GenomeNet

Database: RefSeq
Entry: NC_006383
LinkDB: NC_006383
Original site: NC_006383 
LOCUS       NC_006383              15948 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Peste des petits ruminants virus complete genome.
ACCESSION   NC_006383
VERSION     NC_006383.2
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; C gene; F gene; fusion protein; H gene; haemagglutinin; L
            gene; large protein; M gene; matrix protein; N gene; nucleocapsid
            protein; P gene; phosphoprotein; V gene.
SOURCE      Peste des petits ruminants virus
  ORGANISM  Peste des petits ruminants virus
            Viruses; Riboviria; Orthornavirae; Negarnaviricota;
            Haploviricotina; Monjiviricetes; Mononegavirales; Paramyxoviridae;
            Orthoparamyxovirinae; Morbillivirus.
REFERENCE   1
  AUTHORS   Bailey,D., Banyard,A., Dash,P., Ozkul,A. and Barrett,T.
  TITLE     Full genome sequence of peste des petits ruminants virus, a member
            of the Morbillivirus genus
  JOURNAL   Virus Res. 110 (1-2), 119-124 (2005)
   PUBMED   15845262
REFERENCE   2  (bases 1 to 15948)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (20-MAR-2015) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 15948)
  AUTHORS   Bailey,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-JUL-2005) Bailey D., Morbillivirus - Molecular
            Biology, Institute for Animal Health - Pirbright, IAH-Pirbright,
            Ash Rd., Guildford, Surrey., GU24 0NF, UNITED KINGDOM
REFERENCE   4
  AUTHORS   Bailey,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-OCT-2004) Bailey D., Morbillivirus - Molecular
            Biology, Institute for Animal Health - Pirbright, IAH-Pirbright,
            Ash Rd., Guildford, Surrey., GU24 0NF, UNITED KINGDOM
  REMARK    revised by [3]
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AJ849636.
            On Jul 20, 2005 this sequence version replaced NC_006383.1.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..15948
                     /organism="Peste des petits ruminants virus"
                     /mol_type="genomic RNA"
                     /isolate="Turkey 2000"
                     /host="Ovis aries"
                     /db_xref="taxon:2593991"
                     /cell_line="Vero cell passage"
                     /country="Turkey"
     regulatory      1..107
                     /regulatory_class="promoter"
                     /note="genome promoter"
     gene            108..1685
                     /gene="N"
                     /locus_tag="PPRVgp1"
                     /db_xref="GeneID:3119775"
     CDS             108..1685
                     /gene="N"
                     /locus_tag="PPRVgp1"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="YP_133821.1"
                     /db_xref="GOA:Q5ZER8"
                     /db_xref="InterPro:IPR002021"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER8"
                     /db_xref="GeneID:3119775"
                     /translation="MATLLKSLALFKRNKDKAPTASGSGGAIRGIKNVIIVPIPGDSS
                     IITRSRLLDRLVRLAGDPDINGSKLTGVMISMLSLFVESPGQLIQRITDDPDVSIRLV
                     EVVQSTRSQSGLTFASRGADLDNEADMYFSTEGPSSGGKKRINWFENREIIDIEVQDP
                     EEFNMLLASILAQVWILLAKAVTAPDTAADSELRRWVKYTQQRRVIGEFRLDKGWLDA
                     VRNRIAEDLSLRRFMVSLILDIKRTPGNKPRIAEMICDIDNYIVEAGLASFILTIKFG
                     IETMYPALGLHEFAGELSTIESLMNLYQQLGEVAPYMVILENSIQNKFSAGAYPLLWS
                     YAMGVGVGLENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSVIAAELGITAEEAK
                     LVSEIASQAGDERTARGTGPRQAQVSFLQHKTGEGESSAPATREGVKAAIPNGSEERD
                     RKQTRSGRPRGETPSQLLLEIMPEDEVSRESGQNPREAQRSAEALFRLQAMAKILEDQ
                     EEGEDNSQVYNDKDLLG"
     misc_feature    108..1679
                     /gene="N"
                     /locus_tag="PPRVgp1"
                     /note="Paramyxovirus nucleocapsid protein; Region:
                     Paramyxo_ncap; pfam00973"
                     /db_xref="CDD:307220"
     gene            1807..3336
                     /gene="P"
                     /locus_tag="PPRVgp2"
                     /db_xref="GeneID:3119770"
     CDS             1807..3336
                     /gene="P"
                     /locus_tag="PPRVgp2"
                     /codon_start=1
                     /product="phosphoprotein"
                     /protein_id="YP_133822.1"
                     /db_xref="GOA:Q5ZER7"
                     /db_xref="InterPro:IPR004897"
                     /db_xref="InterPro:IPR016075"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER7"
                     /db_xref="GeneID:3119770"
                     /translation="MAEEQAYHVNKGLECIKSLKASPPDLSTIRDTIESWREGLSPSG
                     RATPNPDTSEGDHQSINQSCSPAIGPNKVYLSPGDNLGFREITGNDCEAGLGGVQGKR
                     SNSQVQRYYVYSHGGEEIEGLEDADSLVVQADPPVANVFNGGEDGSDDSDVDSGPDDP
                     SRDTLYDRGSVAGNDVARSTDVEKLEGADIQEVLNSQKGKGGRFQGGKTLRVPEIPDV
                     KHSRPSAQSIKKGTDGNSVSSGTVTECLSISGATQAVPESRWESSEQNASVGSVLKSA
                     RSAETIQGLTQESGTIASLTQPKENDSEYEYEDDLFKEIQDIRASIAKIHDDNKTILS
                     KLDSILLLKGEVDTIKKQISKQNISISTIEGHLSSIMIAIPGFGKDIKDPTSEVELNP
                     DLRPIISRDSGRALAEVLKKPAVDRSQKIGTKANSSSKGQLLKDLQLKPVDKQASSAI
                     GFVPSDHESSRNVIRSIIKSSKLNTDHKDYLLDLLNDVKGSKDLKEFHKMLTAILAKH
                     P"
     misc_feature    1816..2742
                     /gene="P"
                     /locus_tag="PPRVgp2"
                     /note="Paramyxovirus structural protein V/P N-terminus;
                     Region: Paramyxo_PNT; pfam13825"
                     /db_xref="CDD:372740"
     misc_feature    2776..3309
                     /gene="P"
                     /locus_tag="PPRVgp2"
                     /note="Paramyxovirus P/V phosphoprotein C-terminal;
                     Region: Paramyx_P_V_C; pfam03210"
                     /db_xref="CDD:281237"
     gene            1807..2702
                     /gene="V"
                     /locus_tag="PPRVgp3"
                     /db_xref="GeneID:3119774"
     CDS             1807..2702
                     /gene="V"
                     /locus_tag="PPRVgp3"
                     /exception="RNA editing"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_133823.2"
                     /db_xref="GOA:Q5ZER6"
                     /db_xref="InterPro:IPR004897"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER6"
                     /db_xref="GeneID:3119774"
                     /translation="MAEEQAYHVNKGLECIKSLKASPPDLSTIRDTIESWREGLSPSG
                     RATPNPDTSEGDHQSINQSCSPAIGPNKVYLSPGDNLGFREITGNDCEAGLGGVQGKR
                     SNSQVQRYYVYSHGGEEIEGLEDADSLVVQADPPVANVFNGGEDGSDDSDVDSGPDDP
                     SRDTLYDRGSVAGNDVARSTDVEKLEGADIQEVLNSQKGKGGRFQGGKTLRVPEIPDV
                     KHSRPSAQSIKKGTDGNSVSSGTVTECLSISGATQAVPESRWESSEQNASVGSVLKSA
                     RSAETIQGLTQESGTIASLTQP"
     misc_feature    1816..2700
                     /gene="V"
                     /locus_tag="PPRVgp3"
                     /note="Paramyxovirus structural protein V/P N-terminus;
                     Region: Paramyxo_PNT; pfam13825"
                     /db_xref="CDD:372740"
     gene            1829..2362
                     /gene="C"
                     /locus_tag="PPRVgp4"
                     /db_xref="GeneID:3119769"
     CDS             1829..2362
                     /gene="C"
                     /locus_tag="PPRVgp4"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_133824.1"
                     /db_xref="InterPro:IPR003875"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER5"
                     /db_xref="GeneID:3119769"
                     /translation="MSTRGWNVSSPSKPLPRIYPPSETPLRAGERGSAPRAVQHRTLI
                     RPREIIRVSTNHAHQQSDQTKSTCLLEIISDLERSLATTVRLGSEESRGKDPTLKYSV
                     TMFIATGVKRLKDSRMLTLSWFKQILQLLTSSMEERMDLTTAMWTLAQMIPAEILYMT
                     GDLLPAMMSLGPQMSKN"
     misc_feature    1862..2350
                     /gene="C"
                     /locus_tag="PPRVgp4"
                     /note="Non-structural protein C; Region: Paramyxo_NS_C;
                     pfam02725"
                     /db_xref="CDD:280822"
     gene            3438..4445
                     /gene="M"
                     /locus_tag="PPRVgp5"
                     /db_xref="GeneID:3119772"
     CDS             3438..4445
                     /gene="M"
                     /locus_tag="PPRVgp5"
                     /codon_start=1
                     /product="matrix protein"
                     /protein_id="YP_133825.1"
                     /db_xref="GOA:Q5ZER4"
                     /db_xref="InterPro:IPR000982"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER4"
                     /db_xref="GeneID:3119772"
                     /translation="MTEIYDFDKSAWDVKGSIARIEPTIHHDGRLIPQVRVIDPGLGD
                     RKDECFMYLFLLGVIEDNDPLSPPVGRTFGSLPLGVGRSTAKPEELLREATELDIVVR
                     RTAGLSEKLVFYNNTPLSLLTPWKKVLTTGSVFSANQVCNAVNLVPLDTPQRFRVVYM
                     SITRLSDNGYYSVPRRMLEFRSANAVAFNILVTLRIENGTSPRRYIVGSWENPEVTFM
                     VHVGNFRRKKNEVYSADYCKMKIEKMGLVFALGGIGGTSLHIRSTGKMSKTLHAQLGF
                     KKILCYPLMDVNEDLNRYLWRAECRIVKIQAVLQPSVPQEFRVYDDVIINDDQGPFKI
                     P"
     misc_feature    3447..4427
                     /gene="M"
                     /locus_tag="PPRVgp5"
                     /note="Viral matrix protein; Region: Matrix; pfam00661"
                     /db_xref="CDD:366232"
     gene            5526..7166
                     /gene="F"
                     /locus_tag="PPRVgp6"
                     /db_xref="GeneID:3119771"
     CDS             5526..7166
                     /gene="F"
                     /locus_tag="PPRVgp6"
                     /codon_start=1
                     /product="fusion protein"
                     /protein_id="YP_133826.1"
                     /db_xref="GOA:Q5ZER3"
                     /db_xref="InterPro:IPR000776"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER3"
                     /db_xref="GeneID:3119771"
                     /translation="MTRVAILTFLFLFPNAVACQIHWGNLSKIGIVGTGSASYKVMTR
                     PSHQTLVIKLMPNITAIDNCTKSEIAEYKRLLITVLKPVEDALSVITKNVRPIQTLTP
                     GRRTRRFAGAVLAGVALGVATAAQITAGVALHQSLMNSQAIESLKTSLEKSNQAIEEI
                     RLANKETILAVQGVQDYINNELVPSVHRMSCELVGHKLGLKLLRYYTEILSIFGPSLR
                     DPIAAEISIQALSYALGGDINRILDKLGYSGGDFLAILESKGIKARVTYVDTRDYFII
                     LSIAYPTLSEIKGVIVHKIEAITYNIGAQEWYTTIPKYVATQGYLISNFDETSCVFTP
                     DGTVCSQNALYPMSPLLQECFQGSTKSCARTLVSGTISNRFILSKGNLIANCASVLCK
                     CYTTETVISQDPDKLLTVVASDKCPVVEVDGVTIQVGSREYPDSVYLHKIDLGPAISL
                     EKLDVGTNLGNAVTRLENAKELLDASDQILKTVKGVPFGGNMYIALAACIGVSLGLVT
                     LICCCKGRCKNKEVPISKINPGLKPDLTGTSKSYVRSL"
     misc_feature    5589..7013
                     /gene="F"
                     /locus_tag="PPRVgp6"
                     /note="Fusion glycoprotein F0; Region: Fusion_gly;
                     pfam00523"
                     /db_xref="CDD:334126"
     gene            7326..9155
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /db_xref="GeneID:3119776"
     CDS             7326..9155
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /codon_start=1
                     /product="haemagglutinin"
                     /protein_id="YP_133827.2"
                     /db_xref="GOA:Q5ZER2"
                     /db_xref="InterPro:IPR000665"
                     /db_xref="InterPro:IPR011040"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER2"
                     /db_xref="GeneID:3119776"
                     /translation="MSAQRERINAFYKDNPHNKNHRVILDRERLVIERPYILLGVLLV
                     MFLSLIGLLAIAGIRLHRATVGTSEIQSRLNTNIELTESIDHQTKDVLTPLFKIIGDE
                     VGIRIPQKFSDLVKFISDKIKFLNPDREYDFRDLRWCMNPPERVKINFDQFCEYKAAV
                     KSIEHIFESPLNKSKKLQSLTLGPGTGCLGRTVTRAHFSELTLTLMDLDLEMKHNVSS
                     VFTVVEEGLFGRTYTVWRSDARDPSTDLGIGHFLRVFEIGLVRDLGLGPPVFHMTNYL
                     TVNMSDDYRRCLLAVGELKLTALCSSSETVTLGERGVPKREPLVVVILNLAGPTLGGE
                     LYSVLPTSDLMVEKLYLSSHRGIIKDDEANWVVPSTDVRDLQNKGECLVEACKTRPPS
                     FCNGTGSGPWSEGRIPAYGVIRVSLDLASDPGVVITSVFGPLIPHLSGMDLYNNPFSR
                     AVWLAVPPYEQSFLGMINTIGFPNRAEVMPHILTTEIRGPRGRCHVPIELSRRVDDDI
                     KIGSNMVILPTIDLRYITATYDVSRSEHAIVYYIYDTGRSSSYFYPVRLNFKGNPLSL
                     RIECFPWRHKVWCYHDCLIYNTITDEEVHTRGLTGIEVTCNPV"
     misc_feature    7884..9128
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="sialidases/neuraminidases; Region: Sialidase;
                     cl21531"
                     /db_xref="CDD:389792"
     misc_feature    order(7896..7913,8715..8720,8772..8774,8823..8825,
                     8832..8834,8838..8840,8946..8948,8952..8954,8964..8966,
                     8973..8975)
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="receptor binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:271229"
     misc_feature    order(7926..7928,7932..7940,7947..7952,7959..7961,
                     7965..7967,8031..8033,8040..8042,8106..8108,8112..8120,
                     8136..8141,8148..8150,8154..8156)
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:271229"
     misc_feature    7971..8165
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="Sialidase propeller 1 [structural motif]; Region:
                     Sialidase propeller 1"
                     /db_xref="CDD:271229"
     misc_feature    8172..8327
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="Sialidase propeller 2 [structural motif]; Region:
                     Sialidase propeller 2"
                     /db_xref="CDD:271229"
     misc_feature    8361..8630
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="Sialidase propeller 3 [structural motif]; Region:
                     Sialidase propeller 3"
                     /db_xref="CDD:271229"
     misc_feature    8634..8777
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="Sialidase propeller 4 [structural motif]; Region:
                     Sialidase propeller 4"
                     /db_xref="CDD:271229"
     misc_feature    8850..8984
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="Sialidase propeller 5 [structural motif]; Region:
                     Sialidase propeller 5"
                     /db_xref="CDD:271229"
     misc_feature    9012..9128
                     /gene="H"
                     /locus_tag="PPRVgp7"
                     /note="Sialidase propeller 6 [structural motif]; Region:
                     Sialidase propeller 6"
                     /db_xref="CDD:271229"
     gene            9288..15839
                     /gene="L"
                     /locus_tag="PPRVgp8"
                     /db_xref="GeneID:3119773"
     CDS             9288..15839
                     /gene="L"
                     /locus_tag="PPRVgp8"
                     /codon_start=1
                     /product="large protein"
                     /protein_id="YP_133828.1"
                     /db_xref="GOA:Q5ZER1"
                     /db_xref="InterPro:IPR001016"
                     /db_xref="InterPro:IPR014023"
                     /db_xref="InterPro:IPR016269"
                     /db_xref="UniProtKB/TrEMBL:Q5ZER1"
                     /db_xref="GeneID:3119773"
                     /translation="MDSLSVNQVLYPEVHLDSPIVTNKLVAILEYSGIDHNYVLEDQT
                     LVKNIRYRLGCGFSNQMIINNRGVGETVNSKLKSYPHNRHIIYPDCNKELFCIKDSCI
                     SKKLSELFKKGNSLYSKISHQVLDCLKRVNGKLGLGTDLTYGLKEGILDLGLHMHSSQ
                     WFETFLFWFTIKTEMRSMIKEQSHICHKRRYNPIFVSGDAFEVLVSRDLVVIIDKNTQ
                     YVFYLTFELVLMYCDVIEGRLMTETAMAIDQRYSELLSRVRYLWDLIDGFFPTLGNTT
                     YQVVALLEPLSLAYLQLQDVTLELRGAFLDHCFKELYEILEHCGIDTEGTYNSITEGL
                     DYVFITHDIHLTGEIFSFFRSFGHPRLEAVTAAENVRKHMNQPKVISYETMMKGHAVF
                     CGIIINGFRDRHGGSWPPVALPEHASAAIRNAQASGEGLTHDLCIDNWKSFVGFKFGC
                     FMPLSLDSDLTMYLKDKALAALKNEWDSVYPKEYLRYNPPRGTESRRLVEVFLNDSSF
                     DPYNMIMYVVNGSYLKDPEFNLSYSLKEKEIKETGRLFAKMTYKMRACQVIAENLISN
                     GVGKYFRDNGMAKDEHDLTKALHTLAVSGVPKNNKDNHRGGPPRRTTNREVRSSQDTK
                     TQNRDKVQGGPVYNYLRCQPISPDQGESYETVSAFITADLKKYCLNWRYETISIFAQR
                     LNEIYGLPSFFQWLHRILEKSVLYVSDPHCPPDLDNHIPLDSVPNAQIFIKYPMGGIE
                     GYCQKLWTISTIPYLYLAAYESGVRIASLVQGDNQTIAVTKRVPSSWPYSLKKREASK
                     AAQNYFVVLRQRLHDVGHHLKANETIVSSHFFVYSKGIYYDGLLVSQSLKSIARCVFW
                     SETIVDETRAACSNIATTVAKSIERGYDRYLAYSLNILKIFQQILISLNFTINTTMTQ
                     DVVAPIIENGDLLIRMALLPAPIGGLNYLNMSRLFVRNIGDPVTSSIADLKRMIDAGL
                     MPEETLHQVMTQTPGESSYLDWASDPYSANLPCVQSITRLLKNITARYILISSPNPML
                     KGLFHEGSRDEDEELASFLMDRHIIVPRAAHEILDHSITGAREAIAGMLDTTKGLIRT
                     SMKRGGLTPRVLARLSNYDYEQFRSGITLLTKKGQCYLIDKDSCSVQLAIALRSHMWA
                     RLARGRPIYGLEVPDILESMNGYLIKRHESCAICETGSSHYGWFFVPAGCQLDDVSRE
                     TSALRVPYVGSTTEERTDMKLAFVRSPSRSLKSAVRIATVYSWAYGDDEKSWGEAWML
                     ARQRANITLDELRMITPVSTSTNLAHRLRDRSTQVKYSGTSLVRVARYTTISNDNLSF
                     VISEKKVDTNFIYQQGMLLGLGILENLFRLEATTGVSNTVLHLHVETECCVVPMVDHP
                     RIPSLRNIKVTDELCTNPLIYDRSPIIEHDATRLYSQSHRRHLVEFVTWSTSQLYHIL
                     AKSTAMSMIELITRFEKDHMNEIAALIGDDDINSFITEFLLVEPRLFIVYLGQCAAIN
                     WAFDIHYHRPSGKHQMGELLYSLLSRMSKGVYKIFTNALSHPKVYKKFWRSGVIEPIH
                     GPSLDTQNLHVTVCDMIYGSYVTYLDLLLNDELDDYPYLLCESDEDVVTDRFDNIQAK
                     HLCVLADVYCSSKRCPSIIGMSPIEKCTILTHYIKGESVQSPSGTSWNTDPLVVDHYS
                     CSLTYLRCGSIKQIRLRVDPGFVFEALTDVDFKQPRKAKLDISVVGLTDFSPPCDNVG
                     DFLGTINTLRHNLPVTGTGVSNYEVHAYRRIGLNSSACYKAVEISTLIRPSLEVGEHG
                     LFLGEGSGSMLAAYKEVLKLANCYYNSGVTAEGRAGQREISPYPSEMSLVENQMGIER
                     SVKVLFNGKPEVTWVGTTDCYKYIISNIQTSSLGFIHSDIETLPTKDAVEKLEEFASI
                     LSLSLILGKIGSITVVKVMPISGDFTQGFIAYAIQYFRESLLAYPRYSNFISTECYLI
                     MIGLKANRLINPEAIKQSIIRAGVRTAPGLVSHILSGKQKGCIQSFLGDPYIQGDFNK
                     HLKSLTPIEKILVNCGLSINGTKICRDLIHHDIASGPDGLMSSTIILYRELAHFKDNI
                     RSQHGMFHPYPVLANSRQRELILRIAKKFWGYVLLYSDDPALIRQTIKNLKRNHLTFD
                     LHSNPFIKGLSKAEKLLVRTSSLRREWLFTLDTKEVKEWFKLVGYSALIRG"
     misc_feature    9324..12641
                     /gene="L"
                     /locus_tag="PPRVgp8"
                     /note="Mononegavirales RNA dependent RNA polymerase;
                     Region: Mononeg_RNA_pol; pfam00946"
                     /db_xref="CDD:366381"
     misc_feature    12990..15827
                     /gene="L"
                     /locus_tag="PPRVgp8"
                     /note="mRNA capping enzyme, paramyxovirus family; Region:
                     paramyx_RNAcap; TIGR04198"
                     /db_xref="CDD:275046"
     regulatory      15840..15948
                     /regulatory_class="promoter"
                     /note="antigenome promoter"
ORIGIN      
        1 accaaacaaa gttgggtaag gatagatctt ataataacta tggactggca aacttaggag
       61 taaagatcct actgtcgggg ggaggaggag gagcaagatc tttgactatg gcgactcttc
      121 ttaaaagctt agcattgttc aagaggaaca aagacaaagc gccgacggca tcaggttcag
      181 gaggggccat ccgggggatt aagaatgtta tcatagtccc gattcccgga gactcgtcca
      241 tcattacccg ttcaagactg ctcgacaggc ttgtcagatt ggccggagat cctgacatca
      301 acgggtcaaa gttaaccggc gtgatgatca gcatgttatc tttgttcgta gagtcacccg
      361 ggcaattgat acagcgaatc acagatgatc cagatgttag tatccgcctt gttgaggtag
      421 ttcaaagtac taggtctcag tccgggttga cctttgcatc acgtggtgct gatttagaca
      481 acgaggcaga catgtatttt tcaactgagg ggccctcgag tggaggtaag aaaaggatca
      541 actggtttga gaacagagaa ataatagaca tagaagtgca ggatccagaa gagttcaata
      601 tgttgttagc ctccatacta gcacaagtct ggatccttct ggccaaggct gttacggcac
      661 cggatacggc agctgactca gaattgagaa ggtgggttaa atatacacaa caaaggagag
      721 tgattgggga atttcgcctt gacaaagggt ggctggacgc agtccgcaac agaattgcag
      781 aagatctatc acttcggcgg ttcatggtat ctctcatact tgacatcaag aggacccccg
      841 gcaacaagcc aaggattgca gaaatgatct gcgacattga caactatatt gtcgaagccg
      901 gactcgccag tttcatcctt actatcaagt ttggtatcga aaccatgtat cctgcattag
      961 ggctccacga gtttgccggg gaattgtcca ctattgaatc cttgatgaac ttgtatcaac
     1021 agctaggaga ggttgcaccc tacatggtaa ttctcgagaa ctcaattcag aacaagttta
     1081 gtgcaggagc ttatcccctc ctctggagct atgcgatggg tgtcggagtt gggctggaga
     1141 actcaatggg gggcttgaac tttggcaggt catattttga ccctgcctat tttcgtctcg
     1201 gacaggagat ggtcagaaga tctgcaggaa aggtcagctc tgtgattgcg gccgagctcg
     1261 gcatcacagc agaggaagcc aaactagtct cggaaatcgc ctcgcaggct ggggacgaaa
     1321 gaaccgctag agggactggg cctcgacagg cgcaggtctc cttcctccag cacaaaacag
     1381 gagagggaga gtcgtccgca ccagcaacca gagagggggt caaagctgcg atcccaaacg
     1441 gatccgaaga aagggacagg aagcaaacac gctcaggaag gcccagagga gagaccccca
     1501 gccaactgct cctggaaatc atgccagagg atgaggtctc gcgagagtct ggtcaaaacc
     1561 ctcgtgaggc tcaaagatcg gccgaggcac tcttcaggct gcaggccatg gccaagattc
     1621 tggaggacca ggaggaggga gaagacaaca gtcaggtcta caacgacaag gatctcctcg
     1681 gctaagcaga cgcaccctct gtcgaaatca gtgacaagac atctcctacc agtattataa
     1741 aaaacttagg acccaggtcc aagcaagcac acatcgacac tccaatcagt cgagcggaga
     1801 ccaccgatgg cagaagaaca agcataccat gtcaacaagg ggctggaatg tatcaagtcc
     1861 ctcaaagcct ctcccccgga tctatccacc atcagagaca ccattgagag ctggagagag
     1921 gggctcagcc cctcgggccg tgcaacaccg aaccctgata cgtccgaggg agatcatcag
     1981 agtatcaacc aatcatgctc accagcaatc ggaccaaaca aagtctactt gtctcctgga
     2041 gataatctcg gatttagaga gatcactggc aacgactgtg aggctgggct cggaggagtc
     2101 caggggaaaa gatccaactc tcaagtacag cgttactatg tttatagcca cgggggtgaa
     2161 gagattgaag gactcgagga tgctgactct ctcgtggttc aagcagatcc tccagttgct
     2221 aacgtcttca atggaggaga ggatggatct gacgacagcg atgtggactc tggcccagat
     2281 gatcccagca gagatactct atatgaccgg ggatctgttg ccggcaatga tgtcgctagg
     2341 tccacagatg tcgaaaaact agaaggtgct gatattcaag aggttcttaa ctcccagaaa
     2401 ggcaaaggag gaagattcca aggcgggaag accttacgag tcccggaaat acccgatgtc
     2461 aagcactcca gaccatcagc ccaatcaatt aaaaagggca cagacgggaa ctcagtctca
     2521 tctggaacgg tgacagagtg tttatcgata agtggtgcaa cccaagctgt gccagagtca
     2581 agatgggagt catcagagca aaatgcgtct gtggggagtg tcctcaagtc tgcgaggagt
     2641 gcagagacga tccaggggtt gacacaagaa tctggtacca tagcatcact gactcagcct
     2701 aaagagaatg actccgagta tgagtatgag gatgacctat ttaaagagat tcaggacatc
     2761 cgtgcaagca ttgccaagat ccatgatgac aacaaaacta tcctctcaaa gcttgattct
     2821 atactgttat tgaaaggaga agtcgacact atcaagaaac aaatcagcaa gcagaatata
     2881 agtatatcca ccattgaggg ccatctctcc agtataatga tagctatccc gggctttggg
     2941 aaggatatca aggacccaac atccgaggtt gagttgaacc cagatttaag acccataata
     3001 agccgtgact ctggcagagc cctcgcggag gtcctcaaga aacccgctgt ggataggtct
     3061 cagaaaattg gaaccaaagc caactccagc tcaaagggtc agcttcttaa ggatctccag
     3121 ctaaaacctg tcgacaagca ggcaagctct gcaatcgggt ttgtcccatc cgaccatgaa
     3181 tcatccagaa atgtcatccg ctccataatc aagtcgagca agctaaacac tgatcacaag
     3241 gactatcttc tagatttact aaatgatgtg aaaggctcca aggatcttaa ggaattccac
     3301 aagatgctaa cagcaattct cgccaagcac ccgtaacaca ccctccagtc accatctcat
     3361 actcggctga aaacatcctc tcaatcaggc tattacaaaa aacttaggag caagggtaac
     3421 tgagcttcgc agacaagatg accgagatct acgacttcga taaatcagca tgggatgtca
     3481 aagggtcaat tgctcgcata gaacccacca tccaccatga cggtcgactg ataccccagg
     3541 taagggtcat cgatcctggt ctgggagaca gaaaagatga gtgcttcatg tacctgtttc
     3601 tcctaggagt gattgaggat aacgaccccc tgtctccccc agttggaaga acctttggtt
     3661 ctttacctct aggggtcggt aggtcaactg ctaagccaga agaactacta agagaggcca
     3721 cagaactaga tatagtggtg aggcgcactg caggattaag tgagaaactg gtattttaca
     3781 acaacactcc gctgtccttg ttaacgccct ggaagaaggt tctgacaacc ggaagtgtgt
     3841 ttagtgctaa ccaggtttgc aatgcagtca acctagtccc gcttgatact ccccagagat
     3901 tcagggttgt gtacatgagc ataactagat tatcagacaa tggttactat agtgtgccca
     3961 gaagaatgct ggagttccgc tcagccaatg cagtagcctt caacatcttg gttacactaa
     4021 gaattgaaaa tggcacaagc cctagaagat acatagttgg ctcatgggag aatccagagg
     4081 tcacatttat ggtacacgtg ggcaacttta gaagaaagaa gaacgaagta tactcagctg
     4141 attactgcaa aatgaagatt gaaaagatgg gtttagtttt tgccctggga ggaataggtg
     4201 gaacaagtct ccatattaga agcaccggga aaatgagcaa aaccctccat gcacagctgg
     4261 ggttcaagaa aatcttatgt taccccctaa tggatgttaa tgaggatctt aaccgatatc
     4321 tctggcgggc agagtgccga atagtcaaaa tccaagccgt cctacagcca tcagtacccc
     4381 aagaattccg tgtctacgat gatgtcatca tcaacgatga tcaaggccca ttcaagatcc
     4441 cgtagttcac cctcaaagga atgaacccac ccccaggaag gggccccacc ctcccccgcc
     4501 agaaaacaca ctccaaggct ccccgacaca gcaccaacac agccactctc ccgatgggac
     4561 gaggccggcc ccccaacaaa cccggtccag gcggggggcc cccccccgac ctgccgggcg
     4621 ccgaccgagc aggccggcga gaagccccca agagcccccg acgaagaccg agcaccccat
     4681 ccccccaaaa acgtcccccc aacacgcccg aggccaggcg ccgggcaccc ccagacccgc
     4741 caccggcgag acagaacccc aaggggggac cccccaaacc aaagggacca ccggggaagg
     4801 ctccgccgaa ccagcacaga cccgacccaa gcaaggcgga cccccaacac gaaactgccc
     4861 agcgcacctc actcatcatc aaacaaaact taggggccaa gtccatacga caggccccag
     4921 cccgccagac ggagggccgc agaaaggaag gagacacgac cgccccagaa ggaggacacc
     4981 caaccaccga aacacccagc cccagggaag gagtcccccc ccacacggcg aaggaacggg
     5041 tgagagaccc cgaggaggac ccgaccggga gccaggagcc ggcgacgccg gcggcaaaca
     5101 ggccgggcgc acaccagact ccaccagagg agccgaggag agcctgaccc cgcgtggacc
     5161 aaacggcagg gaatccaacc ccgccaaaaa aagaggtgag ccccccttcc cccccgcaca
     5221 caacctgcag acagaccgag ggaggaccac ctcccaacaa gacaggcggc tccctcgcag
     5281 ccgagccgca tctccccaga agaggacacc cccgcacact ccgaacaccc cctcgccccc
     5341 cgccaccggg acaggggctc cgccaccaca gaccagagcc accgagagcc agccagaggt
     5401 cccctccagt cccgtccagt gcccccccga agaggccccg gcaaggcccc ccagcccgac
     5461 gacccctgca cgcaccggaa gagggacccg cccgagaacg tccggcacat ccatgtgtaa
     5521 acatcatgac acgggtcgca atcttgacat ttctgtttct tttcccaaat gctgttgcgt
     5581 gccagattca ctggggcaat ctatccaaga tcgggattgt aggaacaggg agtgccagct
     5641 acaaggtgat gactaggcca agccaccaaa ctctggttat aaagttaatg ccaaatataa
     5701 cagccatcga caattgtaca aagtcagaga ttgcagagta caagagattg ctgatcacag
     5761 tgttaaagcc tgtagaggat gctctgtcag tgataaccaa gaatgtaaga ccaattcaaa
     5821 ctctgacacc tgggcgtaga actcgccgct ttgctggagc tgttctggcc ggagtagcac
     5881 ttggagttgc gacagccgct cagataactg caggagtcgc ccttcatcaa tcattgatga
     5941 actcccaagc aattgagagt ttaaaaacca gtcttgagaa gtcgaatcag gcaatagagg
     6001 aaatcagact tgcaaataag gagaccatac tagcagtaca gggcgtccag gattatatca
     6061 acaatgagct tgtcccttct gtccatagaa tgtcatgcga gctggtaggt cacaagctcg
     6121 gcctcaagct ccttaggtac tacaccgaga tcctgtccat attcgggccc agccttcgag
     6181 acccgatagc tgccgaaata tcaatccagg cactcagtta tgcattaggc ggggacatta
     6241 atagaatcct ggacaagctt gggtatagcg gtggggattt ccttgccatc ctagaaagca
     6301 agggaataaa ggcccgggta acatatgtgg atacaagaga ttactttata attcttagca
     6361 tcgcctaccc aaccttatct gagatcaagg gagtgatagt tcacaagata gaagctataa
     6421 catacaacat tggggcacag gagtggtata ctactatccc taaatatgta gccactcagg
     6481 ggtatctgat atcgaacttt gatgagacgt catgcgtatt cactccggat gggacagttt
     6541 gcagccagaa tgcgttgtac ccaatgagcc cattgctcca ggaatgtttc caggggtcaa
     6601 caaaatcgtg cgccagaacc ctagtttcag ggaccataag taatagattt atcctatcaa
     6661 aagggaacct gattgcaaat tgtgcgtcag ttctgtgcaa atgctacaca acagagacag
     6721 tcattagcca agatcccgac aaactactaa ctgttgtagc atccgacaag tgtcctgtag
     6781 ttgaggtgga tggagtgaca atacaggtcg gcagtcgaga gtatccggat tctgtatacc
     6841 tacacaaaat agacttaggt ccagccatct ccctagaaaa actggatgta ggcaccaatt
     6901 taggcaatgc agtcacaaga ctggagaatg caaaggagct cctagatgca tcagaccaaa
     6961 tactgaagac tgttaaaggg gtacctttcg gtgggaatat gtacatagca ctggcagctt
     7021 gcattggggt atccctaggg cttgtcacat taatatgctg ctgcaagggg aggtgtaaga
     7081 acaaggaagt tcccatctcc aaaatcaacc cagggctcaa acccgacctg accgggacct
     7141 caaagtcgta cgtgagatca ctgtagtcag aatcacctga atcattcggc ataacacaca
     7201 tacatgtacg acacaagcag tcagaggacg caggaaaccc agcctccgat cacccacctg
     7261 accccacccc acactccacc acacattagt catcaaacaa aacttaggac gaaaggtcaa
     7321 tcaccatgtc cgcacaaagg gaaaggatca atgccttcta caaagacaat cctcacaata
     7381 agaaccatag ggtgatcctg gatagagaac gcttggtcat cgaaagaccc tacatcttgc
     7441 ttggagtcct gctggtaatg ttcctgagtc taatcggact gctggccatt gcagggatca
     7501 ggcttcaccg ggccaccgtt ggaacatcag agatccagag tcggctgaat accaatattg
     7561 agttgaccga atctattgat caccaaacta aggatgtctt aactcccctt ttcaaaatca
     7621 ttggcgatga agtcggcatc agaattccac agaaattcag tgatcttgtc aagttcatct
     7681 ccgataagat taaattcctc aaccctgata gagagtatga tttcagggat ctccggtggt
     7741 gcatgaatcc ccccgagaga gtcaaaatta attttgatca gttttgtgag tacaaggctg
     7801 cggttaagtc aattgaacat atatttgaat caccactcaa caagtcaaaa aagctgcaat
     7861 cattgactct tgggcccgga acaggctgtc taggcaggac agtaacaaga gctcatttct
     7921 cagaacttac actgacctta atggacctgg atctagagat gaagcacaac gtatcctcag
     7981 tgtttaccgt agttgaagag ggattattcg gaagaacata taccgtctgg agatccgatg
     8041 ccagggatcc gagcaccgat ctaggtattg gccacttttt aagagtcttc gagattggac
     8101 tggtaagaga tctcgggctg ggtccccctg tttttcatat gaccaactat ctcacagtga
     8161 acatgagtga tgactatcgg agatgtcttt tagcggtagg ggagttaaag ttgacagccc
     8221 tatgcagctc atctgagact gtgacactgg gcgagagagg agttccaaag agggagcctc
     8281 ttgtagttgt gatactcaac ctagctgggc ccactctagg gggcgaacta tacagtgtct
     8341 tgcctacctc tgatctcatg gtggagaaac tctatttatc ttcacataga gggattatca
     8401 aagatgacga ggccaattgg gtagtgccgt ctaccgatgt tcgtgatctt caaaacaaag
     8461 gagaatgttt ggtggaggca tgcaagactc gacctccttc attttgcaat ggcacaggat
     8521 caggcccgtg gtcagagggg agaatccctg cttacggggt gatcagggtc agtcttgact
     8581 tagctagtga cccgggtgta gttatcactt cagtgtttgg cccactgata cctcacctat
     8641 ctggcatgga tctttacaac aacccgtttt ctagagctgt atggttggct gtaccacctt
     8701 atgagcagtc atttctagga atgattaata cgattggatt ccctaacaga gcagaggtta
     8761 tgccgcacat tttgaccaca gagatcagag gccctcgggg tcgttgccat gttcccatag
     8821 aattgtctcg cagggttgat gacgacatca agattgggtc caacatggtc atattgccga
     8881 cgatagacct gagatatatt acagccactt atgatgtttc taggagcgag catgctatcg
     8941 tgtactatat ctatgacaca ggtcgctcat catcttactt ctacccagtt cggctgaact
     9001 tcaaaggcaa tcctctctct ctgaggatag agtgtttccc ttggcgtcat aaggtgtggt
     9061 gctaccatga ttgtcttata tacaacacca taacagatga agaagtccat acgagagggc
     9121 tgaccggtat agaggtaaca tgtaatccag tctgagcaga gctacgaccg ccactcaggc
     9181 agtcccttga gtcgccaccg aatccaagca gcacagcctg ggacactcaa cagcacagcc
     9241 cagccaacaa tgttataaaa aacttaggag ccagggctgt aggggccatg gactccctat
     9301 cagtcaatca ggtcttgtac cctgaggtcc atctagatag ccctattgtc acaaacaaac
     9361 tagttgccat ccttgagtac tcgggtatcg accataacta tgttcttgaa gaccagaccc
     9421 ttgtcaagaa tattaggtat agactggggt gcggtttttc aaatcaaatg atcatcaata
     9481 acaggggggt gggtgaaaca gtcaattcta aactcaaaag ttacccccat aatcgtcata
     9541 tcatataccc ggattgcaat aaggagttgt tttgtatcaa agatagctgc atatctaaga
     9601 agctctcgga gctattcaag aagggtaatt ccttgtactc taagataagt caccaggtac
     9661 tggattgtct taagagagtc aatgggaaat taggcctggg cacagatctt acctatggtc
     9721 tgaaggaggg tatccttgac ctagggttgc acatgcatag ctctcaatgg ttcgagactt
     9781 tcctgttctg gttcactatc aagacagaga tgagatcaat gatcaaagaa cagtcccata
     9841 tatgccacaa gaggaggtat aacccgattt ttgtgtcggg ggatgcattc gaggtgcttg
     9901 tatcacgaga cctcgttgtg ataattgata agaataccca gtatgtcttc tacttaacat
     9961 ttgagctggt ccttatgtat tgtgatgtca tagagggcag acttatgact gagacagcca
    10021 tggccataga tcagagatat tcagaacttc taagccgagt cagatacttg tgggatctta
    10081 ttgatgggtt cttcccaaca ctaggcaaca ccacatacca agttgttgcc ctgcttgaac
    10141 cattatcgtt ggcttatctt caacttcagg atgtcactct ggagttaaga ggtgcttttt
    10201 tagaccattg cttcaaagaa ctctatgaga tattggagca ttgcggcatt gacacagaag
    10261 gcacctacaa ttccatcact gaaggattgg attacgtatt catcacccac gatatacatc
    10321 taactgggga gattttttca ttctttcgga gtttcggaca cccccgtcta gaagcagtca
    10381 ccgctgcaga aaatgtcaga aaacatatga accaaccgaa ggtaatcagt tatgagacta
    10441 tgatgaaagg gcacgcagta ttttgcggga taatcataaa tggttttagg gaccgacatg
    10501 gcggcagctg gccccctgtt gcattgccag aacatgcttc tgctgcgatc cggaatgcgc
    10561 aggcatcagg tgagggactg acccatgacc tgtgtataga caattggaag tcctttgttg
    10621 gattcaaatt tggctgcttt atgccactca gcctagatag tgatttgacc atgtacctca
    10681 aagacaaggc attggctgca ctgaagaatg agtgggattc agtttacccg aaggaatacc
    10741 tccgttataa cccacctagg gggacagagt caaggcgatt ggtggaggtg ttcctgaatg
    10801 actccagctt tgatccttat aacatgataa tgtacgtggt gaatggctcc taccttaaag
    10861 accctgagtt taatctctca tacagcctaa aagagaagga gataaaggag acagggcggt
    10921 tgtttgccaa aatgacctat aagatgcggg cctgtcaggt aatcgctgaa aatctgatat
    10981 cgaatggtgt tgggaagtat ttccgagaca atgggatggc aaaggacgag catgacctaa
    11041 caaaagccct tcacactctg gcagtctcag gtgttcccaa gaacaacaaa gataaccacc
    11101 gaggtggccc tcccagaaga acaacaaacc gagaggtgag atcaagccaa gacaccaaaa
    11161 cacaaaatag agacaaggtc caaggggggc ctgtgtacaa ctatttgcga tgccaaccaa
    11221 tcagccctga tcagggcgag tcatacgaga ctgttagtgc attcatcacc gctgacctta
    11281 agaagtattg cctgaattgg agatacgaga caatcagcat atttgcacag aggctgaatg
    11341 aaatatatgg actaccatcc ttctttcaat ggttacacag gattttggaa aaatccgtac
    11401 tctacgtcag tgacccacat tgccctcccg acctagataa tcatatccct ctggacagtg
    11461 tccctaatgc ccaaatattc attaagtacc ccatgggcgg aatagaaggt tattgccaaa
    11521 aactatggac aatcagtact ataccatact tgtatctggc agcctatgag agcggagtaa
    11581 gaatcgcctc actagtgcag ggtgacaatc agacaatcgc agtgacaaaa agagttccaa
    11641 gttcttggcc ttattcacta aaaaagaggg aggcatccaa agccgctcaa aattacttcg
    11701 tagtcttaag gcaaagattg cacgatgtag gtcatcactt aaaggctaat gaaaccatag
    11761 tatcttctca cttttttgta tattccaagg ggatttatta tgacggcctg ctagtctcac
    11821 aatcactaaa gagcatcgcc agatgtgtct tctggtccga gactatagtg gatgaaacca
    11881 gagcggcttg cagcaatatt gcaacaactg tcgccaagag tatagagagg ggttatgata
    11941 gataccttgc atattctttg aatatcctca agattttcca acagatcctt atatccctta
    12001 acttcactat taacacaaca atgactcagg atgtcgtggc accgatcatc gaaaacgggg
    12061 atttgctgat aaggatggca ctcttgccag cacccatcgg gggtctcaat tatcttaaca
    12121 tgagcaggtt atttgtgaga aatatcggtg acccggtcac ctcctctata gccgacctga
    12181 agaggatgat agatgctggg ctaatgccag aagaaacatt gcatcaagtg atgacccaga
    12241 ccccgggaga atcatcctac ctcgattggg caagtgaccc ttattctgcc aacctaccct
    12301 gcgtacagag tataactcgc cttctcaaaa acatcactgc acgatatatt ttaatcagca
    12361 gcccaaaccc gatgctgaaa ggattgtttc atgaggggag tagagatgaa gacgaggagc
    12421 ttgcaagttt cttaatggat cggcatataa ttgttccaag agctgcacat gaaatcttag
    12481 accatagcat aaccggggca agagaagcta tagccgggat gttggacacc accaagggtc
    12541 tgattagaac aagtatgaaa cggggtggcc tcacccctcg agtcttagcc cgcctttcca
    12601 attatgatta tgaacaattc cgatccggga taacactatt gacaaagaaa gggcagtgtt
    12661 atctcattga caaggactcg tgctcggtgc agctcgctat agctctgagg agccacatgt
    12721 gggctaggtt ggctcgcggg agaccaatct atgggttgga ggtgcccgat atattggaat
    12781 cgatgaacgg ctaccttatc aaacgccacg agtcttgtgc tatctgtgag acgggctcaa
    12841 gtcactacgg atggtttttt gtccctgcag ggtgccagct tgacgatgta tctagagaga
    12901 cttcggctct tcgtgtacct tatgtcggat caacaactga ggaaaggaca gacatgaaac
    12961 ttgcttttgt taggtctcca agtcgatccc tcaagtcagc agtcagaatt gcaacagttt
    13021 actcatgggc ctacggggat gatgagaaat catggggtga agcctggatg ctagctaggc
    13081 agagagccaa catcacctta gatgaattga gaatgatcac tccagtctct acatccacca
    13141 acctagccca ccggttgagg gatcggagca cccaggtgaa atactcgggg acatcccttg
    13201 tgagggttgc aagatacaca accatctcca atgataacct gtcatttgtg atatctgaga
    13261 aaaaagtgga taccaacttc atttatcagc aagggatgct gctcggtctt gggatccttg
    13321 agaacctctt taggctagag gccaccaccg gagtatccaa cacagtgcta cacctgcacg
    13381 tggaaacaga atgttgtgtt gtacctatgg tggatcaccc aaggataccg agtctccgta
    13441 atataaaagt tacggatgag ctatgcacaa accctttgat ctacgacagg tctcccatca
    13501 tagagcacga tgcaacccga ctatactcac agagccacag gagacatctg gtggagtttg
    13561 ttacctggtc aacaagccag ctttaccata tactggctaa gtctacagca atgtccatga
    13621 ttgagttgat cacgagattc gagaaagatc acatgaatga aatagccgcc ctgattggcg
    13681 atgacgacat caacagcttc atcacagaat ttttgctagt agagcctaga ttatttatag
    13741 tttaccttgg tcagtgtgct gccatcaatt gggcctttga tatacattat catcggccct
    13801 cgggcaagca ccagatgggg gaactcctct actctctgct ctctcggatg agcaaaggag
    13861 tatataagat cttcaccaat gctttgagcc accccaaagt ttacaagaaa ttctggcgaa
    13921 gtggtgtcat tgagccgatt catggcccat ccctggatac acagaattta catgtcactg
    13981 tctgtgacat gatatatggg tcctatgtca cctatttgga tcttttgctg aatgatgagc
    14041 tagatgatta cccgtattta ctctgcgaga gtgatgagga cgtagtcaca gacaggttcg
    14101 acaacattca agccaaacat ctctgtgtat tggccgatgt atattgcagc tccaagaggt
    14161 gtccttcgat aatcgggatg tctcctatag aaaaatgtac cattctcaca cattacatca
    14221 agggagaatc agtacaatcc ccgtcaggga cctcatggaa cactgatccc cttgtagtag
    14281 atcattactc atgctctctg acctaccttc gctgcggttc catcaaacaa atcaggttga
    14341 gagtggatcc tgggtttgta ttcgaggcgt tgacagacgt cgactttaaa cagcctcgca
    14401 aggctaagtt agatatatcg gttgttgggt tgactgattt ctctccccct tgcgacaacg
    14461 ttggtgattt tctagggact atcaacacat tgaggcacaa tctgcctgtc accggaaccg
    14521 gggtctcgaa ctatgaagtc cacgcttatc gtagaattgg cctgaattca tcagcatgtt
    14581 ataaagccgt agagatctcc acgttaatca ggccatcctt agaagtcgga gagcatggat
    14641 tgttcctagg agaaggttcc ggttcaatgc tggctgcgta caaggaagtt cttaaattag
    14701 caaattgtta ttacaacagc ggggtaacag cggagggcag agccggacag agggaaatat
    14761 ctccctatcc ttcagagatg agcctagtag agaatcaaat ggggatagag cggagtgtta
    14821 aagtgctgtt caacggcaaa cctgaggtaa cttgggtggg gaccaccgat tgctacaagt
    14881 acataatcag taacatccaa acctctagtc tgggtttcat acattcagat attgagacac
    14941 tcccaaccaa agacgctgtt gagaaattgg aagaatttgc ctctatccta tccttatcct
    15001 tgattttggg aaaaatcggc tctattacag ttgtcaaagt tatgcccatt agcggggatt
    15061 ttacccaagg tttcatagcc tatgctatcc aatattttag ggagagcctg cttgcctatc
    15121 cgagatatag taacttcatc tcgactgagt gttaccttat tatgatagga ttaaaggcca
    15181 atcgattgat aaacccagaa gccattaagc aaagcataat cagagcgggg gtcaggactg
    15241 caccaggact tgtgagccat atattatcag ggaaacagaa aggttgtatt caatctttct
    15301 tgggtgatcc ttatatccaa ggagacttca ataagcacct taaatctcta acccctattg
    15361 agaaaatcct ggtaaattgt ggtctctcga tcaatggcac aaaaatctgt agagatctaa
    15421 tccaccatga tatcgcctcc ggtccagacg gtcttatgag ctctacaatt attttatata
    15481 gggagttggc tcatttcaaa gataatataa ggagtcagca cggaatgttc cacccctacc
    15541 cagtactggc caacagcagg cagcgtgaat taattcttcg aatagccaag aaattctggg
    15601 ggtatgtctt gctatattct gatgacccgg cactaatcag acaaacaatc aagaacttga
    15661 aacggaatca tctaaccttt gacttacata gtaacccgtt tattaaaggg ctatccaaag
    15721 ctgagaaact gctggtgcgg acgagttcac taagaaggga atggttgttc accctcgata
    15781 cgaaagaagt gaaagagtgg ttcaaattgg taggttacag tgcactcatc agaggctagt
    15841 tagctataca tctgccccct tttcctccgc cataagaccc cactgatgat ccaaaagatt
    15901 aaagaaaact acatattgga taagtatcta ttcccagctt tgtctggt
//
DBGET integrated database retrieval system