtgca gttgccggtg ccgccgcccg aggacgtgct
    63241 gagcccgccg cccgctccgg tcaagcagcc caagcgccgc accaagaagg ccgccgagaa
    63301 gaagcccaag gccgtagaga agctatgcga agacgacgac cgggacaata agaacggcga
    63361 gaaagagccc acggaagaag cacaacgtaa cgtctccgac gtggaatcca gtcccaaagt
    63421 cgaggaggag ctgcagaacc aggacgtggc ttccggaggc gccgctgctg gcgatgacga
    63481 gctcgacgaa ctgggcgagt cagacctgga cctggcgttc gcagccattc tcgccgactt
    63541 taaacacctg accggtcgcg tgaaggcgct gtcctccgtg ctcaccgacg tgcaggcctc
    63601 gggcgtgcgg cgctcgtttg ccggactgtc taaggctctt accgaggcgg ctgccatcgc
    63661 tgccggcggc tccaaggtgc ctgttgcgcc ccgcaagaag aaagccgccg ccggtaagaa
    63721 gtaagcgtcc taaataggca acggcgcctc ggcatggggg cgcgggcgct gttcctctcc
    63781 aagggaaaac tttttttcga caaggacttc tcgcaaccgg taccggacga caaccccgcc
    63841 tacgaggtga tcgccaacat ccggatcccg ccgcatctga cggatgtggt ggtctacgag
    63901 cagaccctgg aggacgcgca ccagggcctg atcttcgtgg gcaaggactc caaggggcgg
    63961 aagcagtact tctacggacg cgaccacgtg cggcggcgca ccgccgtgcg gaacgccgtc
    64021 ttcgtgcgcg tgcaccgcgt catggagaag atcaacgcct tcatcgactc ccacctggcg
    64081 tcgggcagcg agtccaacgc gcagatggcc gccttcctcc tcatggagac cagcttcttc
    64141 atccgcatcg ggaagacgcg ctacgagaag gagagcggca ccgtcggcat gctcacgctc
    64201 cgaaacaagc acctgtccct gacggagggc ggcgaggaga tgcgcgttaa gttcgtgggc
    64261 aaggacaggg tcgcgcacga gttcgcggtc cgcgacgggc agcgcctctt tgcggcgctg
    64321 cggcggctct gggacccggg cgcgccggag caactgctct tcgaccgtct gagcgagcgc
    64381 cgcgtctacg cgttcatgcg ccgcttcggg atccgcgtga aggatctgcg cacctacggc
    64441 gtgaactaca cgtttttgta caacttctgg tccaacgtgc ggtcgctgga cccgcgcccc
    64501 agcgccaagg cgctgatctg cgcctctgtc cggcagacgg ccgagaccgt ggggcacacg
    64561 ccctcgatct ccaggagcgc gtacatggcc acggccgtcc tggagctcgt caaggacggc
    64621 accttcctgg accgcgtggc cgccaccgac agtctcgacg acttcgtgaa cagcgtggtg
    64681 gactatgtaa ataactcaga ggtggtaaat ggataagagt ctcgccgtgg cggtgcggct
    64741 cgtcgagggg ctcagtcccc tggacgtcgc ggtgtgcctc tgccacctcc gcgccgagca
    64801 gcccgcgcgc cggttccctg cgatcgacga ggcctccggc gaggcgttcc tggacttcga
    64861 gttcgccgac ggggacgtcg cctcccggta cctgcccatg tgcgcgcgcg agctggcgcc
    64921 ggacgagcgg aaggcgcaca tgtccgcgat cgcgtgccgc ctcacagagg cggacctggc
    64981 gctagcggcc ggcccgcgcg ggaaagcgcg cgccgtgatc cgcgtgtgca agaacaagaa
    65041 gaaggtccac cggctcctgc gtctgataaa ggagtccgag gaccgcgacg tggacttctc
    65101 tttcatccgc gacgccgtgc tgcgctagac aaaacgtaaa aacaacacga cccataaatc
    65161 gggatgagcg ccccgagcct agacgagctg ctggtcgcac tggccgcgaa ggcggccgcc
    65221 gtggaccgcg gctcgcccgc agacgaggtg caccacgagg tagagctcgt gctcgtgcac
    65281 ccgccgctgg ccacgctggc caccgccctg cggctcgcct cggagacgga gtccttcatc
    65341 ctgttcacgg tgacggcgct cgccaaggag gagggcaagc tgcgcgcgcg catgccgctg
    65401 tcccgcgtcg tcggcctgga cgtgaagaac gtccagctcg tcaactccat agacaccatc
    65461 gtctgggagc gcaagtcgct agtggaggag acggagctgc accctgggtg cctgctccgg
    65521 cactccaccg agcgccgcca cctattcgtc gacttcaaga agtacctctc ggccatccgc
    65581 gtggagctgg tgaacctggt gcgcgtgcgc tcgaaagagg tgatcgcgga cttcaagttc
    65641 aagtacttcc tcgggtcggg cgcgcaggcc aagagcgcgc tgctgcacgc gctcaaccac
    65701 cccaagatcc gcccctccgc cacgctggag ttcgaggtgg tgcccagcgg cgagaccctc
    65761 gacgaggcgt cggtgctggc cgagctccgc gccatggcga aagcgctgtt catggccggc
    65821 tccgactcgg tgttcctgac gccggcgctg tccgcgcccc cggtgcgcac cgtcatgctg
    65881 cagaagcagg agatcccggc gctggagctc gagggcctgt actccgtgtc gaagacggac
    65941 ggggtgctgg ccgcggtcgc cgtgaccgag gacggcgtgc gctgctcctt cgggcacctc
    66001 gggtacacca tccggtaccc gctagccaag gcccccaagt gcgagtaccg cctctggtgc
    66061 gaggccgtgc gtcccgtggg cgagcgcgtg tgggccatgc acgtcctctt cgtggaggag
    66121 ccccagggga gcgaccgcat cgcggacgcg gccgcggcgg cggaggcgct gtgcggcgtc
    66181 tgcgcgcgcg tggagttcaa gtccaagcgc gtggacggtc cgttctccgc cacgtcagag
    66241 ctggtggagc acatctcgag cgccatcaag acggagccgg aggggatcgt gctgttctac
    66301 gcctccgggg agcgttcgaa gctggacttc aaggtgaagc gcgacaacac cgtggaccag
    66361 accaccaacg tgacgttccg gtacatgtcc agcgagccca tcgtcttcgg cgacggggcc
    66421 accttcctgg agttcaagcg attcagcaac gacaagggct tccccaagga ctacggcacc
    66481 gggcgcatct tcctccggga cgacgtcatc taccacaaca acatctactg catcgagttc
    66541 accaagacgc accgagaggt cggtctggcg agcgtggtgg tgcccgtgaa gttcatcagc
    66601 gagttctcac aggaggggta cctcctgcgc ccgcggcccg agaagacgat gaagtacctc
    66661 cgcaacccct cgtactacgg caaccagcac tcggtggtgc tggagcacgc gcgcgaccag
    66721 ctgctgtccg tgatggacgt cttcgacgag aaccgcatgg ccgcggtggg gcacacgctg
    66781 gccaacgacg ccttccgcct caacccggac acgccctact tcaccaaccg ccgcacgcgc
    66841 gggccgctgg gcgtgctctc caactacgtg aagacgctga tgatctcgct gtactgctcg
    66901 aagaccttcc tcaacaaccc cgagaagcgc aaggtgctgg ccgtggactt cggcaacggc
    66961 gcggacctgg agaagtactt cttcggcgag atcgcgtcca tggtggccac ggacccggac
    67021 gcgcgcgcga tcgagcgcgc catggaccgc tacaaccgcc tcaacgcggg gctcaagtcg
    67081 cgctactaca agttcaacta catccaggag accatccgct ccgagaccta cgtggagagc
    67141 atccgccagg tgatgtactt cgggcgcttc aacctcgtgg actggcagat ggcgatccac
    67201 tactccttcc acgcgcggca cttcgcgacc gtgatgcgca acctgcgcga gctcacggcg
    67261 ccgggctgca aggtgctcat caccaccatg gacggcgact acctcgccac gctgaccggc
    67321 aaggtctcct tcgtgatcaa ccgcaacctg caggagagcg agaacttcat gtccgtggag
    67381 cgcgtggccg aggaccaggt catggtgtac acgccctcca cgatggcgca gcccatgacc
    67441 gagtacatcg tgcgccgcga ggacatcgtg aagctcttcg cggacaacgg attcgacctc
    67501 atcgaccacg cgaacttcga gacggtgatc cggcgcagcc gccgcttcgt cgagggcgtc
    67561 tcgcggctgg agacgcggcc ctccaccaag aacttcttcg agctcaaccg caacgcgctg
    67621 gaggagatgg accgcacgga cgtggccgag ctcctaaagc gctacgtgct ttacgtcttc
    67681 agcaagcggt aggcagtaag tcggcgccgc accactccca ccgcccgccc gaaaggcgtt
    67741 gaatagctcc gtcagccacc aggccgtctc ctgggcgtct atctcggacc cgtcgtcctc
    67801 cgggaccggc ggcgcggcgc gcagctccag cgtctcggcc ggctgcagcg gctccagcga
    67861 gtcgaagatc gcctcgctgg ggaacagcgc gcgcatcatc cgttttcggt gtccgaagac
    67921 cgccttcacg gcctgcagcg cggtgaggtt gtcgaggcgc agcgcgtgct cgaagcggtg
    67981 gagccggacg ggagtgccgc ggtggtcgcg ctccacgagc acgtgtcgcc agcccgcgac
    68041 cgcggcgctc acgcggtcca gggtcggcgc gtgcgccacc aggcttttca ggttctgtaa
    68101 atcgccgccg atggggacgc gggactccat ttactaccgc ggaggaacgc acgagctccc
    68161 cgtcgccccg gacgcggcgg tggtcgtact cggggtcgcg gggccggtgg ccgcgcgcgc
    68221 ccctagcggg cggcggatct tcgtggccga gtacgccctg agcgcggccc cgggggcgcc
    68281 gctgcgggcc cgcctgacgg cgtccgggtt ccggagcgcg gccggcgcgt gggcgagcgt
    68341 cgaggacttc gacgtctgcg gccggccggc ggcgtggacg cgcgtgcccg aggagggcgg
    68401 cacgcgcgtg cccgtgccgg aggacggcgc ggtcgcgatc gcgtggagcg agggcggtgc
    68461 gacgtccgcc ctgcgcgcgt gcgtggtagc gcgcgccgcc gacgacgagt ccgctctcgg
    68521 agccgcgctc aaggacggca ccttcgacgc cgccgcaccg ggcgccgcgc tgctggcggc
    68581 cgtgggtgcg cccgcgctcg gctctgagcg tgccgcgcta gtgacggcgc cgggcgcgcc
    68641 ccaccgcgtg cggctgtgca ccaacaggga caaactccgc gccttcgcgg tggggtggtt
    68701 cggcgcgcag ctgagcgcac taggccccga aaatgaaaag gtattttccg cctttgataa
    68761 ggccaggtcc tgtttggacg accgctagca tggccgagac gcccgtgctg cgcacagtgc
    68821 gcctccagca ccggccgcac cgcatcgagt accaccctga ctgggagccg gtggtggaga
    68881 cactggtgga cgagtacaac gccgtcgcgc cctggctcct ccgcgacgcc accagccccg
    68941 cgccggagaa catcttcgcg cagctggcca agccgctcag cgacaagcgc gtgtgcgtgt
    69001 gcggcatcga cccgtacccg cgcggcggca ccggcgtgcc cttccagtcg cccgacttca
    69061 gcaagaagac gatccgcgcg atcgccgccg ccgtgtcccg gatgactggc gtgcaggggt
    69121 acgccgggta cgacctggac gcggtgcccg gcgtcctggc gtggaactac tacctctcct
    69181 gccgggaggg cgagaccaag agccacgcca tgtactggga gcgcgtctcg cgcgtgctgc
    69241 tgcagcacat cgccaagcac gtgagcgtgc tgtactgcat ggggcgcacg gacttccaga
    69301 acgtgcgcgc gcgcctggac gtgccggtga cgctggtggt gggcttccac cccgccgcgc
    69361 gcgacgggca gttcgcgcgg gagaaggcct tctcggtggt caatgcctta ttggagctca
    69421 acggtaagtc tcaagtggac tgggcgcgtg gattttcttt ttatagtgaa aattaatccg
    69481 tggtcctaaa tggcggcgcc cgtctgtgat aacacccacg tcttcctcct caagcgcctg
    69541 ggtgttccgg cgtcgtgccg ccgcgcggag gacccccggt tcgtcgagat cctgaccccg
    69601 tacgaactca gcagctacat cgagcggaac ccgggatgct gcctcttcga gacgctgcgc
    69661 gacgaggagg actgctcggt cgtgcgcatc ttcgccgacg tggacatgga cgccgcgatg
    69721 gaggaggagg acttcgtggc ggcgctggag gacctcatcc tggagcttgg ctccttcttc
    69781 gaccgcttcg ccagcggctc ctgcggcacg gtgccgggcg agcttaagcg gtgcatgctc
    69841 tcgggcttca ccgtgacgcg gtccacggcc gagcacaaga ccagcttcca cctcatcttc
    69901 acggacgcgt acaccacact ggacacgctg gtggccgcca agcggccgct gctggacctg
    69961 tgccgccgct ccgacaacgt gctcctgcgc gcgctggaca cggctgtgta ccgccgcggc
    70021 gccacgctcc gcgtggtggg cacgcgcaag acgccggacg cgaccgccgt gcacctcatg
    70081 cagtcgcccg acgacgacat caaggactac ctgttcacct acgtggagct ctccgacacc
    70141 agcgtctact tcgagctgtc ggagcgcgag cgcgattgcg gcgccagcgt ggtggcctgg
    70201 gaaacctcgt acatcccctt ccaggacgcc atgcgccgcg tgagccaggc cgtcgtcaac
    70261 gacatcgtca acctgcgcga gatcaccgag gacaacttcc tgaacacgcc gctcgtcatc
    70321 gactacgcca cgcgctgcgc gctgtgccgg aagccgcggc acaagcacgc gcaccacatc
    70381 accatgggaa acggctgcct gcgcatcgtc aaggggggca acgcgcacaa ctgcaaggtc
    70441 aagatcatcc agctcgaggg caaccggcta ttcaccgcgg cgcagatcat catcgcgtcg
    70501 gacgtggtca agctcaccga gcgcggcgac tacatcgtct ggctgaacaa ctcctggcgc
    70561 ttcagcagcg aggagtcgct gatcaccaag ctcgtgctgg acgtgcgcca ctcgctgccc
    70621 gcggactacg ccaacgagat gctgtgtccg cgcaagcgca aagtggtcga gaccaacatc
    70681 cgcgacatgc tcgtggacgt ctccgagacg gacgtgctct acgacaagct gcccttcacc
    70741 aacggcgtgc tggacctggc cacgggcgag ttcctcaccg gcgaccgcgc caaggagtgc
    70801 gtgtgcacgg tgtccaccgg gtaccgcttc tccagggagg agtacgaggc cgcggccgac
    70861 tcggaggcca tgcggcggct ggtgagcgtc atcgacgaca tccagccgaa cacgcccgag
    70921 aacgcggaga accgcgcgct gtacgagcgc gccatgtcca gcgcgctctg cggcgccacc
    70981 aagacggtga tcgtcttctt cttcggcgac accatgaccg gaaagtccac gagcaagcgc
    71041 ctgctgcact cggtgctgag cgggctctac atcgagaccg ggcagaccgt gctcacggac
    71101 gtgctcgaca agggcccgaa ccccttcgtg gcgaacatgc acctgcgccg cgccgtcttc
    71161 tgcagcgagc tgccggactt cgcctgcaac aacgcgcgca agctgcgctc cgacaacttc
    71221 aagaagctca ccgagccctg catcgtgggg cgcccgtgct tctcgaacaa gatccacaac
    71281 cgaaaccacg cgaccttcat catcgacacg aactaccgcc cggtcttcga ccgcgtcgac
    71341 aacgcgctca tgcgccgcgt ggcgctggtg cgcttccgca cgcacttctc gtcggcggcg
    71401 acccgcgcgg cggcggtgca caacatcgag tacagcgccg tcaaggacat ggacgacagc
    71461 ctggacgcca agatccagcg caactacttc cgctacgcgt tcctgcgcct gctggtggag
    71521 tggttccgga agtaccacgt gccgcaggtc tcgctggacg ccacgccgga cgcggtgccc
    71581 gacttcgcgt tccaccgccg cgtcgcggag ctggtcgtgc ccagcaacga gacgcaccgc
    71641 cggatgatgg agacgctgtc caagctgggc tacgtgctgg tcaacggcaa cgtggccatg
    71701 ccggccaacg tcttccagca gcgcctggcc gcgcacttca acgcgcgggt gcacggcggc
    71761 gacatagagg ccttcctgtt cagacacaag aaggtggtga acgtcaccga ggagtatatc
    71821 gagtacgtat tcatagatga tgtcgaaaat aaataggcgg ccgccccgcc cgaggtcgga
    71881 gcgcatgaat accgacgtga taaaactctt ccacggccac gatgagacgg tgcccggcat
    71941 cctgccgcac cagcttgcga ccgtggactt tctcgtccgc cgcgtcctcg acgacggggt
    72001 cagcgtcctc ctcttccaca tcatgggctc gggcaagacg gtcatcgcgc tgctgttcgc
    72061 catggtggcc tcgcgcacga agaaggtgta catcctggtt ccgaacgtca acgtgatgaa
    72121 catcttcaac tacagcatgg tcatggtggc caacctcttc aacgctccgt tcgtgataga
    72181 gaacatattc gtctactcga ccaccagttt ttattcgctg aactgcaacg acggcgtcgt
    72241 gaactacaac gggctcagca agtacgagaa ctccgtgttc gtggtcgacg aggcgcacaa
    72301 catcttcggc aacaacaccg gcgagctcat gatggtgatc aagaacaaga cgcgcgtgcc
    72361 cttcctgctg ctctctgcgt cgccgatcac gaacacgccc atcacgctga gcagcatcat
    72421 cagcctcatg tcggagacgg acgtcgagat cggggacatc gtggtgcagg gcaagaaggt
    72481 cttccagatc ctgctcaacg agcacggcgt gagcgtgctc cgcgacgtgc tcaaggggcg
    72541 catctcctac tacgagatgc cggacacgga catgcccgag gtggtgtacc acggacgccg
    72601 gttcctggac acccgcgtgg tctactgccg catgtcccgg ctccaggagg agaactacct
    72661 gaccgtgcgc cgcctctgca acaacgagat gttcgagaag aacatgaaca acgtttccat
    72721 ggcggtgctg ggcccgctga acctggtcaa caacctggac gtgctcttcc aggcccagga
    72781 gaaggacatc taccccaacc tgcgcatcag caacggcgtg ctctacggca acgagctcac
    72841 gaagctggac atcagctgca agttcaagtt cttcatcgac aaggtggagg agatgcgcgg
    72901 caagcacttc atctacttct cgaactccac ctacggcagc ctcatcatcc ggcacgtgat
    72961 gctgagcaac gggtactcgg agtacaacgg ctcgcacagc aacaacccgc acaccatcga
    73021 cggccggccc aagaccttcg ccatcgtgac cagcaagatg aaggcctcgc tcgaggagct
    73081 gctggaggcg tacaactccc cggagaacga cgacgggagc cggctcatgt tcctcttctc
    73141 ctcgaacatc atgtcggagt cgtacacgct caaggaggtg cgcaacatct ggttcatgac
    73201 catcccggac accttctcgc agttcaacca gatcctgggg cgcgccgtgc gcaagttctc
    73261 gtacacggac gtgagcctgc ccgtgaacgt ctacctcatg gcggcggtgt actcggactt
    73321 cgacgaggac atcgtctcgc tggaggacta cagcgtggag gacatcaacg cgctcccctt
    73381 cgacgtgaag aagctcttct acctcaagtt caaggccaag gagacgaacc gcgtgtacgc
    73441 catcctgcag gaactctcgg aggcgtactc ggcgcgcccg cacccgcagc tcgtggacgt
    73501 ggtgctcggg gagatcgtgc gccagttctt cgcgcggcgg tgccgcgtgc ccgcggagga
    73561 ccccaagctc gtcgcggtcg tgaaggcggt gctgggcacc cgcgaggcgg cactcgagta
    73621 catccgcgcg gtcgtcgacg ggcacttctt cgtgaccaac cggaccttcg gcaagtgcct
    73681 cctcttccgg cacgagcggg acatcgtcac ggtgccgttc gagctcgagc acgacgcgtt
    73741 cgcgtgggcg ataaacttcc ggaaggaggt cagtgtcgtg aatatataag ggcgcgcaaa
    73801 cataaaaata acagcgccca taaagcatgt ccacgttccg gcagaccgtg tacctgcccg
    73861 tgaccgtgca gccgcacgag ctcacgctcg acttccgcgg caacgtcgcg gaggcggtca
    73921 tgcgcgagta cctcttcaag gagaagggcg ggctcatggc cacggacatc gaggtctgcc
    73981 tgggcagcga gatgccgctg gggcgcatcg tggggaacgc cgtggtcatc tccgtgccct
    74041 gcaacgtgac gttcaagtac taccgcgtgg gcgacgtcgt ccgcgggaca ctaaacatcg
    74101 aggacgagac caacgtcttc gtggactgcg gggacctcgt ctgccagctg gggaagtcct
    74161 cgggcgcggt caccttcaac gagtcgaagt actgcctggt ccgcaacggc gccgtgtact
    74221 cgcacggcag cgaggtcacc gccgtgctgc gggaggcgcg ctcgggccgg gagtcggcgt
    74281 tcgtgttctc cgccgtgctt gcggcggatg atcgggaggg cgggtcgccg cgcgggtctc
    74341 cgcgcgccga aaaatagccg catatggcac cacgggggca catgataaat gcgcagctac
    74401 acgtccctgc tctcgaagct ggtgaaggcc aaccggcggc tgggcagcac gcgggtcttc
    74461 cgggacccgc tgcagcacat cagcgccacc gccttcgtct accggcgcat cgaccgctac
    74521 cgccggatct ccatctgcgc ggtgctcacc accaccgacg gcctcgtggt cgcgtgccgg
    74581 cgccggctgt cctttttgtc caccgagctc gcggagacgc gctccgccgc gcggcgcgtg
    74641 atgctggccg cgcggcacgc ggacgcgctg tcgcgcatcg gcgcctcccg gagccgcgac
    74701 gacgtgatgt tccccggcgg ggcgccgctg cccggggaga ccttcgtgga ctgcgtgacg
    74761 cgcgaggtcg aggaggagac cggcatccgc cgcgaccaga tgcgcatcga cgagcggatg
    74821 ttcgtgcacg ccttcatcga cgacctggtc accgggcgcg acttcgacgc catcatcttc
    74881 accggggacc tgcgcctctc cagcgcggag gtggagcgcc agttcgtccc gaacggcgag
    74941 gtcaagggcc tgctcttcct gcgcccgacc gaggacgccg ggggcgtgat ggcgcggctg
    75001 gcggccttcg cgcgcgcggc cgcgcggatg cggtgctggg gctccgcggc tacgcgatag
    75061 cggccgggtc gaccacgtac acgaggcggc cgccgctgac gcgcaccgtg gggctggccc
    75121 cgatctccgc caggaagttc ccgtcgtcgt cgaacagctt ccccccggtc tccaggaagc
    75181 ccttgcggac ggtgaccagc gcggcggagg tcgagtacca cacgctctgc ccgtcggtga
    75241 gccggaccgc cctcgtcgcc tcgcgcgcgt ccgcgggccg cgagaccagc gccagccacc
    75301 cggagtcgtc cgccagcggc gcgaagtcgg tgaaggccgc gcgcacccac tccagcgagc
    75361 tccgcttgag cacccggaac agctgcgtga actgccgcga cttgtccttg atgaggtcca
    75421 gcaggtcctc gtccacggtc gccgcgccgg agtcctgccg cgccaccacg aagtgcacgt
    75481 tcacgtaccg ccgctcggcg ggcgtcatct cgtggctgtt gagccgcacg gcgcgcccga
    75541 cgatctggcg cagcgaggcc tcgttccagg tcatgtccag gatgaagatg tcgttgatgg
    75601 agaggaagct cagcccctcc gtgccgctta gcgagaacac acagaccttg atccgctcgc
    75661 cgtccgtgtt gtcgcaggcg ttgaaggcgt ccacgagctt ggcgcgcgtg tcccgcgtgc
    75721 gcgaggagaa ctccacgtgc gagatcccga aggccgcgaa gtacagcagc agcatctcga
    75781 tgccggtgac gttcacgaag ggctcgaaga ccaggcactt ccccggggag gccaggatgc
    75841 gcaggcacac ctccgtgtac ttgcagctgc gctcgcggag ctccgtcagc agcgagacgt
    75901 cggcggaggt catgcggtcg ccgctgatcg tctcgccgct ccggaagagc ttcgtggcgg
    75961 cctccgagaa cgtgcgcccg ccgacgttgc gcgcgaagtc cgcgaagagc gcggccacgg
    76021 tctcgtcgta ctcctgcttc gagagcacgg acttgtccgg cacgtcctcg aaggcgaagg
    76081 tggccgccgt gcgccggtac acgcggaaga ccgccgcgcc ggacttgcgc tccatgaccg
    76141 ccgcgcggcg gtacgccgcg gtctgcttgg cggtcatgtc cacgtacatc atgcgcacgc
    76201 gcttgcgcgc gaaggccgcc gatccgtcca cgtcgtcgaa gatggaggcc tcgttgttga
    76261 ccaggtacga gcacacgccg ccgagcttgt ccacgaggtc ctcggggttg gcgagcacgc
    76321 cgccgtcgaa gagcgcggcc tggccgagca cgcccgggcg cagcaggttc atggccatgg
    76381 cgaactcccg gacgctgttg accacgggcg tggccgtgag gcagaggagc ttgccgttga
    76441 ccagcgggat gttcttcgcg aggtagttgt acaccgtgcg cgcggggcgc tggcgcccgt
    76501 cctccttggt cagcgacatg gagatgaagt tgtggaactc gtcgatgacc acgcagatgc
    76561 ggctgcccgc ggaggaggtc ttgatgaagg tgaagaagcg gtggtggaac cgcgggtcgt
    76621 cgtagttgat gaaggcgcag ttgggcacca cctccggcgc gaactgcatc atggtggagg
    76681 tccacggctg ctcgatgagc gccttcttga cgagcaccac caccgtccag ttggtgaaca
    76741 cgtcccggag gtgcttgagc acgtacaccg cggtcatggt cttcccgacg cccgtctcgt
    76801 ggaagagcag cagcccgtgc atgcggtcca ggcccaggaa gacgcgcgcc acgaagagct
    76861 ggtagtcctt gaggcgcacc gcgccgttca cgccctgcat ctcggagggc atgctcgcgg
    76921 tgcgccggag cgcgtagtcc acgtaggccg cgtgcgcgct cgtcatgcta tttggggtgt
    76981 cgcctctatt ccgatttaaa gggggcggga gttacaaaaa cgcgctctct ttttaacgcg
    77041 gcgcttggcc gcgcggttcc gagagcggcg ccgcagccgc gcgcgccggc cccgcgcggc
    77101 cccgtgcccg aaccagcgcc ggtgcacggc ctcgttagcc gccgagtttt cgcgggcgcg
    77161 gcacccgtac gccgagtagg tgcggcacat gctccgcagc acgcgccggg tgctgcgctc
    77221 cacggcgtcc aggctggcgg cgaccacggg gtactgccgg cgccacccgc ggatggcgaa
    77281 cagcgggcgc tcgcagagcg gcctggctgc ggcgtagtac gcgcccagca gccggacgtc
    77341 cagccggcgg gagtacgtgt ccacgaaccc gtggccgaac acgatggcct gcacgcagtc
    77401 ggggtccagc atctcccgcc gggaggccac gctgtccccg aagtagcccc ggatcccgcg
    77461 gtgccgcaac accagccggc gccgcgggag gtggatgtgc gggcccagcg aggcccgcgt
    77521 ggagggcatg tggaggttct cgtggtggcg tgcgcggcga cgcgtcccgg ggcggtgcat
    77581 ggcggcgacc ggacgcgtta acggggcttg tttttcgctg ttggtgcgag cgctactgca
    77641 gcagcagctt gagcttgcgc tggctctcgt tctcgatgct cttggactcg gaggtcatgc
    77701 tctcgtagag cagcgagtgc gtgacgtaga gcgcgtcgta gacgcggccg gcgaaggcca
    77761 ggaagcggtc gacgaactcg ctctccacgg ggtcccggag gatgcggaag ggcaccgcca
    77821 gggactcacg ccacgaggcc gtcttggcgc ggtcgcggac gtgggccacg aacttggcga
    77881 tatcctggcg ccgcgggtcg ctggccacca tcaccgcgct gtccttgagc cagctgtcgc
    77941 tcacgcactt gaagaggcgc acggtgccga agaggctgca gtacacgcgc agcgcgtgca
    78001 ctacgtcggt gccgaagagc gtgggcagct tgagcaccac gaagcgctcc tgcgagatct
    78061 cgagcagcgg ccgcatgacg gcgaacgtga tcgcgtggta gtccgcgacg tagaggttgt
    78121 tctccgtcag gtggttgttg gagcggatca tgccgcgctc cttgcggtag agcttgttcc
    78181 gcgcgctgag gtccaggact acggcgtcgg ccttgccgcc ccgctgcacg ccgcgcacgc
    78241 tggcgatgcc gtgcgcctcg agcaccttct ccacgtcgcg ctcctcggtc atgaggtcgt
    78301 gcgtgtacag ccgcagcatg tcggtgggca tgcggttgag gtcgttcacg cgcgagagct
    78361 gcaggaagta gttggcgccg tactccaggc tggggaggtg gcccgcgcca agctgcaggt
    78421 ccagccgggg cgcggtctcg aaggtgggca gcgtgacgct gaggccctcg cggatgctgc
    78481 gccgcaccgc atcggtggcc tccatggcgg ctatttaagg aacggcgcgt ctgttttcag
    78541 ttcgcgctac tgggaggtga ccttctccac caggatcccg gtgtcgtagg atatccggta
    78601 gagctcgttg cagaccacga ccatctgccg gggcacgtac agcagcgggt tgtgggcctc
    78661 catgggcgcc gtgttgatgc ggatggtgag cttgtccttg ccgcgggaga cgttcgaggt
    78721 gagcgcggtg gggctgaaga aggtgccggg cgtgaagttg aactgcagcg tccgcacgcc
    78781 ggcggtcttg cctaagatct cgctgaacac gcgggagacc ggactgctct cggagtagag
    78841 cacctcgttc ccgaagcgca cgtccatgcg agcgatcacg tccgtcttgt tcttgaagtc
    78901 cacgcccttg aggaaggggt cggccacgaa gaggtccttg gagcgcgact ccggagaccg
    78961 gttgtcgccg tggtacacgt tccgctggca ggtccagatg ctcacgggga tggaggcgtc
    79021 cccgatgttc accgagtgca ccacgctcgt gaagcggatg cggtgcgtgg cgcggctgta
    79081 ggccccggtg atggcggaga acttcttgga catgttgtac acgacggagt tcttgcgcgt
    79141 gctgaagacc aggatgttcg tgtgcaggaa cacgcgcatg cccaccggca cgtcgtcgac
    79201 gcgcacgaag acgtcggtgt cctggatgga gaccacgccg gacgagggca cctccacgat
    79261 ctcggccgtc tcggggaacc cctccggata gcagttggag acgatgacca tgtcctccag
    79321 cagccgctcc acgaaggcca gcacgaagtc gccctcagac tgctggtacc ccgggtacga
    79381 gatgaagcgg ttgttcgcgt cggcgaatac gggcttcgtg tacaccgaga gcgaggtgca
    79441 cgcatgcacg tccgtgatca cggaggtggt gtggttgagc tgctccacgc ggcggcgcgg
    79501 catctcgatg aacgccgggc gcgcgtgcat gttcttcacc atgtacccga tgaagctgag
    79561 ctccgtggtg taggggaact ccttggcgag cttggacatg tcgaaggcct cgtcgtacac
    79621 catcacacac gagatggggt tcagggtgac cgtcaccacg atcttgttgt cgccgagctt
    79681 cagcgtgctg aaggtgcgct ccgcgtcgaa gggggtcttg atgtacgcgt gcacggtcac
    79741 tgcctccttg atgacgtcgt tcggcgaggt gcccgtggag aggtcgttca gctcgcgcga
    79801 gaagccggac agctccatca cccggtcgtt ctccatgcac gagtcgaaca gctcctcgcc
    79861 ggacgtctcc cagatggtgt cggacgagga gtttatggcg acgtgcctga tcatcttgta
    79921 cccgatgtag ggcacgtagc acagcttgcc catgcccttg atctctggca ggtcgatgct
    79981 gagcacgagg ctgttgatgg ccgagatata cttgtcgcgg atctcgaacg tgacggtgac
    80041 ggcgtcgccg ctggtgtcca ccacgccctg cgtggtgatg tactgcggca tgtacatggt
    80101 cggcacccgg tagtccgtgg tgaacacgct ggcgcggcgg acgctgtcat ccgcgcccac
    80161 gaggctcacc acggagttat tcatttattc cctgggaaaa ccagttaaat aaggctcttt
    80221 agagccatgc gcgcggcgcg gccgtcgcgc tccacgtagc agcgcccgta cacgccgtcc
    80281 agctcgcgcg tctcgttgat gagcgcgcgc acgcggtcgg ggtcggcgta catctccagc
    80341 ggcaggagct cgatcttggg ctcctcgcgc agcgccacca ggtgcttgac gagccccgcg
    80401 aacgagtcgc ggcacaggcg cgagcagaac tccccgatgg ccgcaccgtc cagcgtctcc
    80461 accgccagcg gggccgcccc gacgcgctgc ttgcagaacc agcaggagcc gtccgcggcg
    80521 cgcagcgcca gccggtccga ggagacgctg ttgaagtact tcgggagcac gtactcgatg
    80581 cgccccgcgg ccgggggcgg gcacgccgag gcccggggcg cggagatgtc cacccggcag
    80641 agggcgatgc gcttcatggg ctatttagga cgcgcccggc gcttcaaggg tccagcgagc
    80701 acgccgcgaa gcgcgcgtgg cggaagacgt agtcgtgccc gaactcctgg atctgcgcgg
    80761 cgcgcttccg cgcgcgcatg tgcgcgagga agttctccca cgtgagctgg ttgctgttgt
    80821 tcttggcgta gttcttcacg gtctgcgggc gcaggttgct ggtcacgccc gtgacctcga
    80881 agatcttgtc caggaagaag gagtagttga tggtcttgga gggcgtgctc tcctggcaga
    80941 agaagaccag ctgcttgaag atctcgatga cctcgttgat cttctcggtg ctgaggttga
    81001 gcttctcgtt tttgacctgg ttgatgatct cgaagacgag cttgtagtcc ttcttgttga
    81061 tcatgtcgct gtcttttagg aagctggaga cgtagttggc gtccacgtcc acgggccgta
    81121 tctggtgcct gtccatgatc tcgcggagct cgcggatgac gtcctccgag cactgctttg
    81181 acagcagccg ccggagcacg ttgcgcaggt ggatgagctt gttggacacg tggaagttgg
    81241 accgcttctg cacgcggatg cccatgggga acacggtttc gcagaacagg cagaagtcgt
    81301 agtcggtgtc cgagaccagg ccgttgcgcc ggcagctccc gcacagccgc aggttcatgc
    81361 cgccgctaca ggagcacgcg cctgatctcg cggtccagca ctttagtgtc catgctcttg
    81421 tttctacaga agacgagaaa ctcgccgagg atccgtgcgc ggttcggctg cgacgcgatg
    81481 agcagcatcg cgttgtcccg gtcttcgttc acgaagcggg tcaagttcag cgagcaccgg
    81541 gtgcatcgcc ggggcgggtc tagcgtgacg gagtacgcgg cgtaccacga cgcgtcgcgg
    81601 gagcccattt ggttagcaca aaacgtcgca catgctcctc gaggacatgt acgggtcgta
    81661 ctcctgcgcg tacaccagga tggtgcagta cttggagatc atcgccatgg cctcctccat
    81721 ggtcagcagg tcgtcctcga acatggtctt gtgctgcatg tgctggctct gcttggccgc
    81781 cagcgccgcc gcgccgtccc cgcggagcca gtcgttcagg ctctggctgt cgccgccggc
    81841 gccgttctcc tgcgcgtgca ggttgcgcat ggcgcgcatg agccggctct cgcgggcgcc
    81901 gcggctcagc gcggacatgg ggtcgtagag ccagggcccg gcgtccgtga agaggatggt
    81961 gcagtacccg ttggcgaagg cgtccacggc cccgcagccg tcagcggccc cgtccccggt
    82021 ccggtagcac acggcggaca tgagccggta catgatgccg ttgagcgtca tgtcctgggc
    82081 gacctcgatg gggatgtcgc tgatcatggg ccggtagttc gtgaagcagt cgcccgtctg
    82141 catcatcccg ctggagcgcc gctccaccag gaacaccacg agcccgttgg tgatcaccgg
    82201 ggaccgctcc ttctcgtaca cgtaggagtt ggcggcgcac acggtggcgg ccacgtccgt
    82261 cccggtcgcg ccgaggctgg aggatccgct ggggaggtac agcacgcggc ccgcctccgc
    82321 cgtgcaggag aagttgcctc cgatggagag cggcgcgttc gaggtcgtga gcatcttcct
    82381 ggagtccacc accaggtagg gcaccgagcg cagggacatg tccaccatgc cgccgatgcc
    82441 cgtgccgaag gtcggccgcg acaccgagac cagcgtgggg cggaaggagg cgatggcgaa
    82501 gatggaggcc agcatctgct cctcgtcgga catgatggac gagcacgcgg ggtggatgat
    82561 cttcatcagc tggttgtcga tggactcgtc gctgttgcag tggaagatgc ccatgcgcag
    82621 gttgaggatg cagcgccgca agttggtgtg cagcacggcg cgctggatct ccatggagac
    82681 ggtgtccgtc acgcccggca tgatgatgct cgactcctcc gtgagcttgt tcaccagcag
    82741 ctggtagttg cagggacgca cgcggtggtt gtggtggagc tgctgcagca gcgagaggct
    82801 gtctcccgtc acgaacgcgg cctccaggcc cggcagccgc acgccgaaga gcgccatgat
    82861 gatcgggtgc acgaacccca ccgagtcggc ggacttgaag gagaagagca ggtcgctgga
    82921 ggaggacatg tccttgaagt ggccggactg gaactgcgtg gtgctcagca ggttctggta
    82981 gctggagagg ctgtgcagct gctccagctc cttcatctgc ttgttcacgc gggggtggtt
    83041 cctggcgtag atgagcacca gcgggtgcga gttgctcacg ctcacgccgg tgtccgccat
    83101 ggccgccttg acgctcgaga gaaggtcgaa cagctccgac cggtccctgc tccggatccc
    83161 cagccggctc atgatgttca tcagctcctg gatggtgatg ttccgcgcgt cgctctgcgt
    83221 ggacttgagg tagtcggcga tcatctcgcc ctcccgccgg atctgcagct gccactcctg
    83281 catggaggtc atgcggtcga cgggcatgag cacgttgccg gtggagctag gactgctgga
    83341 gccggagcct gactggcggc tcgagggccg ggccgacgac gaacgcgcgg cgccccgccc
    83401 ggtcgaccgg ctaggggcgc ggcgcgaggc gccccgggag gccgactggc tgcggaccgg
    83461 ccgctgggcg cgcgcgcccg ccgaaaccat gtcctcgcgg tttatcagcg acatggcgtt
    83521 gcagacgccg cacgccatgg tctgctgcgg gatgtggacg tggtcgcaat ccagggagag
    83581 gcccgcatag tcgtaggagg gcgcgaggtc gatgcgcgcg ttacaaaaat cgtcggcaag
    83641 ggcaaacgcg gaggacgatg ccatttatac cggtagtttt tatgaggagc tggcgttatc
    83701 cacgcgatcc acagcgctgg tcgcgttgct gctgtccatt gacctggaca gcagccggcg
    83761 caggtcgtcg atcgcggtct gggtggcgtt cttcgcctgc tcgatgtcgt tggtgaggtt
    83821 gctggactcg gcgctgaggt cccggacgct ttccgcaatg ttctccagct cccgcttgat
    83881 gttgacgcgg tctgatgcgc tctcggtgac cttgtcaggg atccgggtct ccagcaccgg
    83941 cgacgactct ggggccttgg cgacggtgac cgaggggcag ttgtccgccg ggtacggggg
    84001 cggcgcctgc tggcccaggc tcggccgggc ggcgggtacc gggcggtccg cgcagggcag
    84061 cggcggcgcg ggcgggcacg tctgggcctg cacggggcac actggcgctt ctgcggcggg
    84121 acacaccggc ggaggcgcgc acgacgccct cggggaggcg cagggcggcg gagccagagg
    84181 gttgcggccg tccggacggg cgaagcagtc ggaggaggac ttgagccgct gctggaagta
    84241 cttacccatc tccttcacgg tgtacttctc catggagtcc acctcctccg tcggacacac
    84301 gggctgctgt gcgggcgcgg cctgcgggca cttggtgaag agcatggagt tgtactctgc
    84361 gaggaccagg ctggtcttcg ccaggtcccg ggcgaagcgc tttcggagat ccatttaaat
    84421 gcctccaaaa ttgaacgtgt actcggatcg ctaaatggag gaatcggtgg tcgccgggtt
    84481 cgcggacgag gaggacgagg acgagatcga ggactacgaa gaggaagagg aggacgagga
    84541 gcccgcggag ggcgcggccg gcacctccgt cagcgacgtg accccctctg cgaccgagaa
    84601 gctcgtggcc tccgaggtcc ccgaggacgc ggcggctgtg gaaacgaacg cgcggcagcg
    84661 cgtgaccgcg agggtggagg agctcaaggc gcgctacacg cgacggatga gtctgttcga
    84721 gctcactgga attgtagcag aaagtttcaa tcttctgtgc cgcgggcgcc tcccactggt
    84781 cgccgatccc acggacccgg cgctggacaa cgagctgaag gtggtggtgc gggagatcga
    84841 ggagaacgtg tgtcccatcg tcatcgagaa gaacggtgag ttcctgtcca cgcaggactt
    84901 cgacccggag tgcctgcggt accatctgga gtacatgacg gacctctgga agtctcaggg
    84961 gcgcatgtag cttactcggc cgcggggggc ggtgcggcgg tcgccgcctc cgcgattttt
    85021 tctttcacca gggagatcag gtcccggatc tgcaggggct cgccgcggta cgtgatcccg
    85081 ttcgcggaga tcacgccctg cacgatgtcc accagcgagc cctcgcgggt cgagtactcg
    85141 ccggccagca ggtccttgta cagcgtccgg tggttggcca cgtaccgcac gagcgtctgc
    85201 acgttcttga cgcccgccga cttgaggtcc tggggcgcga gcttcccgcg gagcgagtcg
    85261 atgacctcgc gcacgagctg cgcgatggag gcgttggtct tgaactcgtt gtacagcacc
    85321 acgtagagct tgcacacggc ggtggcgaac ttcaccggac gcagctcccg gttctggaac
    85381 accagcatgc tcgaggtgat cttcttgatg aacttgaggt acttcgcgcg gtcgccgtcg
    85441 atggtcacgc tggcgatgtc cacgtccgag atgcactgga tgccgtgcgc ggcgctctcc
    85501 gccgagatca gcagcatctc ccggtactcc ttgagcttct ccttgtcgga gagcagcgag
    85561 ctgtcgaaca cggccaccag cttgagcacg tagttctcgt cggagaagac cttgttcaga
    85621 cacttgacca ggaagctgta gtggccctgc aggatcttca tgatcgagtt cgagccgttg
    85681 gcgccccgga tctgcgcgac gatctccatg agcttcttcg agtcgtcgac gatctcctcc
    85741 gtgtcgctgc ggatgctctt gtacatcgcg ttcagggaca cgatcgtctg cacggccagc
    85801 agaagctccc ggaacacggc tacgaactcc cgccgctcct cctcggagcg gatgctgttg
    85861 tacacggact tcacgacggc gtcagacttc aggaaccaga acgagagcgc ctggtagttg
    85921 cagtgcttca tcagcgccag cacgtccgcg tccgccatgt cgggcgcgat cgggcacacg
    85981 gagccctcca gcatgggcac catggccacc agcgtgtcca cgtccgtctc gaagtcgaag
    86041 cagtccacgc acatccccgt gccccgctgg aggtactccc ggctgatgtc gtagaagcgg
    86101 gcgtagcagc agcggaggcg gtccatggcg gcggtgcagc gttttagtgt ggcacacact
    86161 cttgaattat tgttgggggt acagctcccg cagcagcgcc tccgcgcgcg aggagtccgg
    86221 ctccgtgccc atcttcagcg cgcagttgat ggaccaggtc ttcacgaagc gctccggcgc
    86281 gtccgtgacg acgtacctga acagcttggc gaagtgccgg ctcacggcgt tgggcaccgt
    86341 cgcgttgcgc acgaaggccg tgaacgagga ggagagcttg ggcgcgaagc gcgccccgtc
    86401 cacgaagaag ccgtcggtcg ccagcgtcag gccggcctcc tccgcaacga cccggggcac
    86461 ggtcttgtgc gggaacatgt ccgccaggcg gctgcgcgcg tccggcgcga tgtggatggc
    86521 gtcctcggtc gcgtccttgc ggatgcacac cacgtcgtgc acgatctcct ggatgaggat
    86581 gcgcgtggcg gaggagtccg agagccgcat ggggaagtac accatgtccc cggagatgag
    86641 gatgttcccg ctctcgttca cgtaggccac gatctcggac acggaccgca ggcgcacgat
    86701 cgcgccctcg cagcagtgca ccacgtagta cccggcggtg gcgcgcagac gcttgttgtc
    86761 cgcctcgaag tcggcctcca ggccctcgtt gaagtacttg tcgaagatga tgggcaggaa
    86821 ggagagcttg gactcggtga ccaccttccc gaagttgagg atgtacgggt tcagcgagct
    86881 ccggtccacc tcctcgtcgt agacgcagga cttgaaggtg tccgtgtgcg cctggctgcg
    86941 caggaagcag cacgggatgc agatgcgctg cagacggtgg aagatggaga ggaagcccac
    87001 gctgttgtag cgcccgtccg ggtccatgca cgagaacatg acgccgttgc tgttgacgaa
    87061 gacctcgcgc gcgtcggacc tgaagaagtt gtcgctgacc ttggtcatgt ccgcgtccag
    87121 cgactgcacg atcacgggct tgcggttctt ggtcttggtg ttctggcaga tgcgcgacca
    87181 gtacacggtc tccaccttcg tgaagtccga ggactgcttg acgctgttga acatcacgct
    87241 gatggcgatg atgaggaagg tgaagtactt ctcgatgttg gggatgtagt tcttgacctt
    87301 cacggagacg tgcgacttcg ccaggatgat ggagatgcgc ttgtccgtgg agagcaggat
    87361 gttgttggtc gcggtctcca cgaagatgaa gctcgtctcc atgtccagct tcatcttgga
    87421 ggtgatgtgc gtgcccagcg agaccttgta ggtgatgtcg cccttgacgc ggtccatctt
    87481 cacgtccatg ctggcgacga gcttggtgaa cagcgccacg tcgttcacgg tcagcgtctt
    87541 gccgtcgctg gagatggcca gcgcgccctc ggcgtcccag accgagaggt tcagcggctc
    87601 gtccacgagc aggaagcggc tgcccgtcat ggagatgaag aagtcgtccg tcttcgagag
    87661 caggatgtcg aagtcgccga cctcccggcg ccgctcgggc gactgctgcg cgatcgcgcg
    87721 cagccccgac tcgcggaggt tggtgcggaa gatgttgttg aacttggtct ccaccgtcat
    87781 gttcaggtcg aggccggcga actcctggat gagccgctcc tcgaacttca ggatggagtc
    87841 gctgggctcc tcgaaggagc cgaactccgg cgccgcggtg tcggccgcgc gggccaccca
    87901 caccaccagg aagtcgcacg cgtccgcgta cgcgttgtac aggatcccgt ccgtgcggat
    87961 gagcgtcttc ttctgcgtgg gcgagaaggg gttgaagatg gtgttgtcca cgtagctgta
    88021 ctcgaggttg ttcttgtgcg agtacacgat gatgtcctcc tggaggtcca gcaggtggcc
    88081 caggtacccc ttgagctgct gcacgcgcat ggtcagcagg atgtgccggc gcacgtgcac
    88141 ggggtcgtgc tggatgtact gcttggcgaa gaagtagatc ggcgacgact ggtcgatctc
    88201 gtcgtacagc gagaggtaga gcacgcgctc gatctcctgg tgccgcccga ccaggacgac
    88261 cagctgcggg gacacggtgt acagcatcgc ggttatttta tttatagccg ccgttaaact
    88321 gaaataaaat acgcgttgcg cgacgacgtc gccatgtttc agccggtgcc ggacatgtcg
    88381 gtggaggcgg acatcaagct cggggacgtc agcgtggacg ccacgcgcgc cggcgcgcgc
    88441 gagaagaccg tcttcttcgc gcgcaacaag cgcatgtacc cgcaccgcag caaggacgag
    88501 gagcggaagc tctcgctggg cttcttcctg cagcgcctgg acttcctcac ctcgaaggag
    88561 gtcaacctgc agttccggtc cctcgacgcg gtgaagaccg aaacggtgct gaagaagaac
    88621 aacgtgctgg tggcgccgta catcctcatc gccacgctgg cgggccgggg gttccggctc
    88681 acggagacca tggtcgagat atacttcccg gagctgtacc gcgagaccag caagcggttc
    88741 cggttcggcg cgcagatccg gatcatccag gagttcatgg ggtacgccac cgacagctac
    88801 cacacctacg acttcgagac ctatttcgcc ttcatggcgc tcgtcatccg cggcgccgac
    88861 accgacgtgg aggccttcga cgtgcgtccg gagagcgggc tcgtgcgcag cctcaccgag
    88921 atcacgtacc gcctgtacgt gatgcagctg cgctccgacg ccgcgcagtg gagcgtcagc
    88981 accgggtcgg tggtctcgca ggtggtcaac accgtgctga ccgtcgtctg cgagctcgcg
    89041 gaccgcgcgg aggcggaggg cgcggtcccg gtgtgcgacc tggcgcggga gaacccgcta
    89101 tccgtggagg acctgcgcaa gtacggaacg cgcatgcgcg cgctgctgac caccatgacg
    89161 cgggcgcggt cctttaagat aaacaggagg gacagagacg cgctgtcgcg gttctgccga
    89221 ctggcgccgg gcgcgactag ctgcccgacg tctgggtgct ccgcgtcgtc tgcttagggg
    89281 gtgccgggcg ctcgccgccc gagcagtcgc tgtcgctgaa catgtatatc agggccacgc
    89341 cgagaagcag gtacatgatc atgctgatca cagtcttgaa gaggacggcg gcgagcgtgt
    89401 tggagcgcag ccggtgctcg cagaagtgca taaacaggtg gcgcatgagg tcgatggcgc
    89461 cgttggccac ctggaaaagc gccaggccgc ctatggactt aatcaccgtc acgtagcacg
    89521 gacgcatcgc cgcgcggact atttactcac tgtcaaaaga aaccgagccg tccgaggagc
    89581 ggaggttgag gttgcgcttc atgtggttcc agtacagctc cccgatgttg gcgtagtacc
    89641 ccgtcagcct ggatattttt tctttcacca tctcgtacgc cttctgcatc tcggccacgc
    89701 ctatctcgga gtcgcccacg tagcgcccgc tgcggcgcac gatcaggagc agcgccttca
    89761 ggttctccag cgcgatcatg tccatgtaca gggacttgga cagctccacg aagacccggt
    89821 accgctccag gatggagttc ttgacctcgt ccgagatggg caccccgaag atgcgctccg
    89881 tcgtgtacac cgactgcgtg agctgcttga agagcgacga cacgcagcag gtggcgcgct
    89941 tcacggcctc gagctgcttc tccgagcgcg cgctggcgat ggagagcgcg ctgttcacga
    90001 tgttggacgt gtcgcgcacg tacttggtct tcagcgcggc gttgatggcg tcggcgatct
    90061 cgttgctgct cacgcaggac tcgtcggtgc tcccggtgac gtcgtccagc agcgcggaga
    90121 cggtcatgtc gggcgacccg cccacggaga ccagccggtc gatgaggttg ttgggcatgg
    90181 ccatcaggat gctctcgccg gtcagctggt cggtgtcgat gaggctctgc aggttgtgct
    90241 tgaaggccac gttctcgggc atgaagcagt ccacggacat aagctcgtct atcgtgttgg
    90301 ccgagaagat cccccggacg ttgatccggt cgagaattcc caggttgttg gagagcacca
    90361 ccgcggagct ggagttctcg agcgtctcgg cctcctcgcc gccgggcgcg ccgccgtaga
    90421 tggtgcgcgg gaaccgccag ttgaaggtcg cgtacagcgg agcccggcac tgagactggc
    90481 cgtggtacgt gtgcgcgtcg cgcacgttcg tggccgtgac catgaactgc aggaggtcgt
    90541 gcgcggaggc catgatcttc tccacctcgt ccttgctgca gcagaccttg gtcaggatgc
    90601 gcgagacggt gtgcttggtc acggagggcg agacggtgat cacggtctgg cgccggctgc
    90661 cgtacacgga cgagctcacg tggacccgga accccatggc gccgaagagc agcttcacga
    90721 agtcggcgtg gctctccttg ttgatgtagt gcacggggcc cttgtcggtc atccggatac
    90781 ccgcgtaggc catcagcacc tccttcagcg cgcggtcggg gtcgcagcgg tccacgacgc
    90841 ggagcagctg gaagaactgc atgaaggcct tgtgcgacag cccgatgtgg ttgggctggt
    90901 gggtcgagcg ccgcgggaac tcccgggggg agatcaggtt gatgctggac agcgtctcca
    90961 ggaccagcgc ggccaccgtc ttggtgccca ccgcccgggg gtagaagcac acgcgcagcg
    91021 gcgtcttccc ggcggccagc gcgtcggcga gccccgagca gtacgtgacg tcctcgtggt
    91081 cgaacagcgc gaaggtgtag caggtggcgc tgaggaacag cgcgtcagcg gtgctcatgg
    91141 ccttgaattc gctgtactcg agcccgtccc agaagaggct cttggccggg gcgatcagcg
    91201 gcgaggtccg gtcggcgcgc atgagcatgg agagcaggct agtgtagtag ctcacgttgg
    91261 cggagatgtc cacgaacttc atcccgggcg ccgcgatgcg gacgggcgcg ccgccggtgg
    91321 tcagcgcgtc catgtggtcg gccaaggaca cgctagagtg cagctgcgtg agccgcacca
    91381 gctggctctg gtagaagatg gacgccgcca ggctggccac ggtccccttg accatgcgca
    91441 ggttctggcc gttgaaggtg agctgccgca gcgagaagtg ctgatcgaag tactggaaga
    91501 acgtgagcag gtacttgagc tgcatggtcg tgatctcggt gtccacctgc ggcgtctggg
    91561 cgagcacgat cccgtgcttc gcggcggact caggtatctc gtaggcggcg tcgaagcggg
    91621 cgcgagaggc gtcggtcagc agcgcgcgga tgttcagcag catgagcagg tctctggcga
    91681 tcacggtccc gtccaccatc cgggcgcgga agccgatctc gggcggcccg aggatgtgcg
    91741 ggtacgtgag gttgagcagg taggtgttgt cgaagctgag cgccgggaag gagatggggg
    91801 acttcacctg caggccggtg gggtagcgca cgtagccccc ggccacgcgc gcgtgcgcct
    91861 cgaagctgga cgtccgcagc ttcaggagct cgcgcgtgaa cggggggacg tcgttgaacg
    91921 cgagggtgca cacgacgggg ttggcgatgt ccgtcagctt gagccgcttc gtgaggatct
    91981 cggcggagtt aggcccgacg gtcgccggga tgaggtacga gttggcggac ttgtccagga
    92041 ggtagttgat gccgaactgc ttcacggtca cctccgtctc ctcgtcgccc atgagcttct
    92101 ccagcccgtc gaggaacatg gagtccagcg ggtggacgta ggtccgggtg aggtcgtagc
    92161 tgggcttgaa gtccgcgcac agcgtgggga gcacgttgga cacgatcctg aacatgtatt
    92221 ccgcgccctc cacatggtgc atcgccattt ggacgtttga ggccgtcatt tatttagtat
    92281 taaatgacgg ccgtaccggt gaccgatatt cctggagact acgggccgac gtccttttcc
    92341 gaggacaact acccgctgaa caagcactac gagataacga aggggcagct gtccatcctc
    92401 cggacggtca acgacaagct gctcgcgcgc accgtccagc cgtccgacga cgaggacgag
    92461 gacgatgagg acgaggacga cggactggag atcgaggagg tggacgacga ctacgccacg
    92521 agcccgctcc cgcccgacga ggaggagccg gacacctgcg tcgcgaaggt catgcccgag
    92581 gccgacctgg tgatgccgaa gaaggccgac ggctacatca tagccgccga gcagcagcgc
    92641 caacagcgca tcaacattct ggtatccgat cgagaagccg tggtggagag ggagcccgtg
    92701 cagaccgcgt tcgcgcgcgt ctcagcgatc ccgatccacg gagacgccgg gcgtcgcacc
    92761 acggcctcct tcgccacgac cacgccctcg ctgggggccg tcttcgacga ctccaagcgc
    92821 gtgcgcctgc tggaggagga ggtaaaagag ctccgcagaa aatgcgcggc atctcaggat
    92881 aacggtaatc tggagaactt caccaaggtg ctcttcggga agacgccgcg ggcgagcgag
    92941 ctcaacaaac gcgtggtcat cgtcaactac gcgacgctga acaacgtgac gctgtcgctg
    93001 gacgacctcg aaaagtgctc tgacgaggag gtcgaccgca tgtactccgt gatccggagg
    93061 tacaacgaga cccgcaaaaa gaagatcctg gtgaccaacg tggtcatcat cggaatcacg
    93121 attctggagc acgcgctcgt caaactgggc ttcgccgagg tccgcgggct aagcgccgac
    93181 ctctccacgg agctcatcga cgtggagatc ggggaggact gcgagcacat cgccgagcgc
    93241 atcgggttcg ggaacagccc ggtgctgaac gtcgcgctgt tcgtcataaa actgttcgtc
    93301 cggaaactca acctcatcta gcctctagca catgccgccg tcgaggtcca tgacgctgtt
    93361 tatggtggcg aggccggggg tgcgtcggcg cctggtggcg gtcgagctag atgaagaagt
    93421 gccggaagat cggcggcggg aggtcgagga ggtcgaggac gactgggggc aagtgcctga
    93481 cctgctgcct gtgcatgtct tagtggtctt ggacctggac gtcttcttcc tgcctgcgtt
    93541 cacgcactcg acgcccagca ggtcctcgca cacgtcgccc atggtcccgt ggacctccag
    93601 cttgccgtcc ttcatcacgc cgtacacgat gcggccgcag ttggacacgg cctgcacggt
    93661 ctcggcgtcg caggcgtgca ttccggagga agagataccg ccgtcgccgc gcctagaggg
    93721 cgccccactg cgtcgggacc tggatgacga cgtcttcgtc gagctcctgg aggtccgttt
    93781 ggtgcgtgag gaagaggagg atgaaccgcg gcggctcgac gcggcctcca gcgacccgcc
    93841 ggcgcaagcc tcctcgccgg tagcgccacc acgcaccacg tgatcgctgt tgaggtgcgt
    93901 cagcaggctg cgcagctgcg gcgctatctt gttcagggtc tggatgtagt catcgtagct
    93961 gctctgcgtc ctctgcgcta tcctgtccga cgccatttat tacgcgaaat attctttcgt
    94021 cagcgtcgac tctcgcgtcg gagaggcgac tagaccgcag cagttgcctt gccgccatcg
    94081 ccctcgggcg aggaggtcac cagacggtgg aaggccttca cctgatcgtc ggtcatcttg
    94141 tcgtcgaacg acgaggttcc gggaacgggc tggtccctgc ggccgggcac ccgaggggcg
    94201 gtggacgcct tgcggtacag catgatgatg atgtaacaca cgatggagat gaccaccacg
    94261 gtgagcaacg cgtcgagcaa ccccatttat tactgttaat tgcccacccg ttcggacact
    94321 agcgggcggt gagctcgatg tcggtctggt tcaggcgctc gtagggcatg ctctttgagc
    94381 agcgcctgta catggtgaag acgaacaggc cgaccagcag gatcgagccc acgatgaagc
    94441 acgtgacgct cagcgcgcgc cacacgtagt ccgttacgtt ggtgttcttc ccgaagtcga
    94501 tgcaggcaaa cacacacgcg gaggcgagca gcagcactcc gcagaccagc aggccggagt
    94561 agtaggactt caaggtgtcg aatatgtcca tttatctgag gagaaattta aataaccgaa
    94621 tggacgaagt ggaagagaaa ccacgagaac acgacggact ggagcacgaa tatggtgctc
    94681 agcttcgttt ggggggtcat gtacacgttg gcggccatgg ccgcacagaa tatcagcacc
    94741 aacaccgccg ggtcgtagtc agacaccatt tactatgcta aaaggcgggg cgcaatactc
    94801 ggcgtccacg aggacgagta cccgagcgcc cgccggggcg ccggcagcca cgaccgcgag
    94861 ctggcccgcg gtggggttca ccagcagcag cgcgcgcgcg tcgcgcggca cggaggcgtc
    94921 gtactccatc gtgcgcaccg agcgcggccc gagcgggcgc ccgcgcgtgt cgaacagcgc
    94981 ctccggaaac cgctcgcccg agttcagcac gatgacggtg ttatcgtcta taaacattta
    95041 tgacctttgt ttctagcgat cgtctcgagt acaccgccac gaagtaaaat atcaccgccg
    95101 ccgccagcgc ggccaccgcg aacggcggga cggcgggcag gaacgcctgc gcgttgtcgc
    95161 gcacgcccgg gtccgggtcc gcgtagcccg cggcgacggc cttgccgcag tcggcgatca
    95221 tgtccgcgcg cgagttctgc atcaccaggc tgtccacgtc gatgcgacag cccacgtact
    95281 tgcagcgcga gcgctgcacg tcctggctga agaacagcca ctttcggtcg cgcgactggt
    95341 ccgtgcactc gtgcgcgcgg cagacgcgcg ggcccaggta tttccccagc gcccggccgg
    95401 tgacgcacgc gcactcgggc gccgatcggt gcgcgtcgca gtagcgccgg agcgccgagt
    95461 cgccgaaggc gaacagcgac ggccgcgcga cgcgcgcgaa ctccgagcag aaccgcgcgt
    95521 ccatgtgctt ggcgcacagg ccggcgtacg cgtccagcgc ggcgtagcgc cccgtgcgca
    95581 gccagtccat gcactcgggc gcgtcgggct ccaccgcgca ccggctcgcc atgaccaggt
    95641 cgcagtgcgc ggtcttgtac ccgttggcga gcacggacgg gcagtccggg gtcggccggg
    95701 tgcagcagcg cgccatggcg gcgtccgtgg gcgcgggccc gctcgccatc ttgaacacgc
    95761 acatggagcc cttacgcagg tacggcttgg cgctgtcggg gatgtagtcc gcgcgcagca
    95821 gcgaccccgg acggaagaag agcgagtcgc acggcgggcc ctgcaccagg cgcgcccggg
    95881 cggccacctc cttcgagagg aagcggccgc actgcccggg gtccatgtcc ggcagcaggc
    95941 agaaccgcgg ccgtatttct ttagcacgca cgtcagagaa cgtctccgac tcctcggcga
    96001 agttgaaggt gtccacgccc gtcgtgtgcg tgatgcgcag cgcgtactcg cccggcgccg
    96061 gcgtgtcgat cacctccacc ttggacacgg agtcccccat ttggagcgcc tatttatccc
    96121 gtcgcgaaat gatccgcgcc cgccctactc ggcgaagaac aggtcgtccg acttggctcc
    96181 ggcgtacacg gggcacgcgg gcgcggcgga ggacatgcgg ccgcgcagga tgccgcggcc
    96241 ggtgagccgg aacgcgtaga tggcgaagag gagcccgagc acgatgtaca tgagcgtggt
    96301 ggcgcccacg gacccggtca cgtgggagac gatgatggtg atgatggaca tcagcgtgca
    96361 gacgatggcc atgccggcgt tcccggcggc gttggggtgc atgatctgca tggccgcgca
    96421 gtaccccacg acgaggcacg gcagcggcag aataagtgag gcaataccta tcattaccag
    96481 agcgagcacg ggggtggacg tcagggccaa tacaaatatc accacaccta ttaatactcg
    96541 gacgtcctcg tattgaagaa cgctgtatgg cgccacgttt ccggcggggc ctggcctggg
    96601 aacgataggc aggggaggcg cgtccgggtt gctcgggtcc ttgggaagga aggcattctg
    96661 ctcctcggtg gtgaagagct cggcgtcctg gacgccgccg ccctcgaact cttcgacggg
    96721 gttgtagtaa ctgtagtagc tgtttgccat ttatatgttg aaaaatgttt agaggagtac
    96781 aagtggacga taaactctat gcgtacttaa aaaatctggc gggctacaac cgcccgctgt
    96841 gtctgttccg ggacaacggg gagttcgccg aggtgttccc ggggtcggcg ttccggttcg
    96901 tgctccccgt gggtctgttc tcggacctgc gggtgcgcag ccgcggcgtg gcgttccccc
    96961 ggctccgcga ctccgcgcgg atgcgcggcg tggacgtcgg cgagaacacg ctgccctcgc
    97021 tgtaccccaa ccagaagatc gtggtggacg aggtgctcgc cgcgcgcgac cagctcctcg
    97081 cggccgggcg gtgcgtctac gtcaccctgc acctggcgtg cgggttcggc aagacgctga
    97141 ccgcgtgcca cctcatcgcc acgcacgcgc ggcgcgcggt ggtctgcgtg cccaaccgca
    97201 tgctggtgcc gcagtggcgc tcggcggtgg cggagctgcg cgtgcccttc gtcgtctcct
    97261 acgacggcgc ctcggcgctg ctgcgctccg gcgagctcga ccgcgccatg gtggccatcg
    97321 tggtcagccg gcacttcgcc aacgacgagt tctgtcgggc ggtgagccgg cgcttcgacg
    97381 tgctggtgct cgacgagtcg cacacgtaca acctcatgaa caacacggcg gtggcgcggt
    97441 tcctggtgaa gtacccgccg cccatgtgct acttcctgac ggccacgccg cgccgcgcga
    97501 accgcatcta ctgcaaccgc gtggtcaacg tgtccgtggt cagcaaactc tcgaaggtgg
    97561 tccgcgtcgt ggacgccttc ttcgaggcgt actccacgcc taaaatccga aacatggcgc
    97621 gcagcctgga gggcccgcag aacaagtacc acgtcttcac cgagaagatc ctcgcggagg
    97681 acgtgcaccg gaacaagctc atcgtggaca cggtggccgc ggccttcgcg gacgggacgt
    97741 ccagacgcgt gctggtgctc accaagctcc gcaaccacat ggtggatctg cacgccgcgc
    97801 tggcggaccg gctaggtgcg gacctggtct tcctcggcga cgccaagaac aggaagaccc
    97861 ccgagatcac gcgcgcgctg cgcgagaagg accgcttcgt gctggtgtcc acggtgttct
    97921 tctcgggcac ggggctggac ctccccaacc tggacgcgct ggcggtggcc gccgccgtgc
    97981 tcaaccgcat ggtcatggag cagatgatcg ggcgcgtgtg tcgcgagtcg cactcggacg
    98041 cgcggacgct ctacgtgttc ccgacctcct ccgtgcgcgc catccgcgac accgtggccg
    98101 cgttcgcgca gcggctggtc gcgctggcca ccgacgggct ggggttcgtc cgggagcgcg
    98161 ccgcggccgg cgcaaaaaac gacgaacccg cgctgtacag cgccatcaac ggacgagatc
    98221 tcgcagcggg gtgagcatgg acccgcacgc cgcgcacgac agggtgcctg cgcacttgat
    98281 gaagtccagc gtctggaggc gcgtcacgtc ggacacggtc acaagccgcg actggcacga
    98341 cgagcacgtc gggcagtccg tgtcgccgtc cacgacggtg gtcacccgct tcctcctgcg
    98401 ctttttgtta ccccctgccg cggcggcgtc cctacccggt gctgcctgcg aactcatatc
    98461 gttttattta tcataaaaac acgctcgcgt acgcgtccgc gcacacgtcc cgcagttccg
    98521 cgcgtccgcc cccgcagcgc acgaacttgt cgggatcggc ctgcggcatg cgtgcgcaag
    98581 gcaggggcgc gccggcggcg tccgtcatga cacgcgccac gatcccggtc gcgcccagcg
    98641 cgtacgacac caccacgccg tccacgcacc ggtagacgga gcccgcgctc gccagccggt
    98701 cgaaggcggc ctcctcctgg cgcagcttct cgaatatgtg tgggacgatt atgttaaaaa
    98761 tgagaacaaa atagcagatc accaaaaaca gcgaaatcat gacttcggaa aacgatttat
    98821 atacgttgaa agagctcatc cggcttcgcg actccctgca cctcgtcacc ggcagcgccg
    98881 tggaccggta caacgcgctc gtcgagtggg ccaaccgcac gtactggacg gtcgcggtcg
    98941 cgcccaccgc gccgtgcgcg tccatcgagc agtactaccg cgccgcgcgc gcggactgcg
    99001 cgctcgagcc cggggagtac acggtgagcc ggctccactt cggcgccacg cacgcctggg
    99061 tccgcggcgc cgtcttcgac tccgcgagcg gggccgaggt ggagccgccc cccgaggtgc
    99121 gcgcggcctg cgaggcgctg gacgccaggt acgccgacct gaccttcgtg cgcttctccg
    99181 tgttccggca ggtgtggacg gcggacgacg ccgtcgccga ccactccgcc agcgacgcga
    99241 tcctggccga gtgcgccgca ctgggcgtcc gcgccgcgcg gacgatgcgc gtcgagatcc
    99301 gcgccggaga cgcgttctcg cgcgcggact tcgacgcggt ccaccacgcg ctcgccgcgg
    99361 acggcgacgc ggggttcggc acggccgtct gcctggcgcg gcgcggcgtt ccgcagcgcc
    99421 gggtcgtcga ctgctcgcag cgctgcttca tgcgcgtgaa gggcatcgac ttgacgcccg
    99481 tggacgcgcg gcaccacctg ccggtgctgc gcaccgcggg cggcgggtgc gtgctgagcc
    99541 gcggcgtggg ccacctcgtg gacgcgcgcg tgcgcgaggg cgtcttcgtg gccgtgcggc
    99601 gctacgcgga ctgcctggtg ctctgcgacg acgcggcccg gtgcgccgcc gactgctcgc
    99661 gcgaggaggc cctgcggctg ctcgtgcggc gcttcgggcg ggactgcgcc gtgagcaacg
    99721 gctacgtcgt gcgcgtgcgg gacacggacg tgcgcggcat cgccgcgcgg ctgggcgcgc
    99781 ccgtggcgtg cgacagcttc gacgcgctgc gcgcggccat cgtcgcggac aggacgctct
    99841 cccgccggct acgcgaggcg ggcgcgataa aaatggcctg cgagtgcatg ggttacccgc
    99901 atcgcgacgc tatagagctt ataaataata tgcggtttca aatatcggac gatggcgagg
    99961 tggagcgctt cgagctgagc gacgcgtcct gcctggtgaa ccccaccgcg gagtccatct
   100021 tctcgagctt ctcccagttc gtgaccatct tcaacctgct gtcctcgatc ctccgctagc
   100081 ggcatgatcg tggcggcctt cgacttgggc accaagaacc cggcgcggac cgtgctggag
   100141 gtgctcgacg ggaccgtgcg cgtggtcgac gtggccaagc tggactggag caaggactgg
   100201 gagaagcgcg tgcaccgcga cgtgaccgcc ttccccgcca acgtggtgct cgtggagcgc
   100261 cagtgcaaga tgtcgccttt ttctaagttc atctacttca tccgcggcct gctctacgac
   100321 ggccggcgcc gcgtgcgcgt gatcgcggtc ccgcccgcca tgaccgggag cacctaccgc
   100381 gcgcgcaaga ggcggtccgt gcgcaccttc ctggccctgg ccgagagctt cgggatcctg
   100441 gactccgtcc cggccaggaa aaagctggac gacgtcgcgg acagcttcaa catggccatc
   100501 aactacgtat tgaaaacaaa ctgaaataca attatgacga ttcaaacatg ctcggactgt
   100561 tctcgttcct gcggtccgtg gaggactcgt accgccgcac catcttcaac ttccacatct
   100621 cgcacagcgc ggaggtgggg gatgtctacg gggtgctgcg cgaccgcatc ctcggcgcca
   100681 ccaccttcga ggaggtggcg cccgccggcc tcggcgcctc gctggccaag gtggtgtact
   100741 gcgacatcag cacgaccaag cacatcgtga accacgccgc gttcgcgccg cgcgcgcggc
   100801 cgacgcgacg cggcgccgcg ctctcgcagt tcttcgacgt gcacgtcggc gacgacgcgt
   100861 gcagccggcg cacggcggag atcttcgacc aggagcggtc ctcgctggtc tcgtacgtga
   100921 agaccacggc caagcgctgc aagatcgact acggcgagat caagcgcacc atccacggcg
   100981 gccgccagag ctacttcgcg gggcggcgct ccgacgacta catgtgcacc accgtgcgca
   101041 ccgaccccag caagccctgg atcaagtcca tctccaagca gctgcgcgtg gacatcctgc
   101101 accactcgat ctccacgcgc gggaagagct ccatcctgca gaccatcgag atcgtgctca
   101161 cgaaccgcac ctgcgtgaag atcttcaagg actcgaccat gcacatcatc ctctcgaagg
   101221 acgactcaga gcgcggctgc gcggacctgg tggacaagct cttcgggacc tacgcgatca
   101281 cgttccgcgt gatcgccgcg atcacgggca ccgcctgctt cgcggaggtc gcggaggcgt
   101341 ccgcgcgcgt gctcgcgctg gacggcgcgg acgcgaagat cgcggccatc gaggacatgc
   101401 ggcacgcgta cggcgtgcgg aacttcaaga tcggcatgtt caacctcacg tacacgggcg
   101461 ccatcgagca cacggtgttc ccctcgctga tcccggccga cagccggatc aagttcttca
   101521 agggcaagaa gctgaacatc gtggcggtgc gctccaccga ggaggggcgc gagtgcgtgg
   101581 accaggcgca ggcgctgctc gcgctcatgc gcgagcgctc cgcgcggctg gaggccgtgg
   101641 acgtgaccgc cgccagcgtg gacttcctca aggagctgct cgtgagcgga tagtgaaata
   101701 atatcgattt cataaatatg gagcagtcgc tcggatacaa gtttttgttg cccgacccca
   101761 aggccgaagt ctactaccga ccgctccact tccagtacga gtcctacgcc aacttcatca
   101821 agcaccggct caaggacatc ctcaccgtgc gccgcacgct gctcaccttc aagaacggca
   101881 ccgagtccat cgtgctcgag atcgacgatg tcaagatctc cgcgccggac ttctcgccca
   101941 tcgtggccag catcaagggc cagagctacg aggcgctggt caccttcacc gtcaacatct
   102001 accggcaggt catgaccaag gagggcctga ccgtgaccaa gatcaacagc tacgagggca
   102061 acgactctca cctcatcaag ctgccgctgc tcatcggcta cggcaacaag aacgcgctgg
   102121 acccctccaa gtacgtggtc cccaactcca tcggcggcac cttcatcaac aagcagtcca
   102181 tcgagaagct cggcatcaac atgatcgaga agatcaccac ctggcccaag ttccgggagg
   102241 tgaaggccaa ctcgttcacg ctctccttct cgtccatctc cgcctcgcac gtcatccccg
   102301 cgcggtaccg ccactacaag atcctcatgg acatgaacca gctggacaac ttcgtgatct
   102361 cctccgcgaa gaccttcatc accgtcaacg tcatcgtcat ggtgcagttc ctggcggacg
   102421 tgagcctgga cttcgtcgtc cggaacctct gcttcgacat gccgcccgag gccgcgcacc
   102481 tggccaccgc gctggtggag agcgcgaaga ccgtgcccac gggcggggac atccccgagt
   102541 acgtgaacgc gctcatcgcg gccgagcacg ccaagcagaa gtccccgctg agcaaggacg
   102601 agttccgcta cgagatgctg aacaacttcc tgccgcacat gcaggacagc cccaaccagc
   102661 tcaagggcct gtacctgctc tcgctcgtgc gcaagatggt ctactgcgtg ttcttcccgg
   102721 accgctaccc cgaccgcgac tcgctgatct gccaccgcgt gtacacctac gggcgctact
   102781 tcgaggcgct ggccatggac gagctcgaga cctacatcgg gaacatccgc aacgacatcc
   102841 tcgccaacca caagaaccgc ggcacctgca ccgtgagcat ccacgtgctg accacgcccg
   102901 ggttcaacca cgccttcgcg gcgctgctca gcggcaagtt ccgcaagtcc gacggcagct
   102961 tccgcacgca cccgcactac tcctggatgc agagcatctc catcccgcgc agcgtgggct
   103021 tctaccccga gcaggtcaag atctccaaga tgttcaaggt gcgcaagtac caccccagcc
   103081 agtacgggta cttctgcccc tcggacgtgc ccgagcgcgg cccgcaggtg gggctcatct
   103141 cgcagctctc ggtgctgagc tcgatctcca acatccgcac ggccgacttc gtggagctca
   103201 ccaagaaggt ctgcgactac atccgctcgt acccgcagcg cgacatcagc tacttcgaga
   103261 ccgggttcgc ggtcaccgtg gagaacgcgc tcgtggcctc gctgaacccc gcgatcgtgg
   103321 acgccttcgt gctggacatg cgtcgccgca agcgcctggg cttcttcggg aacaacgaga
   103381 tcagcgtcgc gctggtccgc gaccgcatga acgaggtgcg catcaacttc ggcgccgggc
   103441 ggctcacccg cccgctgctg gtggtcgaga acggcgtgct cgtgatggac gcggagatgg
   103501 agcgcctgca gcgcgacatc cccgcgatga ccttctcgga catccagcgc gagttcccgc
   103561 acgtgatgga gatcgtggac gtggagcagt tcagcttcag caacgtctgc gactccgtgc
   103621 agcgcttccg cacgctgccg cccgaggagc gcgcgctgta cgacttctgc gacttcccgg
   103681 cggagttccg cgacgggtac gtggcctcct cgctggtggg catcaaccac aactccgcgc
   103741 cgcgcgccat cctcggctgc gcgcaggcca agcaggccat ctcctgcctg agcgcggacc
   103801 tgcgcaacaa ggtcgacaac ggcatccacc tcatgaacgc ggagcggccc atcgtgctca
   103861 gcaaggcgct ggagacctcc aagatcgcgg acaactgctt cgggaaccac gtcaccgtcg
   103921 cgctcatgtc cttcaagggc atgaaccagg aggacggcat catcctcaag cggcagttcg
   103981 cggagcgcgg cggcctcgac atcctcacct gcaagaagta ccaggtcgag atcccgctgg
   104041 agaacttcaa caaccgcgag cgcgtgcgct cctccgcgta ctccaagatc gacgtcaacg
   104101 gcgtggtgcg cctgaacgcc ttcctggagc agggcgacgc catcgcgcgg aacgtctcct
   104161 cgcgcacgct cgacgacgac ttcgtggccg acaaccagat cagcttcgac atcgccgagc
   104221 gctactccga catctacccc gcgcgcgtgg agcgcgtgca ggcggacctc accgacaagg
   104281 tcaaggtgcg cgcgctcacc gtgcgcgagc gccgcgccat cctcggggac aagttcacca
   104341 cgcgcaccag ccagaagggc acggtcgcgt acgtcgccga cgagaccgag ctgccctacg
   104401 acgaggacgg gatcacgccc gacgtcatca tcaactccac ctccatcttc tcgcggaaga
   104461 cgctctccat gctcatggag gtcatcctga ccacggcgta cggacacaag cccttcgccg
   104521 aggacggctc caaccgcccc atctgcttcc cgagcaccaa cgagaccgac ttcgagacct
   104581 acatcgagtt cgcgcggcgc tgctacgcgc tcgcgcaccc ggacgcccgg ttggacgacc
   104641 ccgaggtcga gagccgcatc ttctgcgagc gcgtgctcta cgaccccgag acggacgagc
   104701 ccttcgcggc ccggatcttc ttcgggccgc tgtactacct gcgcctgcgg cacctcacgc
   104761 tggacaaggc caccgtgcgc tgccgcgggc gcaagaccaa gctcatccgg caggccaacg
   104821 agggccgccg ccgcggcggc ggcatcaaga tcggcgagat ggagcgcgac tgcatgatct
   104881 cgcacggcgc ggccttcacc gtctcggaga tcctgcgcga ctccgaggag gacgcgcagg
   104941 aggtattcgt ctgcgagaac tgcggcgaca tcgccgcccg gataaacggc acacacgtgt
   105001 gcatccggtg ctcgaagctg agcctctcgc cggtgctcac gcgcatggac tccacgcacg
   105061 tatccaaggt cttcatgacc cagatgaacg cgcgcgggat caagatcaag gtggagttcg
   105121 agaagcagga cccctgcttc tacgggactc cgaaacggtt cagtctgcag cccgacgaga
   105181 cgctgttctc gtctgaggac tgaacctctg cggtcgcgcg gcgccgcgtt ttaggctgct
   105241 aatatagcat acgatccgcg gcatcgccgc acctacttac ccggcagcct ctgcgattcc
   105301 taccttttcc gcgcgcgtac acactacacc actcaccata tggcggcgtg gcgcccccac
   105361 caccacggct tggggccgcc gtggctgacc ctgggcggcc gccgctgccc gcagtcgctg
   105421 cgcacgcccc agttgcccag cacgtgcggc ggcgggaggc tcccgtcgat cgcgtgcttg
   105481 gtcacctcgg cgcccggccg gttgcacgtc tgcacgtccg tcttgttgga caccagcacg
   105541 gcgtactgcc gcatggtctc gatgtggtgc tccaggtgct tcccggcctc gcggttctcc
   105601 tcgcagcagg tcttggcggt ggctatcgtt tcctccaggg gcttcagcag cgcgtccacc
   105661 cgctggggca ggacgcacac ggaccccgag gatcccactg gcttctgggg gaaggggctc
   105721 acgggaatgt tcccgtcgta cctgtcccac agcatgcgga ggtacgtggt accgtcactg
   105781 tcctcgtgcg tccagacgcg gtggcgctgg tcgcagcgcc cgtcgtacgt gagtcggtcg
   105841 cgcctttcat aatagtttct gcttatgttg tttgggtctc cgtactcgta gtagtaaagg
   105901 tcgtagctgc cgggaggagt aatgtcgttt tcatctttgc tcgtgtgaac actaggataa
   105961 tatgaaactc taacggcgct acagtctatg gtttctggtc gcgacagttg ttcaagcact
   106021 ccctgcacat catggtccac agatttgtac actgcaccgt cgtgctcaga agggtgtata
   106081 aatatgtcca tcgtgaaaga cgtcccagtc ttggagaatg tgtcccaggc ggtgaagcat
   106141 agtccgtcca tgacgaactc ggggacgctc atcacaaatt gaaaaatgtg gagtttttca
   106201 aacacaatct tcacatggtc tttgtcgctg acacgcgtgc cgttgacctc tgacataaac
   106261 tgaatgaatg ccagcgaatg acgtgtatat tccatggtag ctgggttttt ccagtttgtt
   106321 tccagttttt tgtagatgct ttttgcatca acaccgtacc accaaaacat gggaacgccg
   106381 aaataaattg cactgttcgt gtaataagat gctaatgcac ccatattgtt caaaaagtct
   106441 aaacaaaaaa acgttgtttg tctatcgatg acatctctag agctattctc gcccactcca
   106501 ggaaattcca tgataagctc gtcgtgggat atatggcctg tcattagctt tttaaccact
   106561 atcaagtata gttttcctag tgtggacaca tttacgatgt ttatcttact atgcgcaccc
   106621 aacgtagtag cgtgcttgct taaccagtcg tcgtctacga atatcttacg atacattgga
   106681 ttttgctcta tgtactttct aaaatacagg ttcagtggtc tgttagcaac gttttttccc
   106741 tctatgggag gtgctaattg tatatacttt cttaatatat cacgtataag cttcctgtct
   106801 tctcgaggta tgcatgatac agactttaac ggatggtgcc aatgtcgttg caccaaagac
   106861 ttaaacctgg caaccaacga atcttcactc tccatttata attaaataat tagtctgcgt
   106921 tcaccaaatg ttaccgtccc gtccccgcca ccacgtactg tctaacggga acctatatgg
   106981 atgatgtctt aaaaacgggc gcgttaacaa cgatctgcgt gctactgaaa gcggtctttc
   107041 tacttctcta acagaagata gactaccatt gacggacgcc aatgaagtaa caccgctggg
   107101 tttcgaagaa caacagggct taggaatact gcgtatagcg tcttctaatg gtttaataag
   107161 actgtccagc ttgttaatat ccatacacac gggttcttca tcccctatcg cgtcgtcctt
   107221 tttaggcacg tccggtttta tttctagata tccaatgaac cggtctctca acattctcct
   107281 gtatgtagtc ttatcattgt ctaagtcccc taaaaagcgt agttttctac acgattttct
   107341 atcatacgta agcctgtctc tgcgctcaaa ttcgttatcc gttataggtt ctacggaact
   107401 gtaatgttgg aaatccaagt aatatccgtt attttcgcta ttacgtgtaa acattattgc
   107461 ctcacttttg tttacatcgt gttgtttgtc aaatgtatcc tccatctcgc gaggctgtct
   107521 tcgagcacga gctccaactg gaatgtgtaa gacacgtcta ctgaagctcg ggtgatacga
   107581 aaatcgcaga gcgctacaat ctatcgtatc cggttttgtt attccatcca atacgccctg
   107641 tttgttatga tctatggatt taaacatcgc gccgttatat ctgtttggtg taataaacac
   107701 atccaaataa aacgtcgttc catactttgt tattttatcc cacactgtgt aacatagacc
   107761 atccatgaca aactcaggaa cagtggcaat aaaattagtg ttaaaattgt taaacgacac
   107821 gtttatacga ggcatatttg tatctgcctt atcatatatc tcggtcatgt atttgacgaa
   107881 cgatatagca ccactagcat acttttgttg atctgatgtg ttaaaatatt cgttgatttt
   107941 tttgttcaca ttttcctcta ggccagatcc acgccaccag tacatcggca cgccgaacac
   108001 caacgacttg tttttataat acgtggatat agaccccatg taccacataa agttgtagca
   108061 aaaataatcc atctgtgtat ccacagcagc tacgtcattt ggatcttttc catccatgat
   108121 agtcatgcca ttgctgatac taccagtcat tattctgtaa actatcatta ataaaaatct
   108181 gcctactgtt cccatgtcgt taaaatcctt tatagcaaca gcgctttcat aaagccatac
   108241 attgttttta aaaagctcct tataaaccgg atttttgtcg acatatggct tatagaacaa
   108301 gtttataggc ctgccaacgt ttttgttatt atcgtccaac ggtggtgcat ggttgatata
   108361 ctcgcgaagt aagtctctaa ctagcttcct gatttcaact ggaatgcacg ttctattatt
   108421 caatgtttgg taccagttac tgctaacgaa agttctaaat cgctccacca gctcttccat
   108481 ttataattaa ataataatca acatagctta taacgaacga aggtcgtgtt aataatatct
   108541 ggagtatccc gtctgaacgt cgattttagt gttaagattc aaaagtgctg ttcgcaggct
   108601 ctccaggtgc ctctccaatc tgtccaggcg ggcgccagtc tcccgacagc agtcagttat
   108661 ggtcttgtag ttgtccagaa ggctgacgag tcgctcctcc acactttcgc tggagggagc
   108721 accggcggtg tagacggcac tgccgtcatt ttcgttaacg ccagtgccca acagattctc
   108781 tccgtcgttc tcatccatga cgaacggcag ttaagtattg cctttattta aagtattgat
   108841 tttaaaaaaa ggcaggcctc gctggactgg ttcggcggca aacacgggtt gaagacgcgg
   108901 aagtcgctga cgtcggtgaa tatctcgtcc acgcacgcgt ccacggtgcc gaagcgcgcg
   108961 ggcgacacgc cgtcgtgcga gcggaacccg aactccgagg ccgccaccgc ggcgccctta
   109021 aagatcacac agcgccactt cttccgcgcg tcgaagacct cgtcgttggg gtcgtacacg
   109081 cgccggtcga cgcgcggccc gcccgccgtg cgcgcgaact ccagcgccgc gttggcggag
   109141 ttgaactcgc ggatgttgtc gtagttctcg tagacggccc acatctgcag cgcgacgaac
   109201 atggccgcgg ccgaggccag ggccacacag agcgcggaca ccgcgtccat ggtttttatg
   109261 tgccgaatat tcacgcgtcc gcgcgcgccg cgccgcgcgg gcggagctcg gcgtcgcgca
   109321 gcttgacgaa cgccgcccgc acggcgcgca gcagctcctc ggtgtccgcc gcgcgcacgt
   109381 cgaagcggtg gaagctgtcc atgcgcgcgt tgcagccgaa gaagcgcacc acgcacgcgg
   109441 tgaggatgtc gttcacgtag agcacgcccg aggcggtgca gtacacggag gcgggcacgc
   109501 gcgggtctgg cgtgccgtcc acagacacgg cgtgcgcgac cacgtcctcg agcacgcgcc
   109561 gctcgagcac ggcgaggaag tcgcggaact ggcgccggtc gtccagccac gcgtacgtgg
   109621 tgatcaggaa ggtgagccgc ccgcgcggcg cgatggcggt gtagggcgcg tacccgcgga
   109681 actccgcggg gtgcacgatc cgcacgttct cgtactcgcg gcggaaggcc tcggtgtcca
   109741 ggaaggccgc gagcgcgtcc accagctttt ccgtcacctc cgtgcccgcg ccgaaggcca
   109801 cgagctcgat ggtctgctcg ctcttggggc ggtagtcgtg gaaggtgtgc agcagcatct
   109861 cgcgcatctc cgccggcttg ggcacgggct cgagcgcgtc gccgcgcacc aggtagtagt
   109921 cgaggtcgtg cagcgtgacg tactgcccgg cggcggtctg cgcgaacttg aggtgcacgc
   109981 acagcccggc cttccggtcg agcacgtccg ccacgtgcgc gtggaagacg tgtcgcgtgg
   110041 gcatgctctc cagcgcggtc agccactcct cgttcacgca ggtggtgctg ttctcgagca
   110101 ccacgccctg cgtgagcgcc ggccagctga cgtggaaggc gaactcgtgc ttgatgagcg
   110161 aggccacggc cgggggcagc tccacctcga cgcgcgcctc gccggtaacg gcgcgaggct
   110221 gcgcgtccat tactgcgagg gagacgcgtt gcgcacctcc tttttcgcct ttttattcag
   110281 ggccattatt ctttcgttga cgaggtccat gagcatcttg atggcggccg cggccgcggc
   110341 cgcgtcgccc gagcacagct gcgtgagccg cgtgagcatg tgtatgagcg cggtctcgtt
   110401 gatgtcctcg tccatttatg agctgtgagg gcgcgccgtt cggcccggcc gggcggcgtc
   110461 gcgcgcgcct gccgcgggcg cgcgggcgcg cggcagcgac aggcggagga ggcaggcgaa
   110521 caccgtggcc atgccctcga cgacgaggca gtcgacgaac gcgggcagga cctccgaggc
   110581 gtgcagcacc atgccgattt acggtcgcgc gcgggttgaa tacgctagac ggactgcggc
   110641 ttgtcggcgg ccttctgctg ccgctccgcg gcggcggtca ggatgtccgc gagccgcgtc
   110701 ttcatgtgcg agaactgcgc gagcaggatg ccggggtcga ggtccctccg gacgacgctc
   110761 tcgtcggcga agtcgtagca gatgcgctcc tggttctggc agaacaccga gtcttcgatg
   110821 atcaacactc tcctgctccc ggccgaccgc atgatggcca tggcccggat gagcctcttc
   110881 ttcgagcccc ggatggacat ggaccggagc acgttctcca cgtcggagtc ggacacgttg
   110941 cagcagcaga ggtgcgtgat gctcgcgcgc ccgttgacgg ggatgtgctt gtacgtctgg
   111001 cacagcagca ccagcgacac gttgaggtgc cgcccgtagt tcatgaggcc caagagtgtg
   111061 ggcgaccgcg tctgcgtgtc gcccatatcg tcgagaatga tgaggaattt gtgttttttg
   111121 gactgcgcgt agcgctcgat cttgcgcttg gtcaccgaga ggttgtactc cagctcctcg
   111181 tgcgtggtca ccttctggat gtggtccggc cacacgaacc cgtcgtaggc ggagttgtac
   111241 acgggcgtga agagcaggat gtgcttgaag cggcgcacca gcgtccggaa gagcgagagc
   111301 aggtacaccg tcttcccgga ccccgagccg cccacgagcg ccatcctgaa gggcgcctcc
   111361 gtgaggctct cccgcttgaa ccggacctcc tggacgacat ccatcgtata tttactgtca
   111421 ttaaattacc ggctccggga aatatagaaa atagagcctc ttaaagcaca ccgagactct
   111481 ccggcaagat ggctcacggt acattcggcg ataacgacag cgaggcggcg gctaatgcca
   111541 cgtacgtagc gtcggtaaag cgccagaaag cgatccgaag gtgtatcaag ctattcttcc
   111601 ggctgatggc ggctctggcc atcatcattc tagctgcact agtcatcatc cttgcattag
   111661 cattgagcga ttgtcgcaat acgacttgtg ttattgacac taattcatat aacaggacgt
   111721 gtgatggaat aaacgcaggt aaccgctgtc tgacccttaa atacccagat acgtggacaa
   111781 atgccaatga acggtgcaaa gaactcggtc agcgtctgcc aaaaccaagc gacaatgaaa
   111841 aatacccatg gcttactgat tacctggtca acacttgggg aaacataaac gaaagagtat
   111901 ttggtactag tggtggatta gagtcggtaa ctatggatgg aagcactaac aagtattttt
   111961 gtgtggacga caattagctt tggctaatag tttattctaa taaatgggtt gctgtaaggt
   112021 tcccaacaga cagtccttac gatcgctgaa aaaggcgtcg tgtccggtgg ccactctcgt
   112081 caccatgctg tcgctcgtga ccagtctagg tgctataata aagtacacag gatttttctt
   112141 aagagaggct tgtgaagacg ggtggattcc gataaaagac atctgtgtgc taaacacaca
   112201 ccaccagtcg gacaccacca gggcgcacga gatatgcagg tactttaaag gcacgccgcc
   112261 agccatcccc aacacgtcgt tgcttcgtgg ggtgatggct gtgacgggag agaggcactt
   112321 ctggctgggt caccatgaca agtatacctc tgtatacgag gacgctccgt ttggaaggag
   112381 ggttccttac cagaacgttg aatacgacaa agctaaacac ttttgtctgt tgagtgcaga
   112441 tgggtatatc caccacaact gcgctctgaa cgccactgtc atatgtgtca aaaaaatgta
   112501 cggataactg aaaatatact gtttgaatga caaacggcaa catgtcgtgc cttcaaatac
   112561 tcactccatt tggactaatc ttcgcacccg acgatgttcg gctgcgtgag atcgcgctgg
   112621 aactggggat cacctacgtt tcccgcgcat tcggagacat gttgtacggc gagatgtcgt
   112681 tcacctcctt acccatgaac gaggtgcccg cgtgcgtgtc ggactgctac cttgccgtga
   112741 acgggaacct cataccgtgc acggagtcct tcaggcttcg gatacccatg gacggcgtta
   112801 aggcggccta ccgcacaggc accggcaaga cgatcctctg cggccccgaa ttcaacgtcg
   112861 tgaacccctc cggctttcgt ccggccctgc ggctccgcga gctcagccac gtggcggcgc
   112921 atacagagat cttagagctg tactcggagt ccggcaacta cgagttcatc atggggccaa
   112981 gcgcgcgctt catgacgtcg ctcatggcaa aggagtccgt ctgcctgttc ggatccgggt
   113041 ggtgcgtcgt cgacctccgg aggatatcct ttaccccgtg acgtgtgact attattttta
   113101 ttgcaacatc atggcttagt aaaacataaa tagtaaaccc gttaagtagt gtgcgtttag
   113161 attgtcgcag ctatgaagtc cacatatctg ttattcgcgt tatccttagt attatctgcg
   113221 gcgctgagcg cgccgatgaa cacagacgaa caaaggaact ggtgtagaat tcataaagac
   113281 aaactctatt ctagatttag actttatatg aagataacta gaacaacagt tacaccaccg
   113341 acgggaatgt gcatgctgga catagaaaac tcaaacatgg atctagatga gactgatgaa
   113401 gttacaaacg tcactagcac gatttccttc agggattcta cagcaacgtt cgaagcatct
   113461 ggcgtaaatg gaagcataac actgatgggg gacgaagttc atatacccat gagttacatc
   113521 ggtgtcagtt ttgacccttc cagtgcctat gtgttcgtta acgtgtcttc ctggactccg
   113581 tgggaaaaat ctaccactga tttggcagcc aatgactttg agggtctaaa aaatattatc
   113641 aaccaccaaa tattggctat taaccttgga tgcgaccatc agtacccggc gcccaagcct
   113701 acaccaaagc cggaaaagat tagtacacca agcaccacac ctggtccgac tcttctggaa
   113761 acagaggcac ctactaccgt tcctcctgtg gacacgtcgt ccgaccgaaa gaagaagcct
   113821 gatcctgtcg acttctcgtt gctagtagat accagatgca taaagaacgt ggatctgtac
   113881 tttgaactta aggacgcgtg tctggcgtat aagagccaga gtccatttaa gttggtagga
   113941 caacatggaa caggccagca agtgcgtcag gatatgaaga gtttgggaac ctcctatagg
   114001 acgtgcaagt taaaaaccag ttccactgca gacaacgaca tggaatccgc aaaggatgag
   114061 gagtaacacc actttttgta gattgtacaa gtcacagttt acacaacctt gtcgtgggat
   114121 tattgaacat taaataatat tacccaccaa ccgcaaccat ggcgctagta ctcataggtc
   114181 tgatagtcgg cgcgttctac ctcacggccg cgattatata cttgctgatt gaaataggcc
   114241 tcgcggtgga gagactaagc aagaaatccc gcgccaaggc ccacatgcga cagctgtcca
   114301 cccagctggg aagcggtact ctggcgtcaa ctatgggcac cccgatcccc gttatgggtg
   114361 atatcggtac atgcagccgc tgggacagtg acaccgaagg ggagactgtg tccaccacct
   114421 ccacgagtga cggcggcacc ctgtccagac aacaatccag attccaacac aggctctacg
   114481 agaacttcca gagcggcgac cctgggtacc accacaggga cacattccag gtgcaggtgc
   114541 gtaacagcgg aaccccacct gtggacaaca tcccccctgt acccaaagta gatgaaccgc
   114601 cctacgacga cgccgagtcc agcggcgtcg ggtccatggg gtccacggaa catattcact
   114661 ccgacggtga cgggccggag caggacttac cgcccccgcc cgcacacgat gaggtcagtc
   114721 tgcaagacga atgcgacgat ttttatttcg aggagtgagg ccgcccaaaa ctgaataact
   114781 atcggagctt cgtaaaccgc aataatgccg ctgtttaaga agctcatggt ctcgcgcgcc
   114841 ctgattaagg agtgtctgac gttggacttc cggcagggct cccgcatacc ctcgcgatgc
   114901 ttcatcccca cgcccacggg catgatgtat cagcggctct gcgacacgag ctccctggtg
   114961 caggagatca cgaagtccct caaccagccg gtgctgtgcg ccggacacgt gaactactac
   115021 tacttcgagc aggggcagtg catgatcggg gagaactcgt gccagacccg tatcctcgtg
   115081 tgcacgcgct ccgcctacgt gggcggcgat atagtcctac gctccacacg cagccgcgcg
   115141 gacaagagca tcctctgccc ctgccagggc atggccgtcg tgctcagccc cttctgcgcc
   115201 ttcgacatca cgcccgtgga gagcgggtcc atgatcgtgg ccgagatctc cgtgagcatc
   115261 ccgggcttcg accacctgga gatgccggcg cccgcggacg ccggcgtccg cctcttcaac
   115321 tcgccgcacc tgctgtggcc gcggcacagc tccaacgtct gcttcgcgtt ccgactcctg
   115381 cgcgacgcgc gctctggcga acgcgtcgtc gagcagctgt tcatcgacgg acggtggtac
   115441 accgtgctcg cgacgcccgg cggcgggcgg atctgcgtgc ccgcggacgt ggtggggagc
   115501 acgcacctgg aagaggtgcc cttctgcgac gtgacccccg atatcatgcg gcgcgtgctg
   115561 gcgatagagc cggcgtacga cgcgctggcg tactcgcacc ggtgcacgca cggggccgtg
   115621 gacgtcaggt gcgccctcga gtccatcgtg tacggcatgt tccggtcaga ggcgccagcg
   115681 cgccgcagct cctcgccggg gcccgagctg ctgtctccga ccgaccggcc ctcggatccg
   115741 cccgccggcg gcggcgcggc cgccatcgcc gaggagtgtg cgaagaaagc cctcggctag
   115801 ctttttctcg aactcccaat aattgaattg atagctgtta ttcaggcgtt ctgtaaccat
   115861 ggcgtgcctt ctagctgcat tagactccct gttctgtaga cgcaagtccc gcttcaactc
   115921 ggaagacgtg tacaccccac gcgaccccaa cgctctccag tctcccccgc gttcgccgcc
   115981 cagccgccct ccctcgagca acagacgatg tcgtcgagcc ccgtcgttcg gcagcggtgc
   116041 aaactacgac tcgcttccgc tgaacagaca ccggatgaaa aataaccgtc gaagctccga
   116101 cgaggaggat gacgagagct acatcgatct tgtgactact acgacaacga cagttgcggt
   116161 cttcgcagcg tcgttcgatt atgagtcact tagcatctgc acgttatctc tttcgtcatc
   116221 gtccacaatt tctgaatcac cgcccaattc gccatgattc atttcctttt gaggcattcc
   116281 ttatttttat actggtttat tgaaccccgg tatccccata caaatacgtt aggaaagatg
   116341 agtgaaacag caccctcctc tagtactacc gattcgactt cggctggtac cagtgacgct
   116401 agtacaagca ctaacgacag cacagctatg tcatcagcac ccactacaga cgctagttcc
   116461 acatcaacta ctagcaatac atcatcagcc acaacttcta gttcatctga cacagagtca
   116521 tcatctacta ccgccaataa cgccgattcc gggtctgcga ctacaaccac tactactacc
   116581 gagagtactc caactgctag taccggatca gagtctactt cgtctgcgac tcagcctacc
   116641 accacagatc caactcctga tcccgctccc gttcccgcta ccgctccaac tgctagtacc
   116701 ggatcagagt ctacttcgtc tgcgactcag cctaccacca cagttccaac caccacagat
   116761 ccaactcctg atcccgctcc agctcccgct ccagctcccg ctccagctcc cgctccaatg
   116821 ccaaatccag taactaccac cactaccacc gtctcaacca ctgccactaa tggtacaaat
   116881 cggtgcgaat gcgtgtgtac ttgcacaact acaatgacag gcggcaacca gtatccccca
   116941 gagaatatag accttggaaa cagcgcaagc actccatcac ctccagatgt agaagaacca
   117001 ccagccgaag aggacgaaga ggtaatttaa gcagtaactc gcctaagtgt tgaccgaggc
   117061 gagcggatct cgccaccagc tttctagata aaaagcgtac cccgttgcca tagctgcaac
   117121 ggggtacgct tttttcacgc cattttttcc ggcggcaatt aaagtacgaa aagcactaaa
   117181 aatcatccat tcgcaagacg ccatgtggct accgcgcgcc ctgctggcgc tgtcggtgat
   117241 atgcggaacc gcttcgtcgt accgcggcat gcacgacggc ggcgagttct gccgggcgca
   117301 ctcgcgcgag atattcacta gcttccagat gtggatgcgc atccagcgga acgtgcagac
   117361 cgcgcggaac gcgacgcagt gcgcgctgga cgtcgaggcc ccgcccgata tgttcgacgt
   117421 ggtcgcgtac gcgaacaccg cggggatcgc cgtcacggtg gcgacggcca acgtcggccg
   117481 cgtggacgtg cgcacgctcc aggtgctgta tagcaccaac aagagcagca tgttcgtgta
   117541 cctcgacacc tggagcccgt ggacgaagta cacccgccct ctgtacagca acgcctccgc
   117601 cgacgcgcac aacgagacga tagactgcct gctcgaggtg ctcgacctga acaaggtgca
   117661 cgtcgacgtc gggtgtgccg tcgaggacat ccccgtggac gtcgtcgacc cgatagacta
   117721 cccgcgcgtg tacgaccccg acctcctcag gtacgtgatt ccaaaaaaca ggaagcagaa
   117781 cccggggtac gtgttcgtcg acctgagcgt ggacagctac tgcgtccaca gcgtgaacgt
   117841 gaagacggtg ctgcgggacg cgtgcatcca ccacaagaac gaaacgccgc taaacttcta
   117901 cgggcgggag aacttccctc tccacaaaag cccgaacagc gtcatcccga cgcacaagcg
   117961 cgggttcagc acgtgcgaga tgatcaccgg acagtgatcg tccttacctc agtgtgcgtg
   118021 tgctgggcgg cgctggtgct cgagggcgcc gaaggcgctg acgaggacga ccggaccctc
   118081 atcaaatttt tgatgtttta gtttgcgcaa gcaggttaaa aatgaaataa aacggcgttt
   118141 agaaggcacg ccgttgttat agcaagtatg gcaggtatcg cgaagtcgcc gcgggtgttg
   118201 tagagctcct cggggctctc cggcgcgtgg tggagcaaac gcggcgcgag cgctacttcg
   118261 acgtgtgcgg tgccgccatg gaggttgacg gcgccgcggc ggacccgttc gagctcgcgc
   118321 cggtgggcgc ggagccgccc gacgtcatca tgcagtgcgc ggagcccgag gagacgccgc
   118381 gcatcatcac tccggcgaac gccttcctgt acctgcccaa caacccgcac cttcacgtag
   118441 acgaggacgt ggaccccttc ttcggcatga agcccgccgt cttcggtcgc tctgcctccg
   118501 gcgccctgct ggggcagcgg aacccggtca tgagcgaggc cggcgagccg ccaagcccgc
   118561 gctcgccgtg cgaagccgac ctctggtgct gggagacgct gggtgacagc gacagcgaca
   118621 gcgactagcc gcctcgtccg caatttcagg tccgtgcatt tcaagtccac acatttcaca
   118681 gccctttttg ttatggtccc acaaaaatag atatttgatg tctatttcag tgtgaagata
   118741 ctccggggag gcaagcagaa agaggcgggg cggggcgcga cgcgcacgga gacgaacctt
   118801 tggggcaaga ccccagacaa cccacaaaac cacaaaccgt tgaaccgtta acagaataac
   118861 catgaagtac atgttgtcgg tgtgcgtgac atgcttgctg gcgacgctgt ccgcagcagc
   118921 gccgacgacc acaaaccacg tcactgacac atccaacacc acgacttcga cgatcgcaac
   118981 cacgacgaca gtgagcactc ccacgacaca ccacattggt gaagacgatg cgaacgacga
   119041 atccgaaccg tacaaggttg tgtgcgccat cttcctcatc gtcgctacgt tcattgtgat
   119101 cgccgttgtg atcgtcatga tggtgaagcg gcgcatgtgc gactggtgct gtgtgtactg
   119161 tccctgctgt aacgacgacg aggacgacga ggagaacgag cgcctggacg ctatgctgga
   119221 acacttcccc accaccgatt ctaacgattt tgttaaaatg tacgctggta ctggggcatg
   119281 ctagcactcc gttgaccttt ttatcccgaa taatgtgaca ttatcccaaa tgcgcgcgcc
   119341 caaaattaag tgaaatataa acagaatttt ggactcaact tcgtggctta gtcaaaaatg
   119401 tcgggtctat tcactaccgt ccgttgcgtg tgcaacgaga tatggaagac gatgcgcggc
   119461 gacggtggac acagcggcca ccacgagagc tgcttccacc atcggcgccg cgccaacagc
   119521 atggagtcgc gtcggaagtc tcgcccgtcg cgccagcacc gctcggcgga aaggacgccc
   119581 accacggcgt cctcgctcac gcacgagaac aacaccgcgc ccagcagaca cgggaagcag
   119641 cactcgtgca aggccagctc ccggtcgtcg cataaccacc aatctacctc atcgtctcac
   119701 aaccatcacg ctcatcgagg cccccaccag agtgcacaca gacggtccaa acacgatgcc
   119761 gtgcgcgaca cataccagcc ctgcccgcag tcaccggaga ccgacctgta caagggaagg
   119821 cttcccgggg agacggagcg gcactacgaa acccccgacc acatatacga cacccccgaa
   119881 aacgtggtgt gtgcggtaga gcctcgcagg gatctggtcc ccgtgaacga acacatacac
   119941 agcagggtgg cagcgcggcg ctcggtaccc ggcgccagcg gcggcacgtc gcgcggcaag
   120001 cacaacctcc agagcgacat aggcacgctg tgtcacgaca tagagcagca gctgagtgcg
   120061 ctcgagaagt cgctggagag cgagttccgg ttctacaagc agtacatcca tgacacgaag
   120121 tcgctcctca cgaccagggc agcaaacatc agtaacaagg cactgttgta cgaggactat
   120181 aacgacatcc acgatgacga cgactgatgg cgacgacggt gagttggtgg cgggaagatg
   120241 cattttttct gtaatgtgaa ataagataag ccttatgcgt tcacacacac cgccggcacc
   120301 atggacaaca aactggtact gctggacttc gagcacctcg ccgaggcgga cagcatcgcc
   120361 gagcagtgcg tgtacgaacc cgcacaaaag aaatgtgcgt tcacgaagat ccggactaac
   120421 tcgagcacgg cggcgcggta cacggtcgcc gacgggtgca tgctggacga cctcatgaac
   120481 gcgtccttcg ggacccggcg cgcctgccgg ctcgtgcggc acgtggtcgt tggctccgac
   120541 accgtcctga gccggcaggc ggcggactgc gcgccccaca tggtcctgat ctgcgtccgg
   120601 ggcatcgccc acgtgtccgg cgacgccctc aagttcgggc gctgcaccat ggaccgcggg
   120661 accatgttca tggtgaagtc ctcgcggagc tcggtggtgt gcggcaaccc ggcgtgcgag
   120721 ctcctcgtgt tcttcgtaga cttcttcatg cccatcccgc gcgtcctgct tccagacgag
   120781 gtgctcttca cccgggacct gacgcacgtg gagtcggacg cgaactcgtc cgtgatcttc
   120841 aaggtggagt tcgacctgtc ggagaacgtc tgcaagctct tcatcaaggg ctacatcatc
   120901 cgggtgaccg ggatgcagct ggagcggcgc gagacggtct gcgacgactg cgactgctgc
   120961 tacccagagg ccccggtgct ggcgctcgac cgcaaaaagc tccatcgctc cgcccgcacg
   121021 gtgcccaccc tgattcccgg agtgctggac ctgcacctca aggagcgggg gtggctgatg
   121081 gcgagcatcg acgccaaggg ccactgcgag cccgccctcc tgcgcatcgc cctcggcagc
   121141 ctgcggctgg tgtgtggcat cctgcggtcc gcggtgggcc ggtaccacaa catgctgttc
   121201 ttctacggca tcatccccgt gaaccgcgag gcggacgcgg cgcccgcgga gatgatggag
   121261 atagagtgat cacttccttt ttgttatctg tacatagcga gcaatagtga aactgtacgg
   121321 taacgcctac aagtaacgcc gtaaccaccg tctgcgaacc taaataagct atggaccgac
   121381 tatccgacca caccgccgtc ttcagggaag cctccctgta cgggtacctg tcctcgacct
   121441 cgacagtgac ggtcgaggac gtccgccggt acctggagtt cggcggcgac gccaactaca
   121501 agggcacgta caagtgcacg ccgctccacg tctacttgcg gctccccggc gacaagagcg
   121561 tggaggtgat agacctgctg ctggacgcgg gcgcggatct caacagccgg gacatctgcg
   121621 ggttcacgcc gctgcacatg tacatctgct acgcggacgt ggagacggac atcctccggc
   121681 acctcctcga gcgcggcgcg cgcgcggacg ccaccgggaa cggtatgatg acggacgcgc
   121741 tgttcgcgta cctgaacacc cacggcatcg acgacgcggc gacccccgag gtcgtggacc
   121801 tgctcatccg cgcgggcgcc aacgtgaacg cgcgcgggga ggcggacaag acgccgctgc
   121861 acgtgcactc ggccagcttc acggtgaacc cggaggtcac gcggctgctg ctggacgccg
   121921 gtgcggacgc ggaggcgctg gacgagttcg gtatgacgcc ggccgacgtg ctcgtgaagt
   121981 cggtgggcgc caacgtggaa acgctgcggc tgttgctcgc ggcaagcgag ggaatcgcga
   122041 cgcgccgcga cgtccgcgga cggacggcgc tgcaccacca cgcggactcc ttccgggcga
   122101 acgcggacat cgtgcgcgag ctcctgcgcg cggggtgcga cccggccgcg acggacatgc
   122161 tcgagaacac gccgctgcac agcctggcca ccttctgttc gtgcaagcgc tcggtgctcg
   122221 accagctcgt cgcgcacggc gcggacatca acgcgatgaa cgtgtacggt cacacgccgc
   122281 tgtactacgc cgccatctac aaccccgaag cgtgcccgcg cctcatcgcc gcgggcgcgg
   122341 acgtgtcggc gcgcacgccg gacgaccgca cgccgatgac cggcatgatc atgcgaaaaa
   122401 acatgcgcgc gctgaccgcc gcgctgaaca cctgtccccc gctggacgcg atatgcgcgt
   122461 ccctcgacgg cgcgcgcccg ggtgccgcat cggacgccac gcgcatgtgc gtgcgcgagg
   122521 tcgtgctgcg cggcggcgcg cggcgcctgt ccgcgccgat gcggcacatg cacgccgact
   122581 tcatcgcgca gtgcgaggca gaggtggcgg tcatggcgac cgtccgtctg ggtgacccgg
   122641 agacctcgct gctggccctg gcgcggcgac gcgcgctgca gccggtgctg ctccagccga
   122701 gggtgaaccg gctgctctgc cggtttggcg tctacagaga cctgctggag cgcctgttcc
   122761 gcgagcaccg ccgcaagacg cgactcgtcg agcaggtggc ccgccgggtg tgcccctgct
   122821 cgctgccgcc cgaggtggtg gtccgcgtgc tgtcgcacgt gcccgcggac gacctggcgg
   122881 ccaccctgcg ctgcccggcg cacgacgcgt cttcgcataa ctgaaatgtt atttttgtga
   122941 tatagtcctc agagttcttc cagatggaga ggtttggtgc tggagagccc gcgcgcctgc
   123001 ggaacccggg gccctggcgc atcagcccgc cgatggcgag cgcgctcgag ggcgcgatgc
   123061 tgaacccggt ggtggcgcat gggacggacc tctgcgccaa cgcccgcgtg gagacccgga
   123121 acatgggcgt gggcgagggc cgacacatcc ccgcggacgt cgaagggctg cgcaccgagg
   123181 tgcacctgcg gtacggcatg agccgcgtgc accgcacgat gtacttcgcg cagttctggc
   123241 acggcgagca cgtcgtgcgg cgcccgtcgc ggtgcgtgtt caccgtgtgg gtgtgtctgt
   123301 acggagaggt gcgcgtgtac gccgagagct gccaggcggg ccagggcttc gtcctctgca
   123361 gacagctgcc cgccggccac atgttcatca cggagccctc ggacatggtg accgtgtccg
   123421 tgccgcacgc gctgcgcgga tcgcgccggc cagtgtggct agtgtgcgtc ttcgccacgc
   123481 ggcacttcga ggacctgccc ccgcccctgt accccgtccc cgcacacgtg gtgctcgccc
   123541 gctcggcgag cgagctctgc aatgtctcgc cctccgcgcc gcagcgccag cacggcatct
   123601 tcttcatgcg tctgtccggg acggtcgtcc gcctgacgat ggccggtgcg gagctcgagg
   123661 tcgagtgcac gtcccaccgc cctgaccaca tggccgtgga cgcggagtgc cgctgctgcg
   123721 agctgcggcc gcacgtgccg cgctcgcggg tgctgacgct cgtggagctc tgcagcggcg
   123781 cgacggtcgt cctggcgccg ccgctccccc gcggcgggac cgggctcgtc gcggagatcc
   123841 gcctccactc cggacaccac atacgcgtcc gcgtgctccg ctccgccacc ggcaacgtgg
   123901 ccgcgtttcc ctcggtggtc tggacgggcg tgttctgcgc cgcccacgtg ttcctgggcg
   123961 gctccgtccc ggcgttcgcg gcgtgcatgg acggcgggcg cggcgcgtac ggcctcgtct
   124021 tcattccgga gggcgaggag cggatgtctg acggcgtgac gacgttcccc acgccccgcg
   124081 agccggtcgc gctgcacata gacgcgaacg gcgccgatgc gcgcgccatg ctgaacgcgc
   124141 cgccgccgat ggaggcgccc cgcgaaggcc gcgcgcctgc cgcggctgga gctgccaatg
   124201 cccctgccga ccaggatgtg gacggggcac ccgatcacag ggacgctgga gacgccgagg
   124261 aagatgacat ggacgcccag gacggcgaga gcgacgcgga gagcgagtac tcctacgcca
   124321 ccacgtcgtc ggaggaggac tccgacagcg acgactcctg ggacgacgag tcgtcctccg
   124381 attccgggat cgagcacgac gacggcggcg ccggccaggt aatcgaggaa gagctagccg
   124441 aggaggccgc cgtcctgaac gccgttgccg agatgctcga ctgacaccga ccttattcct
   124501 tgcccgccgc cctctcacgc cctttttgta cgaaaacata aaattaactc cccattcttc
   124561 gttatcgcgg tagacgcgcc acaccgaaat acctcagcaa ccataacact aactaatcca
   124621 agatgatcgg tgacaggcat cgcgacgata ccgacatcga cgccagcgcc gtcgtgaccg
   124681 cgtatctcgc cagcgagtac gccaacgcgg tcatcgacaa cctttcggat gccgaacgcg
   124741 tggcgctgga ggcattgcgc gcctccggag acgaggtacg ccaccccatg ctgcaggagc
   124801 tgacaaacgc cggcggcaat cacgcgaacc cggagacctc gcacattccg gccaccctca
   124861 tttcagcact acttgaagca ccagcctccc ccggccgcat ggtgacggcc atcgagctct
   124921 gcgcgcagat gggccggcgg tggacgcgcc ggttccagtt cctcaacttc atgcggctcg
   124981 tacacgtcct cgtggatcgc atgccgccta cggcctccga ggacctcgcc gtctggctcg
   125041 aacgcgcagc gcgcgtccag gcgacgcgtc atcgcatgtc ccgcgtcgcc ggtctcggca
   125101 tgttcctcgc cggttgcggc attctgttcg ttggagccag attcctccgt cggtgacctt
   125161 gatttttatt cgcccgccta aagtgaaata cgattcctgg attttgcttg gtcggtcgcc
   125221 cgtggtgcca tggacccaga cgctgacgac gaggctagcg accgccaagc ggcgagcgcg
   125281 ctgtaccggt acctggagac cgccgacaag ccctccgtcg agaagatgtt ccgcctggtc
   125341 cgcgacggtg cggacgtgaa cttcacgggt ccgtacgggt acacgccact gcacgtactc
   125401 atgcgctgca gccccggcac ggaggaggtg cggttcatga tcgccgcagg cgcaaacgtg
   125461 aacgcggcct ctctgtgtgg gttcacggcg ctgcacacgt acatgtgctt cgggacggta
   125521 acgcccgaca cgctgcgtgc cgtcatgcac ggcggcgtca gggtccgcga actggagtac
   125581 aacgtctccg cgatactgga gttcttccag cagcaggggt tcctcggcat cgaggtggag
   125641 gtcgtgcggc tgctcgtgcg gtacggcgcc gacatccgcg ccaaggacga cgtggggcgg
   125701 acgcccctgc atgtgtacct gtcggggttc ttcgtcgtcg agaccatggt gcggaccatg
   125761 atcgccctcg gcgcggacgt gaacgccaaa gacgcgtacg gacgcacgcc gctattcgcc
   125821 ttcctgaagt ccaggaacgt cgacgtcgac gtactgcgca cgctcgtaga ggcgggagcg
   125881 cgcgtgaccg agaaggacct gatcaaccgg accgcgctgc actaccattg cgactccttc
   125941 aagaccaggg cctgcgtgtt ccgggagctg atcgccgccg gatgcgatcc ccgcggtgcg
   126001 gacatcctgc acaacacggt gctgcacagc ctggccattg ggagctcgtg ccgcgcctcg
   126061 cagattgccc cgctgctcga ggcgggcgtg ggcgtgaacg cgcggaacgc gcggctgcag
   126121 accccgctgc acgtcgcggc cgcgttcaac ccccgcgcgt gcgtgtgtct catgcgcgcc
   126181 ggtgcggacg cgacccttgc cgacctggac gaggtgacgc ccttcctgaa catggtgcgc
   126241 cacaactacg cgcacgccgt gcgcgcggcc atgcccggcg tccccgactc gctgatagcc
   126301 ggaactgtga accgcctgaa cgtgctcgtg cccacggacg ccacgcgcga gtgcgtgatg
   126361 gagctggccc tccgcaaggc cgtggacctg ctgagcgacg ccgcgatagc cacgcacgcg
   126421 cagataatcg ccctgtgcgc ggaggagatt tctcacatgt gcgtgacccg actaggcgag
   126481 ccgcaggtgg cgcttgtgca gatcctcgtg gagcgggagc ccttcacggt gatcacggcc
   126541 aaggccgccc ggcgcgcgac ggcgcgcgtg cgcgtgtacc accgcgcgct gtcgcggagg
   126601 atggaggaag tgagacggcg ctcggcgctg gtgcagagga tggttatggc ggtaagtccg
   126661 tgctctctgc cgcccgaggt gctgtacagg atattcctat acgttcccgt tgatgacctg
   126721 atggtaacgc tgcgtatctc gagcaactag atattacgaa ataccgaaac tcaaaatata
   126781 ataatgaata tttatctgag ctaattagac gcgattattg ttataaagac ttattcttta
   126841 atacagtggt tgaagtagta gtgttagtgt taggttaggt tagtttagta tactacaatg
   126901 gccaatgtaa tgtatgtagt tttggttttg aatattctac ttacgcaaat tcatgtatca
   126961 aactcatact gtactatgtg ctccactggt gtatgtaaag aaaacccaca ccagaaacaa
   127021 gaatgcgaaa acacgggaca tcaattacct cacatgttac gagaactccg ggcagcattt
   127081 ggtaaagtca aaacattttt tcagatgaaa gatcagttac atagtttgct tctcacacag
   127141 tctcttttgg atgacttcaa aggctattta gggtgccaag ctctgtctga gatgattcag
   127201 ttctacctcg aagaggtcat gccacaggca gaaaatcacg gacccgacat aaaagaacac
   127261 gtcaattccc tgggtgaaaa gctgaagaca ttgagacttc gactgcgtcg ctgccaccgc
   127321 tttctcccgt gcgagaacaa gagcaaggcg gtggaaaagg tgaagagagt gttcagcgag
   127381 cttcaggaaa gaggcgtgta caaggccatg agtgagtttg acatattcat caactacatc
   127441 gagacttaca tgtagttttt attgcagatt agatttaaaa tgaaatggca agcaagtcta
   127501 gtcatctgga aagacaacat gggctccagg gcgagcgccg ccctctacga gtacctcgac
   127561 gagtctccgt acgtctcgga ggatgaggtc cgccgcctgc tcggggccgg ggcctccgta
   127621 caccaccgcg gggagttcga ccgcacgccc ttgcacctgt acatgggcaa gactagcctc
   127681 gacgtccgcg ttgtccggct gctgctggag gcgggcgcag ccgtggacgt cgccgagtcg
   127741 tgctgtgggt gcacgccgct ggatcttctg ctcatgtcct ccgccgtgga cgtggaggtg
   127801 ctcgagctga tgctgaccgt cggccggctc gtccatccgg accgcgcagc gctggcgtcc
   127861 acgctgctga aggagttcgt ggtcaaccgc gccttccacc ccgtcttgac ggagcgcgtg
   127921 gtgcgggtgc tggtggacgc cggcgctgac gtcaacgtgc ggagcgtcgt cgaccgcacg
   127981 ccgctccaca tctgcctcac gggcatgtcc acgcacccgg ggacgatcac gacgctcctg
   128041 cggttcggtg cggacgtcaa cgcggtggac ttgtacggga tgacgtcgct ggccgcgctc
   128101 atgcgctcca agagggcgag tgtggaactg ctgcggctgc tcctggacgc cggcgccagc
   128161 gtcagcgacg ctgactcgcg cggggacacg ctgctgcacc accacatgca gtcgccgcgc
   128221 ccgagacccg gagtgctaag cgaactggtg gtgcgcggct gccgcgtgaa cgcgcgaaac
   128281 gcgctcggac gcacgccgct gcacgtggcc gcgacgtaca cctcgtgcaa ggactcgatc
   128341 ctggcgccgc tcgtggccgc gggcgcggac atccacgccc gcgacaactc tgggcggacg
   128401 ccgctgcacg cggcggtctg caacgcgcgc gcctggcgcc gtctgctcgc gcgcggcgcg
   128461 agcgcgactg ctcggtccaa cgccggcgtc tccccgctcg cgctcgcgat ctcgcgacac
   128521 gacgagtcca tgctggcggc cgctctcgcc acgcagccgc aggccagcga ggtcgcggcc
   128581 gcacttcaca ccgccggacc ggcgcgggag accgcgtgct cgcgggcgtg cgtcgcgtac
   128641 gtggtcgcgc ggctgccgcc cgccgccgtg ccagagcccg agcgcggcat acacgcggcc
   128701 ttcatcgagt cgtgtctgtg cgaggtgtcc gtgctgcaac agaccgtgtg cggaaccccc
   128761 tcggtttccc tgctggatat cctgcgcggc cggtcgtgca ccgagacgct cgtcccccgc
   128821 cgggcacgcg cgctggcgac gcggctggcg cgcgtgtacc gcgagccgct gctggagcgc
   128881 gtgacagagc tccgccggcg cgcgaacctg gtagcacggg tgcgcgcgat catgggcggg
   128941 tgcggctgcg ccctgccccc ggagatgctc gaccgcgtgc tcctctgcct gaccacggcc
   129001 gaactgcgca gctgctgcgc acccagacgc tgatttttgt cgaaaaataa gtgaagaata
   129061 aacgcggtgc tgaatcgagc gcccacaatc cccgcacatt tcagtcatgg acaggaacat
   129121 ggaccacgag ttcgacatca gtccggagtc ggcgctgtac gactacttca tcacgcagtc
   129181 cgagcacgcg tgtgtcggag aggtggtcgc gctgctggcc gagggcgcag acgtaaacta
   129241 cgtcggccac ttcgacaagt ccgcgctgca cctctacctc cacaccagac acccgcgcac
   129301 tgacgtcatc tacgcgctga tggaggccgg tgccttcgtg gacgccccag agcgctgctg
   129361 tggcgcgacc ccgctgcatc tgtacgtgct caacgccgac gtgctcgacc tgacgctgct
   129421 cgaggcaatg ctggtgtggg gcgcgcgctc cggcaactcc ccgttgtcgg aacggttcct
   129481 ctccagcgtg ctccgggagg ccgtcgtcca ccgcccgttc tccgagcaga cggagccgct
   129541 catggacatg ctcatccggc tgggcgccaa catcaacttc aaggtcggcg tggaccgcac
   129601 accgctgcac gcctgcctca cgggggcgtg cacggacccg cgcgtcatcg acgcgctgct
   129661 cgcgcgcggc gcgagcgtcc gtgatctcga cgcgtacgag atgtcccccc tggccgtgct
   129721 gctcaagtcc gcgcgagcga ccgtggagct cgtccggcgg ctcgtggccg ccgggtctga
   129781 cctgttcact gtagacttct gcaggaacac gctcctgcac cagcacgcgc agtcgccgcg
   129841 cccgcggcag cagatcatgc gggagctcat ccgactgggc tgcgacccca tgaccaccaa
   129901 cgtgttcggg aacacgccgc tgcacgtgct ggcgatgcag agcacctgcc gcgcgtcgat
   129961 cattcgcccg ttcatagagg ctggtgtcgg cgtgaacgtg ctcaaccctc gatacggcat
   130021 ctcgccgctg cacatggcgg ccgggtacaa caacaccgcc gcctgcgaaa agctcatcgt
   130081 ccagggcgcc gacccctctg tggtctcgaa caccggcagg acgccgctgg ccaacatgat
   130141 catcaaccac aatcacgcgg ccgcggtcgc cgcgctgaac actcacccgg cgacgtccgt
   130201 tgtggccgcg tcgctgacgc aggccgttga ggccggggtc agcgacgcat cacggctctg
   130261 tgtcgcgtac gtggtcgcgc gcgctggcgc tcgcgcgctt tcggaggccg tgcgcgcgga
   130321 gcacgcggag ctcatcctgg agtgcgagac ggagatcgcc agactgcgcg agatccgcgt
   130381 gggcttcccc gccatgagcc tgcgggacgt cctcgtcagc gcgaccgtcc ctgacaccat
   130441 cgtgacttcc aacgcgatgc gcctgtgcaa ggaatccagc aggatataca gaccgcaact
   130501 ctgtgctgcg gtggaaaaac tccgctacaa atcccaatta gtttccagca ttaaaaaaga
   130561 ggtcggtccg tgcagtcttc cctccgagct cgtcgacctg gtgctgagca aggtgcccgt
   130621 cgccgatctg cgtcgctcgt gcggaaagca gtgacacttc ctctcttttt gtgacatcgc
   130681 ccgtcctctc agtccttatg tcgccccctg gcgccgagga caagaagccg cgtcgggcgc
   130741 gacgcaagac ccccgactgc gcggacgacg aggccgcggc gctggacgca caggtgccct
   130801 gcgaccgcga gtgggcggac tgccgctcgt ccgcgctgac gggcccggac tccgtgtcgc
   130861 tcggcgacga gatctacctg cgctacgtgg cctcgcaggt ggacttcgcg cagacctggg
   130921 cgccgccggt gcggctgctg cgcttcttcg gcaacttctc caaggacacg ctcgaccgca
   130981 tgtccaagcg cgggtacgtc aaccgctcct actaccagat ggcgcacgcg cgcttctcgc
   131041 ccacgaacga cgacatgtac cacatggcca ccgggggcta cggcatcgtc tgccgcttcg
   131101 accggtacgt ggtcaagttc gtcttcgagc accgcaacgg catgtccgag atcgacgcct
   131161 ccacagagta cacggtgccg cgcttcctgc gctccaacct caagggcgac gagcgcgagt
   131221 tcgtggtctg cgcgctggcc atggggctga actaccgcct cgggttcctg cactcgctgt
   131281 accggcgcgt gctgcacacg ctgctgctgc tgatgcgcgc ggaggagggc cagcgcccct
   131341 ccgtggagat ggccaagaag ccgctgctgc gctggttcga gtcgcgcaag gactcggagt
   131401 ccttcgtgcg gctcgtctcg tacttctacc cctcggccgt gcagagcaac gtcaacctcg
   131461 tcaacaactt cccgcacctg gtgcactttt tcgagcacga gaagcgcgcg cggtacgtct
   131521 tcgaccgcgg ggccgtgatc gtgttcccgc tggcgcgcgg ctccgcggac tccgtctccg
   131581 cggaggccgc gctcggcctg ggcttctcct cgcacgcgga gttcctcaag ttcgtgttcc
   131641 tgcagatcgc gctgctgtac ctcaagatct acgagatgcc ggggtgcgcg aacttcctgc
   131701 acgtggacct caagcccgac aacgtgctca tcttcgacag ctcgcgcgca ctcagcgtgg
   131761 aggcggccgg cgccaccttc cgcttcgagg agcccgtgcg cgccgcgctg aacgacttcg
   131821 acttcgcgcg cgtggctaac atcgagaacc gcaagatcgc gggcagcatc cgcgtgccgc
   131881 agaactggta ctacgacttc cacttcttcg cacacacgct gctgcgcgcg tacccgaaca
   131941 tagccgccga ggaccccgcg ttccactcgg tgctctcgga gctgaccatc tcgtgctcgc
   132001 gctccacgtg cgaccgcttc cgcctgcgcg tgtcgtcgac gcacccgata gagcacctgg
   132061 cgcggatcgt gcgccgcgac ctattctccc gctggataaa tgccgccacc gacgctcccg
   132121 accccgccgc agcctgaccc agtgcgggcg gacacggggt cgctatacga cgcgttcctc
   132181 gcgcggttcc tgcgcgcgct cgcggcccgg gccgcgcccg cgtccgccgc ctgcgccgtg
   132241 cgcgtcggcg ccgtgcgcgg caggctccgc aactgcgagc tggtggtgct gaaccgctgc
   132301 cacacggacg cgacggaggc gctggcgctg gcgtcgagcg cgctcgcgga cacgctcgcc
   132361 tccatcccga gggaggaccg gatcgccgtg gccaaagagc tgggcataga cccggacaag
   132421 ccgcagctga cgcccgaccc ggcgtgcacg gcggcggagg gggcgctggc ccagagcata
   132481 gacctgcaga cgctagacat aggcgactgc ggggttcccg gaggccgccg agtgcgcata
   132541 gcgctggtga acagcggaca cgcggccacc aactgcgcgc tcgccaaagt cgcgagcgcg
   132601 ctgacaaaga gggttcccgt gcggcggcag gagggactgg cggccggcgg gatgccgccc
   132661 tggtcggtcc tgctgtcggt ggccgcggtg gttgtcgtcg gcacggtggc cgtgtcgctg
   132721 ttgcgacgcg cgctgcggct gcggttcagg ttcgcgacgc gcctgcgagt gtgagcacga
   132781 taagtgaagt ttaactacca acttttacac tgcgtcagat atggcgtccc ttcgcagact
   132841 cgtcgcgtcc accctctttg tggtgttctt gatcgcgctc aacgcgatgg tggggaacac
   132901 gccacaggaa gcgcttccgt acgcacatat cgaggtgggg cgcgcggacg ccaacggatc
   132961 cgcgacgttc acgtgcacga tcgccggcat acaccacgtc agcaacgtgg tgatcgccga
   133021 cgagcaaacg ctctcggcgg tgtacccgcg ctcagatgac gcgagcgcgg agttcaacta
   133081 ccgccgccgc ggcctcgtgc acgtgcacct ggtggtcgtg accgtccacg acgtttctcg
   133141 tttgcacacc gatgactgga tcgggtgcca ggctatcaca ggcgcattcg tagcttcgtc
   133201 cgcgtacgcg gcgccggtgg ccgcctggat gcaggagatc cgtgcgctcc gtgaacacat
   133261 cgagctgtga tccccgcgga gctggtcgcg cgcgtgctgc ggctgctccc ggcggcggcg
   133321 ctgcgccggc tgtagcccgc tccgtcccgc agtccgcccc cgccggcctc ccgccgcccg
   133381 cctcccgcgc aaagtgaaat tcgacggcct ccaggcgacg cccgccctcc gccgcgccgc
   133441 gccagccccg ccgctccagc cccgccgccg ccagcatgtc cgcgctccgc cgcctcgccg
   133501 ccgccgccgc gctcgtcgcg ctcgggctcc tgctcggcgc gctcttccgc ccggccgcgc
   133561 ccgcgctgcc cgccgccttc gtcgagcccg ggcccgcgcg cgcggacggc tccgcggagc
   133621 tggtctgcct cgtcgtcggc ggcgcgcagc acatggccgc cgtcgaggcc gcgggcgccg
   133681 cgctctcgcc cgcgtacccc gcggccgcgg gcgtgcgcgc gagcttcgcc tccgcgcgca
   133741 agggcccgct gctgctgcag gaggtcaccg tcgccgtgca ggacgtcgcc gcgctggacg
   133801 ccgacgcgga gttcgcctgc gtggcgttcg ccggcggctt ccgcgcggcc gcggcgtacg
   133861 cgcggccggt ggcggagtgg cgccggcagc tggagcgcct gcgccgcgag gagctctgat
   133921 cggtttttct gattcggcct cacccgacct tatctttctt accttatttt tgtcaaggcg
   133981 tccgtgcgtc cgcacgaccg cctcccgagt tctcgagtca gcccgtccgt gcgtccgtgc
   134041 gtccgtgcgt ccgcacgacc gcctcccgag ttctcgagtc agcccgtccg tgcgtccgtg
   134101 cgtccgtgcg tccgcacgac cgcctcccga gttctcgagt cagcccgtcc gtgcgtccgt
   134161 gcgtccgtgc gtccgcacga ccgcctcccg agttctcgag tcagcccgtc cgtgcgtccg
   134221 tgcgtccgtg cgtccgcacg accgcctccc gagttctcga gtcagcccgt ccgtgcgtcc
   134281 gtgcgtccgt gcgtccgcac gaccgcctcc cgagttctcg agtcagcccg tccgtgcgtc
   134341 cgtgcgtccg cacgaccgcc tcccgagttc tcgagtcagc ccgtccgtgc gtccgtgcgt
   134401 ccgtgcgtcc gcacgaccgc ctcccgagtt c
//
DBGET integrated database retrieval system