GenomeNet

Database: RefSeq
Entry: NC_007605
LinkDB: NC_007605
Original site: NC_007605 
LOCUS       NC_007605             171823 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Human gammaherpesvirus 4, complete genome.
ACCESSION   NC_007605
VERSION     NC_007605.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq; complete genome.
SOURCE      Human gammaherpesvirus 4 (Epstein-Barr virus)
  ORGANISM  Human gammaherpesvirus 4
            Viruses; Herpesvirales; Herpesviridae; Gammaherpesvirinae;
            Lymphocryptovirus.
REFERENCE   1  (bases 1 to 171823)
  AUTHORS   de Jesus,O., Smith,P.R., Spender,L.C., Elgueta Karstegl,C.,
            Niller,H.H., Huang,D. and Farrell,P.J.
  TITLE     Updated Epstein-Barr virus (EBV) DNA sequence and analysis of a
            promoter for the BART (CST, BARF0) RNAs of EBV
  JOURNAL   J. Gen. Virol. 84 (PT 6), 1443-1450 (2003)
   PUBMED   12771413
REFERENCE   2  (bases 1 to 171823)
  AUTHORS   Parker,B.D., Bankier,A., Satchwell,S., Barrell,B. and Farrell,P.J.
  TITLE     Sequence and transcription of Raji Epstein-Barr virus DNA spanning
            the B95-8 deletion region
  JOURNAL   Virology 179 (1), 339-346 (1990)
   PUBMED   2171209
REFERENCE   3  (sites)
  AUTHORS   Hatfull,G., Bankier,A.T., Barrell,B.G. and Farrell,P.J.
  TITLE     Sequence analysis of Raji Epstein-Barr virus DNA
  JOURNAL   Virology 164 (2), 334-340 (1988)
   PUBMED   2835854
REFERENCE   4  (bases 1 to 171823)
  AUTHORS   Baer,R., Bankier,A.T., Biggin,M.D., Deininger,P.L., Farrell,P.J.,
            Gibson,T.J., Hatfull,G., Hudson,G.S., Satchwell,S.C., Seguin,C.,
            Tuffnell,P.S. and Barrell,B.G.
  TITLE     DNA sequence and expression of the B95-8 Epstein-Barr virus genome
  JOURNAL   Nature 310 (5974), 207-211 (1984)
   PUBMED   6087149
REFERENCE   5  (sites)
  AUTHORS   Jones,M.D., Foster,L., Sheedy,T. and Griffin,B.E.
  TITLE     The EB virus genome in Daudi Burkitt's lymphoma cells has a
            deletion similar to that observed in a non-transforming strain
            (P3HR-1) of the virus
  JOURNAL   EMBO J. 3 (4), 813-821 (1984)
   PUBMED   6327290
REFERENCE   6  (sites)
  AUTHORS   Jeang,K.T. and Hayward,S.D.
  TITLE     Organization of the Epstein-Barr virus DNA molecule. III. Location
            of the P3HR-1 deletion junction and characterization of the NotI
            repeat units that form part of the template for an abundant
            12-O-tetradecanoylphorbol-13-acetate-induced mRNA transcript
  JOURNAL   J. Virol. 48 (1), 135-148 (1983)
   PUBMED   6310141
REFERENCE   7  (bases 1 to 171823)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-NOV-2005) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   8  (bases 1 to 171823)
  AUTHORS   Farrell,P.J. and Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-NOV-2005) Department of Virology, Ludwig Institute
            for Cancer Research, Faculty of Medicine, Imperial College, St
            Mary's Campus, Norfolk Place, London W2 1PG, UK
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review. This record has been curated by Drs. Andrew
            Davison (Institute of Virology, Glasgow, UK) and Paul Farrell
            (Imperial College School of Medicine, London, UK). The reference
            sequence was derived from AJ507799.
            CONSTRUCTION: This sequence was assembled from data for the B95-8
            (V01555) and Raji (M35547) strains with corrections. The number of
            IR1 (W) repeats in V01555 has been reduced from 11.6 to a more
            typical 7.6, and the missing B95-8 sequence has been restored to
            give a sequence more representative of wild type EBV.
            NUMBERING: Like the modified B95-8 sequence in V01555, this
            sequence starts 1 bp to the left of the EcoRI site separating EcoRI
            Dhet from EcoRI I (i.e. the first A of AGAATTC).
            TRANSCRIPTION: Long-range splicing of the EBNA and BART genes
            generates multiple, complex mRNAs. A single mRNA structure is shown
            for each gene, but alternatives may initiate at other promoters and
            may involve various exon combinations. TATA and polyA signals are
            shown as non-experimental where predicted or as experimental where
            supporting data are available. Predictions of TATA or polyA signals
            are not made for some genes.
            NOMENCLATURE: The original gene nomenclature has been retained.
            Genes presumably inherited from the common ancestor of alpha-,
            beta- and gammaherpesviruses (core genes), from the common ancestor
            of beta- and gammaherpesviruses (betagamma genes), or from the
            common ancestor of gammaherpesviruses (gamma genes) are indicated.
            A standard protein nomenclature has been applied so that orthologs
            have the same name in all herpesviruses.
            CONFIDENCE: Evidence for encoded protein functions is more
            convincing for some ORFs than others, and rests on a combination of
            factors, including evolutionary conservation, expression and
            functional data. The most questionable ORFs are annotated as such.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..171823
                     /organism="Human gammaherpesvirus 4"
                     /mol_type="genomic DNA"
                     /strain="B95-8"
                     /strain="Raji"
                     /host="Homo sapiens"
                     /db_xref="taxon:10376"
                     /type="1"
                     /common="Epstein-Barr virus"
                     /acronym="EBV"
                     /acronym="HHV-4"
     source          join(1..139723,151555..171823)
                     /organism="Human gammaherpesvirus 4"
                     /mol_type="genomic DNA"
                     /strain="B95-8"
                     /host="Homo sapiens"
                     /db_xref="taxon:10376"
                     /type="1"
                     /common="Epstein-Barr virus"
                     /acronym="EBV"
     source          139724..151554
                     /organism="Human gammaherpesvirus 4"
                     /mol_type="genomic DNA"
                     /strain="Raji"
                     /host="Homo sapiens"
                     /db_xref="taxon:10376"
                     /type="1"
                     /common="Epstein-Barr virus"
                     /acronym="EBV"
     gene            join(166011..171823,1..5856)
                     /gene="LMP-2A"
                     /locus_tag="HHV4_LMP-2A"
                     /note="LMP-2 family"
                     /db_xref="GeneID:3783751"
     mRNA            join(166040..166458,58..272,360..458,540..788,871..951,
                     1026..1196,1280..1495,1574..1682,5408..5856)
                     /gene="LMP-2A"
                     /locus_tag="HHV4_LMP-2A"
                     /db_xref="GeneID:3783751"
     CDS             join(166103..166458,58..272,360..458,540..788,871..951,
                     1026..1196,1280..1495,1574..1680)
                     /gene="LMP-2A"
                     /locus_tag="HHV4_LMP-2A"
                     /note="type 3 membrane protein; role in intracellular
                     signalling"
                     /codon_start=1
                     /product="membrane protein LMP-2A"
                     /protein_id="YP_401631.1"
                     /db_xref="UniProtKB/TrEMBL:Q777H4"
                     /db_xref="GeneID:3783751"
                     /translation="MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTP
                     PNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYS
                     PRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALS
                     LLLLAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGG
                     LQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVS
                     MTLLLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLNLTTMFLLMLLWTLV
                     VLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNL
                     FCMLLLIVAGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMSNTLLSA
                     WILTAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV"
     misc_feature    join(166103..166458,58..272,360..458,540..788,871..951,
                     1026..1196,1280..1495,1574..1677)
                     /gene="LMP-2A"
                     /locus_tag="HHV4_LMP-2A"
                     /note="Gammaherpesvirus latent membrane protein (LMP2)
                     protein; Region: Herpes_LMP2; pfam07415"
                     /db_xref="CDD:284762"
     gene            join(169294..171823,1..5856)
                     /gene="LMP-2B"
                     /locus_tag="HHV4_LMP-2B"
                     /note="LMP-2 family"
                     /db_xref="GeneID:3783760"
     mRNA            join(169294..169448,58..272,360..458,540..788,871..951,
                     1026..1196,1280..1495,1574..1682,5408..5856)
                     /gene="LMP-2B"
                     /locus_tag="HHV4_LMP-2B"
                     /db_xref="GeneID:3783760"
     CDS             join(59..272,360..458,540..788,871..951,1026..1196,
                     1280..1495,1574..1680)
                     /gene="LMP-2B"
                     /locus_tag="HHV4_LMP-2B"
                     /note="type 3 membrane protein; role in intracellular
                     signalling"
                     /codon_start=1
                     /product="membrane protein LMP-2B"
                     /protein_id="YP_401632.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK9"
                     /db_xref="GeneID:3783760"
                     /translation="MNPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALSLLL
                     LAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGGLQG
                     IYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVSMTL
                     LLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLNLTTMFLLMLLWTLVVLL
                     ICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNLFCM
                     LLLIVAGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMSNTLLSAWIL
                     TAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV"
     misc_feature    join(<59..272,360..458,540..788,871..951,1026..1196,
                     1280..1495,1574..1677)
                     /gene="LMP-2B"
                     /locus_tag="HHV4_LMP-2B"
                     /note="Gammaherpesvirus latent membrane protein (LMP2)
                     protein; Region: Herpes_LMP2; pfam07415"
                     /db_xref="CDD:284762"
     gene            1691..5856
                     /gene="BNRF1"
                     /locus_tag="HHV4_BNRF1"
                     /note="gamma gene; FGARAT family"
                     /db_xref="GeneID:3783722"
     regulatory      1691..1696
                     /regulatory_class="TATA_box"
                     /gene="BNRF1"
                     /locus_tag="HHV4_BNRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             1736..5692
                     /gene="BNRF1"
                     /locus_tag="HHV4_BNRF1"
                     /function="tegument protein"
                     /codon_start=1
                     /product="tegument protein G75"
                     /protein_id="YP_401633.1"
                     /db_xref="UniProtKB/TrEMBL:Q777H3"
                     /db_xref="GeneID:3783722"
                     /translation="MEERGRETQMPVARYGGPFIMVRLFGQDGEANIQEERLYELLSD
                     PRSALGLDPGPLIAENLLLVALRGTNNDPRPQRQERARELALVGILLGNGEQGEHLGT
                     ESALEASGNNYVYAYGPDWMARPSTWSAEIQQFLRLLGATYVLRVEMGRQFGFEVHRS
                     RPSFRQFQAINHLVLFDNALRKYDSGQVAAGFQRALLVAGPETADTRPDLRKLNEWVF
                     GGRAAGGRQLADELKIVSALRDTYSGHLVLQPTETLDTWKVLSRDTRTAHSLEHGFIH
                     AAGTIQANCPQLFMRRQHPGLFPFVNAIASSLGWYYQTATGPGADARAAARRQQAFQT
                     RAAAECHAKSGVPVVAGFYRTINATLKGGEGLQPTMFNGELGAIKHQALDTVRYDYGH
                     YLIMLGPFQPWSGLTAPPCPYAESSWAQAAVQTALELFSALYPAPCISGYARPPGPSA
                     VIEHLGSLVPKGGLLLFLSHLPDDVKDGLGEMGPARATGPGMQQFVSSYFLNPACSNV
                     FITVRQRGEKINGRTVLQALGRACDMAGCQHYVLGSTVPLGGLNFVNDLASPVSTAEM
                     MDDFSPFFTVEFPPIQEEGASSPVPLDVDESMDISPSYELPWLSLESCLTSILSHPTV
                     GSKEHLVRHTDRVSGGRVAQQPGVGPLDLPLADYAFVAHSQVWTRPGGAPPLPYRTWD
                     RMTEKLLVSAKPGGENVKVSGTVITLGEQGYKVSLDLREGTRLAMAEALLNAACAPIL
                     DPEDVLLTLHLHLDPRRADNSAVMEAMTAASDYARGLGVKLTFGSASCPETGSSASNF
                     MTVVASVSAPGEFSGPLITPVLQKTGSLLIAVRCGDGKIQGGSLFEQLFSDVATTPRA
                     PEALSLKNLFRAVQQLVKSGIVLSGHDISDGGLVTCLVEMALAGQRGVTITMPVASDY
                     LPEMFAEHPGLVFEVEERSVGEVLQTLRSMNMYPAVLGRVGEQGPDQMFEVQHGPETV
                     LRQSLRLLLGTWSSFASEQYECLRPDRINRSMHVSDYGYNEALAVSPLTGKNLSPRRL
                     VTEPDPRCQVAVLCAPGTRGHESLLAAFTNAGCLCRRVFFREVRDNTFLDKYVGLAIG
                     GVHGARDSALAGRATVALINRFPALRDAILKFLNRPDTFSVALGELGVQVLAGLGAVG
                     STDNPPAPGVEVNVQRSPLILAPNASGMFESRWLNISIPATTSSVMLRGLRGCVLPCW
                     VQGSCLGLQFTNLGMPYVLQNAHQIACHFHSNGTDAWRFAMNYPRNPTEQGNIAGLCS
                     RDGRHLALLCDPSLCTDFWQWEHIPPAFGHPTGCSPWTLMFQAAHLWSLRHGRPSE"
     misc_feature    1778..5674
                     /gene="BNRF1"
                     /locus_tag="HHV4_BNRF1"
                     /note="FGAM-synthase; Provisional; Region: PHA03366"
                     /db_xref="CDD:223058"
     regulatory      5841..5846
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="LMP-2A, LMP-2B and BNRF1"
     misc_RNA        6629..6795
                     /product="EBER-1 (pol III transcript)"
     misc_RNA        6956..7128
                     /product="EBER-2 (pol III transcript)"
     rep_origin      7315..9312
                     /note="region containing oriP, the latent cycle origin of
                     DNA replication"
     repeat_region   7421..8042
                     /note="binding sites for EBNA-1 (site I, family of
                     repeats, FR); also functions as a cell type-specific
                     enhancer"
                     /rpt_type=direct
                     /rpt_unit_range=7421..7450
     repeat_region   9021..9135
                     /note="dyad symmetry, binding site for EBNA-1 (site II)"
                     /rpt_type=inverted
     gene            9631..10262
                     /gene="BCRF1"
                     /locus_tag="HHV4_BCRF1.1"
                     /note="IL-10 family"
                     /db_xref="GeneID:3783689"
     regulatory      9631..9636
                     /regulatory_class="TATA_box"
                     /gene="BCRF1"
                     /locus_tag="HHV4_BCRF1.1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             9675..10187
                     /gene="BCRF1"
                     /locus_tag="HHV4_BCRF1.1"
                     /note="role in immune regulation"
                     /codon_start=1
                     /product="interleukin-10 BCRF1"
                     /protein_id="YP_401634.1"
                     /db_xref="UniProtKB/TrEMBL:Q777H2"
                     /db_xref="GeneID:3783689"
                     /translation="MERRLVVTLQCLVLLYLAPECGGTDQCDNFPQMLRDLRDAFSRV
                     KTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHV
                     NSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINY
                     IEAYMTIKAR"
     misc_feature    9693..10175
                     /gene="BCRF1"
                     /locus_tag="HHV4_BCRF1.1"
                     /note="Interleukin 10; Region: IL10; cl02501"
                     /db_xref="CDD:413341"
     regulatory      10257..10262
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BCRF1"
                     /locus_tag="HHV4_BCRF1.1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            11305..97654
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.1"
                     /db_xref="GeneID:3783709"
     gene            11305..89482
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="EBNA-3 family"
                     /db_xref="GeneID:3783763"
     gene            11305..82962
                     /gene="EBNA-3A"
                     /locus_tag="HHV4_EBNA-3A"
                     /note="EBNA-3 family"
                     /db_xref="GeneID:3783762"
     gene            11305..37739
                     /gene="EBNA-2"
                     /locus_tag="HHV4_EBNA-2"
                     /db_xref="GeneID:3783761"
     regulatory      11305..11310
                     /regulatory_class="TATA_box"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="C promoter (Cp) used in latency III"
     mRNA            join(11336..11479,11626..11657,14554..14619,14701..14832,
                     17626..17691,17773..17904,20698..20763,20845..20976,
                     23770..23835,23917..24048,26842..26907,26989..27120,
                     29914..29979,30061..30192,32986..33051,33133..33264,
                     35473..35505,35590..35711,55190..55361,86076..86442,
                     95654..97654)
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.1"
                     /note="can start from Cp, Qp or any Wp"
                     /db_xref="GeneID:3783709"
     mRNA            join(11336..11479,11626..11657,14554..14619,14701..14832,
                     17626..17691,17773..17904,20698..20763,20845..20976,
                     23770..23835,23917..24048,26842..26907,26989..27120,
                     29914..29979,30061..30192,32986..33051,33133..33264,
                     35473..35505,35590..35711,55190..55361,83020..83421,
                     83500..89482)
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /product="EBNA-3B"
                     /db_xref="GeneID:3783763"
     mRNA            join(11336..11479,11626..11657,14554..14619,14701..14832,
                     17626..17691,17773..17904,20698..20763,20845..20976,
                     23770..23835,23917..24048,26842..26907,26989..27120,
                     29914..29979,30061..30192,32986..33051,33133..33264,
                     35473..35505,35590..35711,55190..55361,86076..86442,
                     86517..89482)
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /product="EBNA-3C"
                     /note="can start from Cp or any Wp"
                     /db_xref="GeneID:3783763"
     mRNA            join(11336..11479,11626..11657,14554..14619,14701..14832,
                     17626..17691,17773..17904,20698..20763,20845..20976,
                     23770..23835,23917..24048,26842..26907,26989..27120,
                     29914..29979,30061..30192,32986..33051,33133..33264,
                     35473..35505,35590..35711,55190..55361,79950..80293,
                     80382..82962)
                     /gene="EBNA-3A"
                     /locus_tag="HHV4_EBNA-3A"
                     /db_xref="GeneID:3783762"
     mRNA            join(11336..11479,11626..11657,14554..14619,14701..14832,
                     17626..17691,17773..17904,20698..20763,20845..20976,
                     23770..23835,23917..24048,26842..26907,26989..27120,
                     29914..29979,30061..30192,32986..33051,33133..33264,
                     35473..35505,35590..35711,36098..37744)
                     /gene="EBNA-2"
                     /locus_tag="HHV4_EBNA-2"
                     /note="can start from Cp or any Wp"
                     /db_xref="GeneID:3783761"
     repeat_region   12001..35355
                     /gene="EBNA-2"
                     /locus_tag="HHV4_EBNA-2"
                     /rpt_family="IR1; W"
                     /rpt_type=direct
                     /rpt_unit_seq="12001..15072 (3072 bp)"
     repeat_region   12001..15072
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <12541..13692
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.1"
                     /note="originally called BCRF2"
                     /db_xref="GeneID:3783691"
     CDS             <12541..13692
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.1"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401635.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK8"
                     /db_xref="GeneID:3783691"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <12559..13677
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.1"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            14352..37744
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /db_xref="GeneID:3783746"
     regulatory      14352..14357
                     /regulatory_class="TATA_box"
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="W promoter (Wp) used in earlier stages of latent
                     infection"
     mRNA            join(14384..14410,14559..14619,14701..14832,17626..17691,
                     17773..17904,20698..20763,20845..20976,23770..23835,
                     23917..24048,26842..26907,26989..27120,29914..29979,
                     30061..30192,32986..33051,33133..33264,35473..35505,
                     35590..35711,36098..36156,37564..37744)
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /note="can start from Cp or any Wp"
                     /db_xref="GeneID:3783746"
     CDS             join(14409..14410,14559..14619,14701..14832,17626..17691,
                     17773..17904,20698..20763,20845..20976,23770..23835,
                     23917..24048,26842..26907,26989..27120,29914..29979,
                     30061..30192,32986..33051,33133..33264,35473..35505,
                     35590..35694)
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /note="repetitive sequence results in variable size; role
                     in latency"
                     /codon_start=1
                     /product="nuclear antigen EBNA-LP"
                     /protein_id="YP_401636.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK7"
                     /db_xref="GeneID:3783746"
                     /translation="MGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPR
                     RVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSP
                     TRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLL
                     RRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGP
                     EGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTR
                     PGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDR
                     SEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGS
                     PSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQ
                     EEEVVSGSPSGPLRPRPRPPARSLREWLLRIRDHFEPPTVTTQRQSVYIEEEEDED"
     misc_feature    join(17629..17691,17773..17904,20698..20763,20845..20976,
                     23770..>23772)
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /note="Herpesvirus leader protein; Region: Herpes_LP;
                     pfam03363"
                     /db_xref="CDD:281372"
     misc_feature    join(20701..20763,20845..20976,23770..23835,23917..24048,
                     26842..>26844)
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /note="Herpesvirus leader protein; Region: Herpes_LP;
                     pfam03363"
                     /db_xref="CDD:281372"
     misc_feature    join(23773..23835,23917..24048,26842..26907,26989..27120,
                     29914..>29916)
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /note="Herpesvirus leader protein; Region: Herpes_LP;
                     pfam03363"
                     /db_xref="CDD:281372"
     misc_feature    join(29917..29979,30061..30192,32986..33051,33133..33264,
                     35473..35505,35590..35685)
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /note="Herpesvirus leader protein; Region: Herpes_LP;
                     pfam03363"
                     /db_xref="CDD:281372"
     repeat_region   15073..18144
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <15613..16764
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.2"
                     /db_xref="GeneID:3783734"
     CDS             <15613..16764
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.2"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401637.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK6"
                     /db_xref="GeneID:3783734"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <15631..16749
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.2"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      17424..17429
                     /regulatory_class="TATA_box"
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="W promoter (Wp) used in earlier stages of latent
                     infection"
     repeat_region   18145..21216
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <18685..19836
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.3"
                     /db_xref="GeneID:3783735"
     CDS             <18685..19836
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.3"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401638.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK5"
                     /db_xref="GeneID:3783735"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <18703..19821
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.3"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      20496..20501
                     /regulatory_class="TATA_box"
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="W promoter (Wp) used in earlier stages of latent
                     infection"
     repeat_region   21217..24288
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <21757..22908
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.4"
                     /db_xref="GeneID:3783736"
     CDS             <21757..22908
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.4"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401639.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK4"
                     /db_xref="GeneID:3783736"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <21775..22893
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.4"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      23568..23573
                     /regulatory_class="TATA_box"
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="W promoter (Wp) used in earlier stages of latent
                     infection"
     repeat_region   24289..27360
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <24829..25980
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.5"
                     /db_xref="GeneID:3783737"
     CDS             <24829..25980
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.5"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401640.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK3"
                     /db_xref="GeneID:3783737"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <24847..25965
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.5"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      26640..26645
                     /regulatory_class="TATA_box"
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="W promoter (Wp) used in earlier stages of latent
                     infection"
     repeat_region   27361..30432
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <27901..29052
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.6"
                     /db_xref="GeneID:3783738"
     CDS             <27901..29052
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.6"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401641.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK2"
                     /db_xref="GeneID:3783738"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <27919..29037
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.6"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      29712..29717
                     /regulatory_class="TATA_box"
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="W promoter (Wp) used in earlier stages of latent
                     infection"
     repeat_region   30433..33504
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <30973..32124
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.7"
                     /db_xref="GeneID:3783739"
     CDS             <30973..32124
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.7"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401642.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK1"
                     /db_xref="GeneID:3783739"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <30991..32109
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.7"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      32784..32789
                     /regulatory_class="TATA_box"
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="W promoter (Wp) used in earlier stages of latent
                     infection"
     variation       33127..40536
                     /note="DAUDI deletion"
                     /citation=[5]
     variation       33356..40162
                     /note="P3HR1 deletion"
                     /citation=[6]
     repeat_region   33505..35355
                     /note="partial copy"
                     /rpt_family="IR1; W"
                     /rpt_type=direct
     gene            <34045..35196
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.8"
                     /db_xref="GeneID:3783740"
     CDS             <34045..35196
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.8"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BWRF1"
                     /protein_id="YP_401643.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZK0"
                     /db_xref="GeneID:3783740"
                     /translation="VWEAEGRPRPGEVEGDRPGLCWQSPGDPLRPSGPGRSPSAPQTD
                     PRVSRQGPASSGAAGSPPQAPQTRVSASRADRPRAWRLLGASRRGWFCPSLCPSEEPG
                     TSGTPEPLGPASRRPPGLRSPLSPVKPKECLRGATLGAQAPESRGQGHLRVPPRVPGQ
                     PEGPRQPGRPQRPVPRPFPGLQSPGCPPEGTLGVPSPPLQARASPSRRGASLGPQVQP
                     HRDPSGPDPPTGPSLCPPAPLQPSLHPRPQLLASPGPPGQPEGPRQPGRVAFPLPWPL
                     LPASHPSPLSLPPHRVHQAGRRDPGGPVSVPPAAAQSLPPGKGASFSPPSLRPSLLCT
                     VCKVQPPTPVHGSRAQPRPPLPTVDRPSVHPGHPRPPVSTPVPSRGDFM"
     misc_feature    <34063..35181
                     /gene="BWRF1"
                     /locus_tag="HHV4_BWRF1.8"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     STS             35887..37347
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /standard_name="ODOSTSI"
                     /db_xref="UniSTS:55605"
     CDS             36216..37679
                     /gene="EBNA-2"
                     /locus_tag="HHV4_EBNA-2"
                     /note="role in latency"
                     /codon_start=1
                     /product="nuclear antigen EBNA-2"
                     /protein_id="YP_401644.1"
                     /db_xref="UniProtKB/TrEMBL:Q777H1"
                     /db_xref="GeneID:3783761"
                     /translation="MPTFYLALHGGQTYHLIVDTDSLGNPSLSVIPSNPYQEQLSDTP
                     LIPLTIFVGENTGVPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPPQR
                     RDAWTQEPSPLDRDPLGYDVGHGPLASAMRMLWMANYIVRQSRGDRGLILPQGPQTAP
                     QARLVQPHVPPLRPTAPTILSPLSQPRLTPPQPLMMPPRPTPPTPLPPATLTVPPRPT
                     RPTTLPPTPLLTVLQRPTELQPTPSPPRMHLPVLHVPDQSMHPLTHQSTPNDPDSPEP
                     RSPTVFYNIPPMPLPPSQLPPPAAPAQPPPGVINDQQLHHLPSGPPWWPPICDPPQPS
                     KTQGQSRGQSRGRGRGRGRGRGKGKSRDKQRKPGGPWRPEPNTSSPSMPELSPVLGLH
                     QGQGAGDSPTPGPSNAAPVCRNSHTATPNVSPIHEPESHNSPEAPILFPDDWYPPSID
                     PADLDESWDYIFETTESPSSDEDYVEGPSKRPRPSIQ"
     repeat_region   36390..36512
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /rpt_unit_range=36390..36398
     repeat_region   37237..37290
                     /gene="EBNA-LP"
                     /locus_tag="HHV4_EBNA-LP"
                     /rpt_unit_range=37237..37242
     regulatory      37715..37720
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="EBNA-2 and EBNA-LP"
     gene            complement(38014..40529)
                     /gene="BHLF1"
                     /locus_tag="HHV4_BHLF1"
                     /db_xref="GeneID:3783705"
     regulatory      complement(38024..38029)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BHLF1"
                     /locus_tag="HHV4_BHLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             complement(38287..40269)
                     /gene="BHLF1"
                     /locus_tag="HHV4_BHLF1"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BHLF1"
                     /protein_id="YP_401645.1"
                     /db_xref="UniProtKB/TrEMBL:Q777A3"
                     /db_xref="GeneID:3783705"
                     /translation="MGTPCQSARGPRTTPLPHCPPPCLPGAPDQQTRRLPPGWGQRTA
                     PTQVGLADAASPDELQDQASGARPGGGNRVGAGRGRPGTPAPSRQSRRTGPAEQADHA
                     HSNPTGGCSDPQRSPRTRQAGYALGEGSAGLGSRGPRPHPAFQVQWSARNPGCPRTWR
                     RRSGAQRGHPPPGAGQRPSGPTGGRPAAPGAPGTPAAPGPGGGAAVPSGATPHPERGS
                     GPADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRRPPGCPRSAR
                     NPGCPRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAAPGAPGTPAAPGPGGGAAVPSG
                     ATPHPERGSGPADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPTRSGAAAQRTHRR
                     PPGCPRSARNPGCPRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAAPGAPGTPAAPGP
                     GGGAAVPSGATPHPERGSGPADPPAAARLPPERQEPRLPQDLAAAQRCPAGPPPTRSG
                     AAAQRTHRRPPGCPRSARNPGCPRTWRRRSGAQRGHPPPGAGQRPSGPTGGRPAAPGA
                     PGTPAAPGPGGGAAVPSGATPHPERGSGPADPPAAARLPPERQEPRLPQDLAAAQRCP
                     AGPPPTRSGAAAQRTHRRPPGCPRSARNPGCPRTWR"
     misc_feature    complement(38503..>39777)
                     /gene="BHLF1"
                     /locus_tag="HHV4_BHLF1"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     repeat_region   38290..39827
                     /gene="EBNA-3A"
                     /locus_tag="HHV4_EBNA-3A"
                     /rpt_family="IR2; NotI"
                     /rpt_type=direct
                     /rpt_unit_range=38290..38414
     rep_origin      40301..41293
                     /note="region containing oriLyt, core lytic cycle origin
                     of DNA replication"
     repeat_region   40366..41409
                     /note="DRleft, similar to 143272..144328"
                     /rpt_family="DR"
                     /rpt_type=direct
     regulatory      complement(40524..40529)
                     /regulatory_class="TATA_box"
                     /gene="BHLF1"
                     /locus_tag="HHV4_BHLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            41471..43251
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /note="Bcl-2 family; can also be expressed from Cp or Wp
                     type of spliced RNA"
                     /db_xref="GeneID:3783706"
     regulatory      41471..41476
                     /regulatory_class="TATA_box"
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     ncRNA           41474..41495
                     /ncRNA_class="miRNA"
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /product="ebv-miR-BHRF1-1"
                     /db_xref="GeneID:3783706"
     intron          41629..42046
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /note="spliced in some BHRF1 transcripts; acceptor site is
                     utilised by latent transcripts"
     CDS             42088..42663
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /note="role in apoptosis"
                     /codon_start=1
                     /product="apoptosis regulator BHRF1"
                     /protein_id="YP_401646.1"
                     /db_xref="UniProtKB/TrEMBL:Q777H0"
                     /db_xref="GeneID:3783706"
                     /translation="MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPED
                     TVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRAL
                     AWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
                     SRRFSWTLFLAGLTLSLLVICSYLFISRGRH"
     misc_feature    42247..42537
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /note="Apoptosis regulator proteins, Bcl-2 family; Region:
                     Bcl-2; pfam00452"
                     /db_xref="CDD:395362"
     misc_feature    order(42253..42258,42268..42270,42277..42282,42328..42333,
                     42340..42345,42352..42357,42376..42378,42382..42387,
                     42391..42396,42406..42408,42418..42420)
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /note="BH3-homology region binding site [active]"
                     /db_xref="CDD:132900"
     misc_feature    order(42352..42360,42373..42411)
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /note="BH1 [active]"
                     /db_xref="CDD:132900"
     misc_feature    42511..42552
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /note="BH2 [active]"
                     /db_xref="CDD:132900"
     ncRNA           42853..42874
                     /ncRNA_class="miRNA"
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /product="ebv-miR-BHRF1-2*"
                     /db_xref="GeneID:3783706"
     ncRNA           42888..42909
                     /ncRNA_class="miRNA"
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /product="ebv-miR-BHRF1-2"
                     /db_xref="GeneID:3783706"
     ncRNA           42968..42989
                     /ncRNA_class="miRNA"
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /product="ebv-miR-BHRF1-3"
                     /db_xref="GeneID:3783706"
     regulatory      43230..43235
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BHRF1"
                     /locus_tag="HHV4_BHRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            complement(43691..46280)
                     /gene="BFLF1"
                     /locus_tag="HHV4_BFLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783697"
     gene            complement(43691..44793)
                     /gene="BFLF2"
                     /locus_tag="HHV4_BFLF2"
                     /note="core gene"
                     /db_xref="GeneID:3783698"
     CDS             complement(43691..44647)
                     /gene="BFLF2"
                     /locus_tag="HHV4_BFLF2"
                     /note="interacts with nuclear egress type 2 membrane
                     protein; role in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress lamina protein"
                     /protein_id="YP_401647.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G9"
                     /db_xref="GeneID:3783698"
                     /translation="MAPVTPDAVNARQQRPADPALRRLMHPHHRNYTASKASAHSVKS
                     VSRCGKSRSELGRMERVGSVARSICSRHTRHGVDRSHFSLRDFFRGISANFELGKDFL
                     REMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFGHSLTLGSHCEICINRSQVHVPQEF
                     SSTQLSFFNNVHKIIPNKTFYVSLLSSSPSAVKAGLSQPSLLYAYLVTGHFCGTICPI
                     FSTNGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYELAVDLVGDAFCIKVSPRDT
                     VYEKAVNVDEDAIYEAIKDLECGDELRLQIINYTQLILENKQ"
     misc_feature    complement(43709..44470)
                     /gene="BFLF2"
                     /locus_tag="HHV4_BFLF2"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     cl27388"
                     /db_xref="CDD:421492"
     regulatory      complement(43697..43702)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BFLF1 and BFLF2"
     CDS             complement(44660..46237)
                     /gene="BFLF1"
                     /locus_tag="HHV4_BFLF1"
                     /note="role in DNA encapsidation; role possibly in capsid
                     transport"
                     /codon_start=1
                     /product="DNA packaging protein UL32"
                     /protein_id="YP_401648.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G8"
                     /db_xref="GeneID:3783697"
                     /translation="MAHKVTSANEPNPLTGKRLSSCPLTRSGVTEVAQIAGRTPKMED
                     FVPWTVDNLKSQFEAVGLLMAHSYLPANAEEGIAYPPLVHTYESLSPASTCRVCDLLD
                     TLVNHSDAPVAFFEDYALLCYYCLNAPRAWISSLITGMDFLHILIKYFPMAGGLDSLF
                     MPSRILAIDIQLHFYICRCFLPVSSSDMIRNANLGYYKLEFLKSILTGQSPANFCFKS
                     MWPRTTPTFLTLPGPRTCKDSQDVPGDVGRGLYTALCCHLPTRNRVQHPFLRAEKGGL
                     SPEITTKADYCGLLLGTWQGTDLLGGPGHHAIGLNAEYSGDELAELALAITRPEAGDH
                     SQGPCLLAPMFGLRHKNASRTICPLCESLGAHPDAKDTLDRFKSLILDSFGNNIKILD
                     RIVFLIKTQNTLLDVPCPRLRAWLQMCTPQDFHKHLFCDPLCAINHSITNPSVLFGQI
                     YPPSFQAFKAALAAGQNLEQGVCDSLITLVYIFKSTQVARVGKTILVDVTKELDVVLR
                     IHGLDLVQSYQTSQVYV"
     misc_feature    complement(44663..45955)
                     /gene="BFLF1"
                     /locus_tag="HHV4_BFLF1"
                     /note="Herpesvirus putative major envelope glycoprotein;
                     Region: Herpes_env; cl28122"
                     /db_xref="CDD:332943"
     regulatory      complement(44788..44793)
                     /regulatory_class="TATA_box"
                     /gene="BFLF2"
                     /locus_tag="HHV4_BFLF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            46236..49786
                     /gene="BFRF1A"
                     /locus_tag="HHV4_BFRF1A"
                     /note="core gene"
                     /db_xref="GeneID:3783759"
     CDS             46236..46643
                     /gene="BFRF1A"
                     /locus_tag="HHV4_BFRF1A"
                     /note="interacts with DNA packaging terminase subunit 2;
                     role in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging protein UL33"
                     /protein_id="YP_401728.1"
                     /db_xref="GeneID:3783759"
                     /translation="MTHLGGKVRSSGFLIPGSAPVSGTPPQGQGGLASSRVYEDSGGS
                     LLSFSPMIHPNLAPLIAPSAYARLNLLNHCIFLEAFKEENSGQGLGGVQREVLFLKRD
                     IIKQVIARIVAADSTLDLVNHGEPGREAPRRAQ"
     misc_feature    46371..46592
                     /gene="BFRF1A"
                     /locus_tag="HHV4_BFRF1A"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     regulatory      complement(46275..46280)
                     /regulatory_class="TATA_box"
                     /gene="BFLF1"
                     /locus_tag="HHV4_BFLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            46544..49786
                     /gene="BFRF1"
                     /locus_tag="HHV4_BFRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783699"
     regulatory      46544..46549
                     /regulatory_class="TATA_box"
                     /gene="BFRF1"
                     /locus_tag="HHV4_BFRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             46603..47613
                     /gene="BFRF1"
                     /locus_tag="HHV4_BFRF1"
                     /note="interacts with nuclear egress lamina protein; role
                     in nuclear egress"
                     /codon_start=1
                     /product="nuclear egress membrane protein"
                     /protein_id="YP_401649.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G7"
                     /db_xref="GeneID:3783699"
                     /translation="MASPEERLLDELNNVIVSFLCDSGSLEVERCSGAHVFSRGSSQP
                     LCTVKLRHGQIYHLEFVYKFLAFKLKNCNYPSSPVFVISNNGLATTLRCFLHEPSGLR
                     SGQSGPCLGLSTDVDLPKNSIIMLGQDDFIKFKSPLVFPAELDLLKSMVVCRAYITEH
                     RTTMQFLVFQAANAQKASRVMDMISDMSQQLSRSGQVEDTGARVTGGGGPRPGVTHSG
                     CLGDSHVRGRGGWDLDNFSEAETEDEASYAPWRDKDSWSESEAAPWKKELVRHPIRRH
                     RTRETRRMRGSHSRVEHVPPETRETVVGGAWRYSWRATPYLARVLAVTAVALLLMFLR
                     WT"
     misc_feature    46618..47190
                     /gene="BFRF1"
                     /locus_tag="HHV4_BFRF1"
                     /note="Herpesvirus virion protein U34; Region: Herpes_U34;
                     cl29790"
                     /db_xref="CDD:421915"
     gene            47520..49786
                     /gene="BFRF2"
                     /locus_tag="HHV4_BFRF2"
                     /note="betagamma gene"
                     /db_xref="GeneID:3783700"
     CDS             47520..49295
                     /gene="BFRF2"
                     /locus_tag="HHV4_BFRF2"
                     /codon_start=1
                     /product="protein UL49"
                     /protein_id="YP_401650.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G6"
                     /db_xref="GeneID:3783700"
                     /translation="MALFLARHTLSGTGAGCHGRGPAPDVSEVDLTLQALGERGFSRL
                     LDLGLACLDLSYVEMREFVVWGRPPASEAAVASTPGSLFRSHSSAYWLSEVERPGGLV
                     RWARSQTSPSSLTLAPHLGPSLLSLSVVTGGGCGAVAFCNAFFLAYFLVVRSVFPAFS
                     DRIAAWICDRSPFCENTRAVARGYRGLVKRFLAFVFERSSYDPPLLRQNSRPVERCFA
                     IKNYVPGLDSQSCVTVPSFSRWAQSHASELDPREIRDRVTPATAPSFVADHASALLAS
                     LQKKASDTPCGNPIQWMWYRLLVNSCLRSAHCLLPIPAVSEGGRKTGGGVGEELVGAG
                     GPCLSRDVFVAIVSRNVLSCLLNVPAAGPRAYKCFRSHASRPVSGPDYPPLAVFCMDC
                     GYCLNFGKQTGVGGRLNSFRPTLQFYPRDQKEKHVLTCHASGRVYCSNCGSAAVGCQR
                     LAEPPSARSGWRPRIRAVLPHNAAYELDRGSRLLDAIIPCLGPDRTCMRPVVLRGVTV
                     RQLLYLTLRTEARAVCSICQQRQAPEDARDEPHLFSSCLEVELPPGERCAGCRLYQTR
                     YGTPAAQAHPPGEAGGGFSRQSPAS"
     misc_feature    48324..49103
                     /gene="BFRF2"
                     /locus_tag="HHV4_BFRF2"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     regulatory      49056..49061
                     /regulatory_class="TATA_box"
                     /gene="BFRF3"
                     /locus_tag="HHV4_BFRF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            49219..49786
                     /gene="BFRF3"
                     /locus_tag="HHV4_BFRF3"
                     /note="core gene"
                     /db_xref="GeneID:3783701"
     CDS             49219..49749
                     /gene="BFRF3"
                     /locus_tag="HHV4_BFRF3"
                     /note="located externally on capsid hexons; role in capsid
                     morphogenesis; role possibly in capsid transport"
                     /codon_start=1
                     /product="small capsid protein"
                     /protein_id="YP_401651.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G5"
                     /db_xref="GeneID:3783701"
                     /translation="MARRLPKPTLQGRLEADFPDSPLLPKFQELNQNNLPNDVFREAQ
                     RSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQA
                     QAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGG
                     GGQPHDTAPRGARKKQ"
     misc_feature    49219..>49602
                     /gene="BFRF3"
                     /locus_tag="HHV4_BFRF3"
                     /note="Gammaherpesvirus capsid protein; Region:
                     Herpes_capsid; pfam06112"
                     /db_xref="CDD:399248"
     gene            complement(49775..63034)
                     /gene="BOLF1"
                     /locus_tag="HHV4_BOLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783723"
     gene            complement(49775..59904)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783726"
     regulatory      complement(49775..49780)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="BOLF1 and BPLF1"
     regulatory      49781..49786
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="for BFRF1A, BFRF1, BFRF2 and BFRF3"
     CDS             complement(49790..59239)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="complexed with tegument protein UL37;
                     ubiquitin-specific protease (N-terminal region); role in
                     capsid transport"
                     /codon_start=1
                     /product="large tegument protein"
                     /protein_id="YP_401652.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G4"
                     /db_xref="GeneID:3783726"
                     /translation="MSNGDWGQSQRTRGTGPVRGIRTMDVNAPGGGSGGSALRILGTA
                     SCNQAHCKFGRFAGIQCVSNCVLYLVKSFLAGRPLTSRPELDEVLDEGARLDALMRQS
                     GILKGHEMAQLTDVPSSVVLRGGGRVHIYRSAEIFGLVLFPAQIANSAVVQSLAEVLH
                     GSYNGVAQFILYICDIYAGAIIIETDGSFYLFDPHCQKDAAPGTPAHVRVSTYAHDIL
                     QYVGAPGAQYTCVHLYFLPEAFETEDPRIFMLEHYGVYDFYEANGSGFDLVGPELVSS
                     DGEAAGTPGADSSPPVMLPFERRIIPYNLRPLPSRSFTSDSFPAARYSPAKTNSPPSS
                     PASAAPASAAPASAAPASAAPASAAPASAAPASAAPASAAPASSPPLFIPIPGLGHTP
                     GVPAPSTPPRASSGAAPQTPKRKKGLGKDSPHKKPTSGRRLPLSSTTDTEDDQLPRTH
                     VPPHRPPSAARLPPPVIPIPHQSPPASPTPHPAPVSTIAPSVTPSPRLPLQIPIPLPQ
                     AAPSNPKIPLTTPSPSPTAAAAPTTTTLSPPPTQQQPPQSAAPAPSPLLPQQQPTPSA
                     APAPSPLLPQQQPPPSAARAPSPLPPQQQPLPSATPAPPPAQQLPPSATTLEPEKNHP
                     PAADRAGTEISPSPPFGQQPSFGDDASGGSGLVRYLSDLEEPFLSMSDSEEAESDLAS
                     DIPTTEDEDMFEDEVFSNSLESGSSAPTSPITLDTARSQYYQTTFDIETPEMDFVPLE
                     SNIARIAGHTYQEQAIVYDPASNREVPEADALSMIDYLLVTVVLEQGLIRSRDRSSVL
                     NLLEFLKDWSGHLQVPTLDLEQLLTSELNIQNLANMLSENKGRAGEFHKHLAAKLEAC
                     LPSLATKDAVRVDAGAKMLAEIPQLAESDDGKFDLEAARRRLTDLLSGGDQEAGEGGG
                     EPEDNSIYRGPHVDVPLVLDDESWKRLLSLAEAARTAVARQQAGVDEEDVRFLALLTA
                     IEYGAPPAASVPPFVHNVAVRSKNAALHVRRCTADIRDKVASAASDYLSYLEDPSLPT
                     VMDFDDLLTHLRHTCQIIASLPLLNIRYTSIEWDYRELLYLGTALSDMSGIPWPLERV
                     EEDDPSIAPLPEFETVAKKQKELETTRENEKRLRTILDDIEAMLGLAGVASAPGAPIS
                     PASPSATPANHDNPEATPPLADTAALTIPVIEKYIANAGSIVGAAKNPTYIRLRDTIQ
                     QIVRSKKYLMNILKSITFYTIDNYIASFEESIDHLYRDLPVLDPEVQDGIDRILDPMV
                     SEALHTFEMGNRLTLEPARLVALQNFATHSTLKETAAAVNLLPGLLAVYDATITGQAP
                     EDALRLLSGLQNQLSQTLIPGKLKKRFLSYLQKLKNNNNDQLRQKEVQAWRLEAEGFK
                     PATEEQLEAFLDTAPNKELKRQYEKKLRQLMETGRKEKEKLREQEDKERQERRAREAN
                     EAWARIRKALGARPEPAPTSPDDWNTLLASLLPDNTDSAAAAAAAVARNTDILDSLTQ
                     ILAAMLLGITRVRRERLRSLLVDDGGAAERMEAAEPGWFTDIETGPLARLDAWPATPA
                     ATAKEGGGGRGAEEAAGALFRARTAADAIRSALAQTRQALQSPDMKSAVVNTDLEAPY
                     AEYERGLAGLLEKRRAAEAALTAIVSEYVDRTLPEATNDPGQANLPPPPTIPQATAPP
                     RLASDSALWPKKPQLLTRRERDDLLQATGDFFSELLTEAEAAEVRALEEQVRESQTLM
                     AKAHEMAASTRRGFHTALEAVLSRSRDEAPDDELRSLLPSPPKAPVQAPLEAALARAA
                     AGNGSWPYRKSLAAAKWIRGICEAVRGLSEGALALAGGAGAWLNLAAAADGEIHELTR
                     LLEVEGMAQNSMDGMEELRLALATLDPKRVAGGKETVADWKRRLSRLEAIIQEAQEES
                     QLQGTLQDLVTQARGHTDPRQLKIVVEAARGLALGASAGSQYALLKDKLLRYASAKQS
                     FLAFYETAQPTVFVKHPLTNNLPLLITISAPPTGWGNGAPTRRAQFLAAAGPAKYAGT
                     LWLETESPCDPLNPAYVSADTQEPLNYIPVYHNFLEYVMPTVLENPEAFSLTPAGRPQ
                     AIGPPQDDQERRRRTLASVASARLSAAAADSYWDTWPDVESNAGELLREYVSAPKALM
                     EDLADNPIVAMTLLAHASLIASRNHPPYPAPATDREVILLEQREMMALLVGTHPAYAA
                     AFLGAPSFYAGLGLVSALARDGGLGDLLSDSVLTYRLVRSPASGRGGMPSTTRGSNDG
                     EDARRLTRHRIAGPPTGFIFFQDAWEEMDTRAALWPHPEFLGLVHNQSTARARACMLL
                     LARRCFAPEALQQLWHSLRPLEGPVAFQDYLRDFVKQAYTRGEELPRAEGLEVPRETP
                     SSYGTVTGRALRNLMPYGTPITGPKRGSGDTIPVSVFEAAVAAAFLGRPLTLFVSSQY
                     LFNLKTLGQVRVVAPLLYCDGHSEPFRSLVETISLNFLQDLDGYSESFEPEMSIFARQ
                     AVWLRELLTEARAAKPKEARPPTVAILANRKNIIWKCFTYRHNLPDVQFYFNAAGASR
                     WPTDVLNPSFYEHEDPPLPVGYQLPPNPRNVQELFSGFPPRVGHGLVSGDGFQSADNT
                     PASSDRLQQLGGGETDQGEKGSTTAESEASGPPSPQSPLLEKVAPGRPRDWLSPTSSP
                     RDVTVTPGLAAPITLPGPRLMARPYFGAETRASESPDRSPGSSPRPWPKDSLELLPQP
                     APQQPPSSPWASEQGPIVYTLSPHSTPSTASGSQKKHTIQIPGLVPSQKPSYPPSAPY
                     KPGQSTGGIAPTPSAASLTTFGLQPQDTQASSQDPPYGHSIMQREKKQQGGREEAAEI
                     RPSATRLPTAVGLRPRAPVVAAGAAASATPAFDPGEAPSGFPIPQAPALGSGLAAPAH
                     TPVGALAPRPQKTQAQRPQDAAALPTPTIKAVGARPVPKATGALAAGARPRGQPTAAP
                     PSAASPPRVSLPVRSRQQQSPAIPLPPMHSGSEPGARPEVRLSQYRHAGPQTYTVRKE
                     APPSAASQLPKMPKCKDSMYYPPSGSARYPAPFQALSFSQSVASPAPSSDQTTLLWNT
                     PSVVTQFLSIEDIIREVVTGGSTSGDLVVPSGSPSSLSTAAPEQDLRYSLTLSQASRV
                     LSRFVSQLRRKLERSTHRLIADLERLKFLYL"
     misc_feature    complement(58577..59107)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:398488"
     misc_feature    complement(57308..>58084)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    complement(<54863..55648)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="Septal ring factor EnvC, activator of murein
                     hydrolases AmiA and AmiB [Cell cycle control, cell
                     division, chromosome partitioning]; Region: EnvC; COG4942"
                     /db_xref="CDD:227278"
     misc_feature    complement(54878..>55216)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="Domain of unknown function (DUF4207); Region:
                     DUF4207; pfam13904"
                     /db_xref="CDD:404741"
     misc_feature    complement(50378..>51391)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    complement(<50084..>50662)
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /note="DNA polymerase III subunit gamma/tau; Region:
                     PRK07003"
                     /db_xref="CDD:235906"
     exon            49943..50170
                     /note="Fp first exon of splice RNAs induced in lytic
                     cycle, some spliced to EBNA-1"
     gene            50134..97654
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /note="latency I"
                     /db_xref="GeneID:3783774"
     mRNA            join(50134..50170,55190..55361,95654..97654)
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /product="EBNA-1, QUK transcript"
                     /note="starts from the Q promoter (Qp) in latency I"
                     /db_xref="GeneID:3783774"
     protein_bind    50142..50189
                     /note="site III"
                     /bound_moiety="EBNA-1"
     repeat_region   57396..57642
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=57396..57446
     repeat_region   58099..58233
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=58099..58113
     CDS             complement(59232..62951)
                     /gene="BOLF1"
                     /locus_tag="HHV4_BOLF1"
                     /note="complexed with large tegument protein; role in
                     virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL37"
                     /protein_id="YP_401653.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G3"
                     /db_xref="GeneID:3783723"
                     /translation="MASAMESDSSGGSGGADAQPPLAEVDGGLARVTRQLLLSGDDPA
                     ARLRALMPLELGIFGLGDLAQPVLVRDFLNTLTLMSGHAYPAAVLRHHAYYLLRAASF
                     SRRSFGLGHLEAALDVLASSLPPTTASPATDDPLDGSRLIAETRALAAAYRRIIEEGS
                     GEVLAVSGPTATFAFVEELVADTYLARWDAFPREGLSFYAFNAAKTTLGRWLVTVYAE
                     TNRYPWAAAGQGQPTAADIKAMAVELVEHSGGGAGGGEGEESGGGLFHRPESLSSVVA
                     SLPLARRRAVEILGVYAEASGGQTPPVAAVPVLAFDAARLRLLEPSGALFYDYVYEAL
                     LWDQTYGVPDSVIEAFLAGMAAEMEALAARVQEAAGSRASFSPAAIEQVATVLLSAGL
                     NETVAGDYAMMLASVPRVSRSRWRWLEATAALLESLSGFALHFFRLLPTASPTSRFAR
                     VARAAYLRAEAEAVDRRARRTSGPSTPAAAPAATAVGVGAAADPWDAVTPLRIFIVPP
                     PAAEYEQVAGDLSSELLRSLLWVRYSRLWQAPAPAPALPCKPPLLPGEQGRRQWTAAV
                     AAAPRTDVEAYCRSLRAGQTARADPAYVHSPFFPAAFIEFQIWPALRRVLSNELPKTR
                     SLAALRWLVSFGSDLALPSPELTRARRPLELIYATVWEIYDGAPPMPGESPQAVGLRP
                     LNLEGEGKAGDAGAEGAEDEEGGGPWGLSSHDAVLRIMDAVREVSGIISETISASERA
                     AEAPPLAWPTSLFSLLFTLRYSTTAESLGLATRRFLVSGETLSEDISRLTGAAWRLCS
                     RPLLYDAETGRVQIPLATEEEEEAVVAVKEKSVSSSPRHYSTDLQTLKSVVEGIQDVC
                     RDAAARWALATADTATLRRRLLVPALRESRGIADHPLWAHTSEPLRPDLEELNERVEH
                     ALELGYSLTGALRRSVAYRFRDYTFARLFQPPAIDAERAEAIVRRDARPPPVFIPAPR
                     RLPQGGADTPPPLSMDDILYLGKSICKALVDVLDHHPAAPETTPIKTYTPAMDLNPEQ
                     ITVTPRSPSVLAAFARTARVQTHHLVPALTDDSPSPVGQTPPPFRILPAKKLAAILLG
                     NGRNASKRRASRDLSPPPHGRWRAVLDSSPFSFSSSDFSDQDEGEGGEADLRGVPGGG
                     GEGAYEEDRERPSDIDTAARAQKVETSCPRRRSPRTTPSPSRRASGGGGPDRGEAEAH
                     TYPPYLSAAAAASRVRPRTRRGATRRPPRPTAEDE"
     misc_feature    complement(59856..62867)
                     /gene="BOLF1"
                     /locus_tag="HHV4_BOLF1"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     regulatory      complement(59899..59904)
                     /regulatory_class="TATA_box"
                     /gene="BPLF1"
                     /locus_tag="HHV4_BPLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            62729..66600
                     /gene="BORF1"
                     /locus_tag="HHV4_BORF1"
                     /note="core gene"
                     /db_xref="GeneID:3783724"
     regulatory      62729..62734
                     /regulatory_class="TATA_box"
                     /gene="BORF1"
                     /locus_tag="HHV4_BORF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             62950..64044
                     /gene="BORF1"
                     /locus_tag="HHV4_BORF1"
                     /note="complexed 1:2 with capsid triplex subunit 2 to
                     connect capsid hexons and pentons; role in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 1"
                     /protein_id="YP_401654.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G2"
                     /db_xref="GeneID:3783724"
                     /translation="MKVQGSVDRRRLQRRIAGLLPPPARRLNISRGSEFTRDVRGLVE
                     EHAQASSLSAAAVWRAGLLAPGEVAVAGGGSGGGSFSWSGWRPPVFGDFLIHASSFNN
                     AEATGTPLFQFKQSDPFSGVDAVFTPLSLFILMNHGRGVAARVEAGGGLTRMANLLYD
                     SPATLADLVPDFGRLVADRRFHNFITPVGPLVENIKSTYLNKITTVVHGPVVSKAIPR
                     STVKVTVPQEAFVDLDAWLSGGAGGGGGVCFVGGLGLQPCPADARLYVALTYEEAGPR
                     FTFFQSSRGHCQIMNILRIYYSPSIMHRYAVVQPLHIEELTFGAVACLGTFSATDGWR
                     RSAFNYRGSSLPVVEIDSFYSNVSDWEVIL"
     misc_feature    62950..64041
                     /gene="BORF1"
                     /locus_tag="HHV4_BORF1"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03263"
                     /db_xref="CDD:223028"
     regulatory      complement(63029..63034)
                     /regulatory_class="TATA_box"
                     /gene="BOLF1"
                     /locus_tag="HHV4_BOLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            63881..66600
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /note="core gene"
                     /db_xref="GeneID:3783725"
     regulatory      63881..63886
                     /regulatory_class="TATA_box"
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             64119..66599
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /EC_number="1.17.4.1"
                     /note="role in nucleotide metabolism"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 1"
                     /protein_id="YP_401655.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G1"
                     /db_xref="GeneID:3783725"
                     /translation="MATTSHVEHELLSKLIDELKVKANSDPEADVLAGRLLHRLKAES
                     VTHTVAEYLEVFSDKFYDEEFFQMHRDELETRVSAFAQSPAYERIVSSGYLSALRYYD
                     TYLYVGRSGKQESVQHFYMRLAGFCASTTCLYAGLRAALQRARPEIESDMEVFDYYFE
                     HLTSQTVCCSTPFMRFAGVENSTLASCILTTPDLSSEWDVTQALYRHLGRYLFQRAGV
                     GVGVTGAGQDGKHISLLMRMINSHVEYHNYGCKRPVSVAAYMEPWHSQIFKFLETKLP
                     ENHERCPGIFTGLFVPELFFKLFRDTPWSDWYLFDPKDAGDLERLYGEEFEREYYRLV
                     TAGKFCGRVSIKSLMFSIVNCAVKAGSPFILLKEACNAHFWRDLQGEAMNAANLCAEV
                     LQPSRKSVATCNLANICLPRCLVNAPLAVRAQRADTQGDELLLALPRLSVTLPGEGAV
                     GDGFSLARLRDATQCATFVVACSILQGSPTYDSRDMASMGLGVQGLADVFADLGWQYT
                     DPPSRSLNKEIFEHMYFTALCTSSLIGLHTRKIFPGFKQSKYAGGWFHWHDWAGTDLS
                     IPREIWSRLSERIVRDGLFNSQFIALMPTSGCAQVTGCSDAFYPFYANASTKVTNKEE
                     ALRPNRSFWRHVRLDDREALNLVGGRVSCLPEALRQRYLRFQTAFDYNQEDLIQMSRD
                     RAPFVDQSQSHSLFLREEDAARASTLANLLVRSYELGLKTIMYYCRIEKAADLGVMEC
                     KASAALSVPREEQNERSPAEQMPPRPMEPAQVAGPVDIMSKGPGEGPGGWCVPGGLEV
                     CYKYRQLFSEDDLLETDGFTERACESCQ"
     misc_feature    64449..66308
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl38938"
                     /db_xref="CDD:422965"
     misc_feature    order(64629..64634,64674..64679,65277..65279,65283..65285,
                     65289..65291,65331..65333,65895..65912)
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /note="active site"
                     /db_xref="CDD:153083"
     misc_feature    order(64677..64679,65277..65279,65283..65285,65289..65291,
                     65325..65327,66291..66296)
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:153083"
     misc_feature    order(64995..64997,65004..65009,65145..65147,65151..65156,
                     65166..65168,65187..65189,66228..66236,66240..66245,
                     66255..66260,66264..66269)
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /note="R2 peptide binding site [active]"
                     /db_xref="CDD:153083"
     gene            66516..69916
                     /gene="BaRF1"
                     /locus_tag="HHV4_BaRF1.1"
                     /note="core gene"
                     /db_xref="GeneID:3783683"
     regulatory      66516..66521
                     /regulatory_class="TATA_box"
                     /gene="BORF2"
                     /locus_tag="HHV4_BORF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      66595..66600
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BORF1 and BORF2"
     CDS             66612..67520
                     /gene="BaRF1"
                     /locus_tag="HHV4_BaRF1.1"
                     /EC_number="1.17.4.1"
                     /note="role in nucleotide metabolism"
                     /codon_start=1
                     /product="ribonucleotide reductase subunit 2"
                     /protein_id="YP_401656.1"
                     /db_xref="UniProtKB/TrEMBL:Q777G0"
                     /db_xref="GeneID:3783683"
                     /translation="MSKLLYVRDHEGFACLTVETHRNRWFAAHIVLTKDCGCLKLLNE
                     RDLEFYKFLFTFLAMAEKLVNFNIDELVTSFESHDIDHYYTEQKAMENVHGETYANIL
                     NMLFDGDRAAMNAYAEAIMADEALQAKISWLRDKVAAAVTLPEKILVFLLIEGIFFIS
                     SFYSIALLRVRGLMPGICLANNYISRDELLHTRAASLLYNSMTAKADRPRATWIQELF
                     RTAVEVETAFIEARGEGVTLVDVRAIKQFLEATADRILGDIGQAPLYGTPPPKDCPLT
                     YMTSIKQTNFFEQESSDYTMLVVDDL"
     misc_feature    66678..67415
                     /gene="BaRF1"
                     /locus_tag="HHV4_BaRF1.1"
                     /note="Ribonucleotide reductase, small chain; Region:
                     Ribonuc_red_sm; pfam00268"
                     /db_xref="CDD:395206"
     misc_feature    order(66792..66794,66882..66884,66891..66893,67071..67073,
                     67173..67175,67182..67184)
                     /gene="BaRF1"
                     /locus_tag="HHV4_BaRF1.1"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153108"
     gene            67552..69916
                     /gene="BMRF1"
                     /locus_tag="HHV4_BMRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783718"
     regulatory      67552..67557
                     /regulatory_class="TATA_box"
                     /gene="BMRF1"
                     /locus_tag="HHV4_BMRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             67611..68825
                     /gene="BMRF1"
                     /locus_tag="HHV4_BMRF1"
                     /note="dsDNA-binding protein; role in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase processivity subunit"
                     /protein_id="YP_401657.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F9"
                     /db_xref="GeneID:3783718"
                     /translation="METTQTLRFKTKALAVLSKCYDHAQTHLKGGVLQVNLLSVNYGG
                     PRLAAVANAGTAGLISFEVSPDAVAEWQNHQSPEEAPAAVSFRNLAYGRTCVLGKELF
                     GSAVEQASLQFYKRPQGGSRPEFVKLTMEYDDKVSKSHHTCALMPYMPPASDRLRNEQ
                     MIGQVLLMPKTASSLQKWARQQGSGGVKVTLNPDLYVTTYTSGEACLTLDYKPLSVGP
                     YEAFTGPVAKAQDVGAVEAHVVCSVAADSLAAALSLCRIPAVSVPILRFYRSGIIAVV
                     AGLLTSAGDLPLDLSVILFNHASEEAAASTASEPEDKSPRVQPLGTGLQQRPRHTVSP
                     SPSPPPPPRTPTWESPARPETPSPAIPSHSSNTALERPLAVQLARKRTSSEARQKQKH
                     PKKVKQAFNPLI"
     misc_feature    67620..68822
                     /gene="BMRF1"
                     /locus_tag="HHV4_BMRF1"
                     /note="Herpes DNA replication accessory factor; Region:
                     Herpes_DNAp_acc; pfam04929"
                     /db_xref="CDD:282746"
     gene            68491..69916
                     /gene="BMRF2"
                     /locus_tag="HHV4_BMRF2"
                     /note="core gene"
                     /db_xref="GeneID:3783719"
     regulatory      68491..68496
                     /regulatory_class="TATA_box"
                     /gene="BMRF2"
                     /locus_tag="HHV4_BMRF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      68544..68549
                     /regulatory_class="TATA_box"
                     /gene="BMRF2"
                     /locus_tag="HHV4_BMRF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             68830..69903
                     /gene="BMRF2"
                     /locus_tag="HHV4_BMRF2"
                     /note="type 3 membrane protein; role possibly in membrane
                     fusion"
                     /codon_start=1
                     /product="envelope protein UL43"
                     /protein_id="YP_401658.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F8"
                     /db_xref="GeneID:3783719"
                     /translation="MFSCKQHLSLGACVFCLGLLASTPFIWCFVFANLLSLEIFSPWQ
                     THVYRLGFPTACLMAVLWTLVPAKHAVRAVTPAIMLNIASALIFFSLRVYSTSTWVSA
                     PCLFLANLPLLCLWPRLAIEIVYICPAIHQRFFELGLLLACTIFALSVVSRALEVSAV
                     FMSPFFIFLALGSGSLAGARRNQIYTSGLERRRSIFCARGDHSVASLKETLHKCPWDL
                     LAISALTVLVVCVMIVLHVHAEVFFGLSRYLPLFLCGAMASGGLYLGHSSIIACVMAT
                     LCTLTSVVVYFLHETLGPLGKTVLFISIFVYYFSGVAALSAAMRYKLKKFVNGPLVHL
                     RVVYMCCFVFTFCEYLLVTFIKS"
     misc_feature    68857..69894
                     /gene="BMRF2"
                     /locus_tag="HHV4_BMRF2"
                     /note="Herpesvirus BMRF2 protein; Region: Herpes_BMRF2;
                     pfam04633"
                     /db_xref="CDD:282486"
     regulatory      69892..69897
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BaRF1, BMRF1 and BMRF2"
     repeat_region   70031..70173
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=70031..70101
     gene            complement(70454..74593)
                     /gene="BSLF1"
                     /locus_tag="HHV4_BSLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783730"
     gene            complement(70454..72068)
                     /gene="BSLF2/BMLF1"
                     /locus_tag="HHV4_BSLF2/BMLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783758"
     regulatory      complement(70454..70459)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="BSLF1 and BSLF2/BMLF1"
     CDS             complement(join(70455..71833,71940..72000))
                     /gene="BSLF2/BMLF1"
                     /locus_tag="HHV4_BSLF2/BMLF1"
                     /note="RNA-binding protein; shuttles between nucleus and
                     cytoplasm; inhibits pre-mRNA splicing; exports virus mRNA
                     from nucleus; exerts most effects post-transcriptionally;
                     role in gene regulation; role in RNA metabolism and
                     transport"
                     /codon_start=1
                     /product="multifunctional expression regulator"
                     /protein_id="YP_401659.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ9"
                     /db_xref="GeneID:3783758"
                     /translation="MVPSQRLSRTSSISSNEDPAESHILELEAVSDTNTDCDLDPMEG
                     SEEHSTDGEISSSEEEDEDPTPAHAIPARPSSVVITPTSASFVIPRKKWDLQDKTVTL
                     HRSPLCRDEDEKEETGNSSYTRGHKRRRGEVHGCTDESYGKRRHLPPGARAPRAPRAP
                     RVPRAPRSPRAPRSNRATRGPRSESRGAGRSTRKQARQERSQRPLPNKPWFDMSLVKP
                     VSKITFVTLPSPLASLTLEPIQDPFLQSMLAVAAHPEIGAWQKVQPRHELRRSYKTLR
                     EFFTKSTNKDTWLDARMQAIQNAGLCTLVAMLEETIFWLQEITYHGDLPLAPAEDILL
                     ACAMSLSKVILTKLKELAPCFLPNTRDYNFVKQLFYITCATARQNKVVETLSSSYVKQ
                     PLCLLAAYAAVAPAYINANCRRRHDEVEFLGHYIKNYNPGTLSSLLTEAVETHTRDCR
                     SASCSRLVRAILSPGTGSLGLFFVPGLNQ"
     misc_feature    complement(70470..71123)
                     /gene="BSLF2/BMLF1"
                     /locus_tag="HHV4_BSLF2/BMLF1"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; pfam05459"
                     /db_xref="CDD:283185"
     repeat_region   71352..71441
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=71352..71360
     CDS             complement(71969..74593)
                     /gene="BSLF1"
                     /locus_tag="HHV4_BSLF1"
                     /note="role in DNA replication"
                     /codon_start=1
                     /product="helicase-primase primase subunit"
                     /protein_id="YP_401662.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F5"
                     /db_xref="GeneID:3783730"
                     /translation="MSAPVVIKALVASNTDIAEAILDAILSRPDEGFRLFCLCHNASP
                     LHHVAGSLVELQLHLPKKRLTSQSRCGLVLTLHLPAEEAFPFLRGLTPLTADRLSTYL
                     DRAGALRSLTPLVELLTLSAKKQPQGDARGRVAWLRPKIVGCLRRIYRVNISARWFIS
                     TFGSHEAQFVLVTAAYYFWGIPCTIETLAHLTELFTSESGQSLAAVTSLAELGEVFGS
                     SAWAEQTEAFAHFAHEKLRRDSREIRAVARTIDAYRGRLPLASADLVRYVYLAHAQCF
                     NEGTFKRYSQLTSMGEIGCLPSGGVVLPSLLDRGFAEHMRTYFTRETYLAEHVRVQQL
                     KIRMEPPAPYTWDPDPDDGLMRAWAGLSVDVARELVELARWHADEGPTYPPTLQGFLC
                     LAGQATCRGQWNPKEQFLPPTVLRRVQRLPVFLCHFADRHYFVMTAADPFSSHLAEVV
                     STPTNCRLPDTCLTRALSYTPVYYSQNSLSEQLFVSRHEYFNPRLPVCNLVLDLDLKI
                     KGAPWSLEEIYDLCRTVRREVLRLMRRLGPVSRAHPVYFFKSACPPADPDNMEDVLPF
                     CICTGKLGFRVITPLPRGHAIVGTSAVQGFVSVLQKLMGLTACLRRMRHKIKEIGAPL
                     FDSGVYHAGRCIRLPHTYKVDRGGGLSRQLRLFVCHPEEEDKHSYVKNALNIQNLLHH
                     SLHVGWPAPKTFCYHIADDGRDYLIQRTRETLPPTVENVCAMIEGHLGLDLVAWVSSC
                     IWPSLMSTLATAVPEDKFPQFLHVTFEQTGPNLVQVCHARGRNFACLRHTHRASSKNV
                     RVFLVLYYTSQAITVTFMSQCFAGRCGANQPTAHFSISVPASRIINRAEASQDSTTSQ
                     LARRRDRQDGSFSETLPN"
     misc_feature    complement(72068..74593)
                     /gene="BSLF1"
                     /locus_tag="HHV4_BSLF1"
                     /note="helicase-primase primase subunit BSLF1;
                     Provisional; Region: PHA03142"
                     /db_xref="CDD:222999"
     regulatory      complement(72063..72068)
                     /regulatory_class="TATA_box"
                     /gene="BSLF2/BMLF1"
                     /locus_tag="HHV4_BSLF2/BMLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            74594..75316
                     /gene="BSRF1"
                     /locus_tag="HHV4_BSRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783731"
     regulatory      74594..74599
                     /regulatory_class="TATA_box"
                     /gene="BSRF1"
                     /locus_tag="HHV4_BSRF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             74636..75292
                     /gene="BSRF1"
                     /locus_tag="HHV4_BSRF1"
                     /function="tegument protein"
                     /note="role in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL51"
                     /protein_id="YP_401663.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F4"
                     /db_xref="GeneID:3783731"
                     /translation="MAFYLPDWSCCGLWLFGRPRNRYSQLPEEPETFECPDRWRAEID
                     LGLPPGVQVGDLLRNEQTMGSLRQVYLLAVQANSITDHLKRFDAVRVPESCRGVVEAQ
                     VAKLEAVRSVIWNTMISLAVSGIEMDENGLKALLDKQAGDSLALMEMEKVATALKMDE
                     TGAWAQEISAVVSSVTAPSASAPFINSAFEPEVPTPVLAPPPVVRQPEHSGPTELALT
                     "
     misc_feature    74636..75244
                     /gene="BSRF1"
                     /locus_tag="HHV4_BSRF1"
                     /note="Herpes virus U44 protein; Region: Herpes_U44;
                     cl28003"
                     /db_xref="CDD:332824"
     regulatory      75311..75316
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BSRF1"
                     /locus_tag="HHV4_BSRF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(75320..76231)
                     /gene="BLLF3"
                     /locus_tag="HHV4_BLLF3"
                     /note="core gene; DURP family"
                     /db_xref="GeneID:3783715"
     regulatory      complement(75320..75325)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BLLF3"
                     /locus_tag="HHV4_BLLF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             complement(75350..76186)
                     /gene="BLLF3"
                     /locus_tag="HHV4_BLLF3"
                     /EC_number="3.6.1.23"
                     /note="role in nucleotide metabolism"
                     /codon_start=1
                     /product="deoxyuridine triphosphatase"
                     /protein_id="YP_401664.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F3"
                     /db_xref="GeneID:3783715"
                     /translation="MEACPHIRYAFQNDKLLLQQASVGRLTLVNKTTILLRPMKTTTV
                     DLGLYARPPEGHGLMLWGSTSRPVTSHVGIIDPGYTGELRLILQNQRRYNSTLRPSEL
                     KIHLAAFRYATPQMEEDKGPINHPQYPGDVGLDVSLPKDLALFPHQTVSVTLTVPPPS
                     IPHHRPTIFGRSGLAMQGILVKPCRWRRGGVDVSLTNFSDQTVFLNKYRRFCQLVYLH
                     KHHLTSFYSPHSDAGVLGPRSLFRWASCTFEEVPSLAMGDSGLSEALEGRQGRGFGSS
                     GQ"
     misc_feature    complement(75353..76186)
                     /gene="BLLF3"
                     /locus_tag="HHV4_BLLF3"
                     /note="dUTPase; Provisional; Region: PHA03131"
                     /db_xref="CDD:222996"
     gene            76219..77129
                     /gene="BLRF1"
                     /locus_tag="HHV4_BLRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783716"
     regulatory      76219..76224
                     /regulatory_class="TATA_box"
                     /gene="BLRF1"
                     /locus_tag="HHV4_BLRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      complement(76221..76226)
                     /regulatory_class="TATA_box"
                     /gene="BLLF3"
                     /locus_tag="HHV4_BLLF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             76259..76567
                     /gene="BLRF1"
                     /locus_tag="HHV4_BLRF1"
                     /function="envelope glycoprotein gN"
                     /note="type 1 membrane protein; complexed with envelope
                     glycoprotein M; role in virion morphogenesis; role in
                     membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein N"
                     /protein_id="YP_401665.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F2"
                     /db_xref="GeneID:3783716"
                     /translation="MGKVLRKPFAKAVPLLFLAATWLLTGVLPAGASSPTNAAAASLT
                     EAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCFNKFVNTLLTD
                     "
     misc_feature    76352..76558
                     /gene="BLRF1"
                     /locus_tag="HHV4_BLRF1"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            76575..77129
                     /gene="BLRF2"
                     /locus_tag="HHV4_BLRF2"
                     /note="gamma gene"
                     /db_xref="GeneID:3783717"
     regulatory      76575..76580
                     /regulatory_class="TATA_box"
                     /gene="BLRF2"
                     /locus_tag="HHV4_BLRF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             76637..77125
                     /gene="BLRF2"
                     /locus_tag="HHV4_BLRF2"
                     /codon_start=1
                     /product="virion protein G52"
                     /protein_id="YP_401666.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F1"
                     /db_xref="GeneID:3783717"
                     /translation="MSAPRKVRLPSVKAVDMSMEDMAARLARLESENKALKQQVLRGG
                     ACASSTSVPSAPVPPPEPLTARQREVMITQATGRLASQAMKKIEDKVRKSVDGVTTRN
                     EMENILQNLTLRIQVSMLGAKGQPSPGEGTRPRESNDPNATRRARSRSRGREAKKVQI
                     SD"
     misc_feature    76682..77035
                     /gene="BLRF2"
                     /locus_tag="HHV4_BLRF2"
                     /note="Herpesvirus BLRF2 protein; Region: Herpes_BLRF2;
                     cl27945"
                     /db_xref="CDD:332766"
     regulatory      77124..77129
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BLRF1 and BLRF2"
     gene            complement(77132..79904)
                     /gene="BLLF1"
                     /locus_tag="HHV4_BLLF1"
                     /note="gamma gene"
                     /db_xref="GeneID:3783713"
     gene            complement(77132..77763)
                     /gene="BLLF2"
                     /locus_tag="HHV4_BLLF2"
                     /db_xref="GeneID:3783714"
     regulatory      complement(77132..77137)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BLLF1 and BLLF2"
     CDS             complement(77142..79865)
                     /gene="BLLF1"
                     /locus_tag="HHV4_BLLF1"
                     /note="type 1 membrane protein; binds to cell surface
                     receptor CD21; role in cell attachment"
                     /codon_start=1
                     /product="glycoprotein 350"
                     /protein_id="YP_401667.1"
                     /db_xref="UniProtKB/TrEMBL:Q777F0"
                     /db_xref="GeneID:3783713"
                     /translation="MEAALLVCQYTIQSLIHLTGEDPGFFNVEIPEFPFYPTCNVCTA
                     DVNVTINFDVGGKKHQLDLDFGQLTPHTKAVYQPRGAFGGSENATNLFLLELLGAGEL
                     ALTMRSKKLPINVTTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPVYLIPETVPYI
                     KWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKTEMLGNEIDIECIMEDGEI
                     SQVLPGDNKFNITCSGYESHVPSGGILTSTSPVATPIPGTGYAYSLRLTPRPVSRFLG
                     NNSILYVFYSGNGPKASGGDYCIQSNIVFSDEIPASQDMPTNTTDITYVGDNATYSVP
                     MVTSEDANSPNVTVTAFWAWPNNTETDFKCKWTLTSGTPSGCENISGAFASNRTFDIT
                     VSGLGTAPKTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFADPNTTTGLPS
                     STHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPSPWDNGTESKAPDMTS
                     STSPVTTPTPNATSPTPAVTTPTPNATSPTPAVTTPTPNATSPTLGKTSPTSAVTTPT
                     PNATSPTLGKTSPTSAVTTPTPNATSPTLGKTSPTSAVTTPTPNATGPTVGETSPQAN
                     ATNHTLGGTSPTPVVTSQPKNATSAVTTGQHNITSSSTSSMSLRPSSNPETLSPSTSD
                     NSTSHMPLLTSAHPTGGENITQVTPASISTHHVSTSSPAPRPGTTSQASGPGNSSTST
                     KPGEVNVTKGTPPQNATSPQAPSGQKTAVPTVTSTGGKANSTTGGKHTTGHGARTSTE
                     PTTDYGGDSTTPRPRYNATTYLPPSTSSKLRPRWTFTSPPVTTAQATVPVPPTSQPRF
                     SNLSMLVLQWASLAVLTLLLLLVMADCAFRRNLSTSHTYTTPPYDDAETYV"
     misc_feature    complement(77145..79865)
                     /gene="BLLF1"
                     /locus_tag="HHV4_BLLF1"
                     /note="Herpes virus major outer envelope glycoprotein
                     (BLLF1); Region: Herpes_BLLF1; pfam05109"
                     /db_xref="CDD:282904"
     CDS             complement(77279..77725)
                     /gene="BLLF2"
                     /locus_tag="HHV4_BLLF2"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein BLLF2"
                     /protein_id="YP_401668.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E9"
                     /db_xref="GeneID:3783714"
                     /translation="MCPPVRQHPAQAPPAKRQALETVPHPQNRGRLMSPKARPPKMQR
                     RPRPPVAKRRRFPRSPQQVERPILPPVESTPQDMEPGQVQSPPQITAVIQLRQDRDTM
                     RPPIYLPALLANCGPAGLLRAHRLPQPKPPCQSRQRPSPDSQTSPC"
     misc_feature    complement(77282..77725)
                     /gene="BLLF2"
                     /locus_tag="HHV4_BLLF2"
                     /note="Family of unknown function (DUF5451); Region:
                     DUF5451; pfam17532"
                     /db_xref="CDD:340247"
     regulatory      complement(77758..77763)
                     /regulatory_class="TATA_box"
                     /gene="BLLF2"
                     /locus_tag="HHV4_BLLF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     intron          complement(77774..78364)
                     /gene="BLLF1"
                     /locus_tag="HHV4_BLLF1"
                     /note="splicing in BLLF1 produces gp220"
     repeat_region   77889..78351
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=77889..77919
     regulatory      complement(79899..79904)
                     /regulatory_class="TATA_box"
                     /gene="BLLF1"
                     /locus_tag="HHV4_BLLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             join(79955..80293,80382..82877)
                     /gene="EBNA-3A"
                     /locus_tag="HHV4_EBNA-3A"
                     /note="role in latency"
                     /codon_start=1
                     /product="nuclear antigen EBNA-3A"
                     /protein_id="YP_401669.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ8"
                     /db_xref="GeneID:3783762"
                     /translation="MDKDRPGPPALDDNMEEEVPSTSVVQEQVSAGDWENVLIELSDS
                     SSEKEAEDAHLEPAQKGTKRKRVDHDAGGSAPARPMLPPQPDLPGREAILRRFPLDLR
                     TLLQAIGAAATRIDTRAIDQFFGSQISNTEMYIMYAMAIRQAIRDRRRNPASRRDQAK
                     WRLQTLAAGWPMGYQAYSSWMYSYTDHQTTPTFVHLQATLGCTGGRRCHVTFSAGTFK
                     LPRCTPGDRQWLYVQSSVGNIVQSCNPRYSIFFDYMAIHRSLTKIWEEVLTPDQRVSF
                     MEFLGFLQRTDLSYIKSFVSDALGTTSIQTPWIDDNPSTETAQAWNAGFLRGRAYGID
                     LLRTEGEHVEGATGETREESEDTESDGDDEDLPCIVSRGGPKVKRPPIFIRRLHRLLL
                     MRAGKRTEQGKEVLEKARGSTYGTPRPPVPKPRPEVPQSDETATSHGSAQVPEPPTIH
                     LAAQGMAYPLHEQHGMAPCPVAQAPPTPLPPVSPGDQLPGVFSDGRVACAPVPAPAGP
                     IVRPWEPSLTQAAGQAFAPVRPQHMPVEPVPVPTVALERPVYPKPVRPAPPKIAMQGP
                     GETSGIRRARERWRPAPWTPNPPRSPSQMSVRDRLARLRAEAQVKQASVEVQPPQLTQ
                     VSPQQPMEGPLVPEQQMFPGAPFSQVADVVRAPGVPAMQPQYFDLPLIQPISQGAPVA
                     PLRASMGPVPPVPATQPQYFDIPLTEPINQGASAAHFLPQQPMEGPLVPEQWMFPGAA
                     LSQSVRPGVAQSQYFDLPLTQPINHGAPAAHFLHQPPMEGPWVPEQWMFQGAPPSQGT
                     DVVQHQLDALGYTLHGLNHPGVPVSPAVNQYHLSQAAFGLPIDEDESGEGSDTSEPCE
                     ALDLSIHGRPCPQAPEWPVQEEGGQDATEVLDLSIHGRPRPRTPEWPVQGEGGQNVTG
                     PETRRVVVSAVVHMCQDDEFPDLQDPPDEA"
     misc_feature    join(79955..80293,80382..82874)
                     /gene="EBNA-3A"
                     /locus_tag="HHV4_EBNA-3A"
                     /note="EBNA-3A; Provisional; Region: PHA03379"
                     /db_xref="CDD:223066"
     misc_feature    80457..81194
                     /gene="EBNA-3A"
                     /locus_tag="HHV4_EBNA-3A"
                     /note="Epstein-Barr virus nuclear antigen 3 (EBNA-3);
                     Region: EBV-NA3; pfam05009"
                     /db_xref="CDD:282817"
     repeat_region   81920..81989
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type A"
     repeat_region   81993..82018
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type B"
     repeat_region   82019..82093
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type C"
     repeat_region   82098..82123
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type B"
     repeat_region   82124..82201
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type C"
     repeat_region   82202..82272
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type A"
     repeat_region   82283..82360
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type C"
     repeat_region   82361..82431
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type A"
     repeat_region   82608..82694
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type D"
     repeat_region   82695..82781
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="type D"
     regulatory      82933..82938
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EBNA-3A"
                     /locus_tag="HHV4_EBNA-3A"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             join(83065..83421,83500..85959)
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="role in latency"
                     /codon_start=1
                     /product="nuclear antigen EBNA-3B"
                     /protein_id="YP_401670.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E8"
                     /db_xref="GeneID:3783763"
                     /translation="MKKAWLSRAQQADAGGASGSEDPPDYGDQGNVTQVGSEPISPEI
                     GPFELSAASEDDPQSGPVEENLDAAAREEEEPHEQEHNGGDDPLDVHTRQPRFVDVNP
                     TQAPVIQLVHAVYDSMLQSDLRPLGSLFLEQNLNIEEFIWMCMTVRHRCQAIRKKPLP
                     IVKQRRWKLLSSCRSWRMGYRTHNLKVNSFESGGDNVHPVLVTATLGCDEGTRHATTY
                     SAGIVQIPRISDQNQKIETAFLMARRARSLSAERYTLFFDLVSSGNTLYAIWIGLGTK
                     NRVSFIEFVGWLCKKDHTHIREWFRQCTGRPKAAKPWLRAHPVAIPYDDPLTNEEIDL
                     AYARGQAMNIEAPRLPDDPIIVEDDDESEEIEAESDEEEDKSGMESLKNIPQTLPYNP
                     TVYGRPAVFDRKSDAKSTKKCRAIVTDFSVIKAIEEEHRKKKAARTEQPRATPESQAP
                     TVVLQRPPTQQEPGPVGPLSVQARLEPWQPLPGPQVTAVLLHEESMQGVQVHGSMLDL
                     LEKDDEVMEQRVMATLLPPVPQQPRAGRRGPCVFTGDLGIESDEPASTEPVHDQLLPA
                     PGPDPLEIQPLTSPTTSQLSSSAPSCAQTPWPVVQPSQTPDDPTKQSRPPETAAPRQW
                     PMPLRPIPMRPLRMQPIPFNHPVGPTPHQTPQVEITPYKPTWAQIGHIPYQPTPTGPA
                     TMLLRQWAPATMQTPPRAPTPMSPPEVPPVPRQRPRGAPTPTPPPQVPPVPRQRPRGA
                     PTPTPPPQVLPTPMQLALRAPAGQQGPTKQILRQLLTGGVKKGRPSLKLQAALERQAA
                     AGWQPSPGSGTSDKIVQAPIFYPPVLQPIQVMGQGGSPTAMAASAVTQAPTEYTRERR
                     GVGPMPPTDIPPSKRAKIEAYTEPEMPHGGASHSPVVILENVGQGQQQTLECGGTAKQ
                     ERDMLGLGDIAVSSPSSSETSNDE"
     misc_feature    join(83065..83421,83500..85956)
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="EBNA-3B; Provisional; Region: PHA03378"
                     /db_xref="CDD:223065"
     misc_feature    83575..84354
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="Epstein-Barr virus nuclear antigen 3 (EBNA-3);
                     Region: EBV-NA3; pfam05009"
                     /db_xref="CDD:282817"
     repeat_region   85234..85410
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=85234..85293
     CDS             join(86083..86442,86517..89135)
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="role in latency"
                     /codon_start=1
                     /product="nuclear antigen EBNA-3C"
                     /protein_id="YP_401671.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E7"
                     /db_xref="GeneID:3783763"
                     /translation="MESFEGQGDSRQSPDNERGDNVQTTGEHDQDPGPGPPSSGASER
                     LVPEESYSRDQQPWGQSRGDENRGWMQRIRRRRRRRAALSGHLLDTEDNVPPWLPPHD
                     ITPYTARNIRDAACRAVKQSHLQALSNLILDSGLDTQHILCFVMAARQRLQDIRRGPL
                     VAEGGVGWRHWLLTSPSQSWPMGYRTATLRTLTPVPNRVGADSIMLTATFGCQNAART
                     LNTFSATVWTPPHAGPREQERYAREAEVRFLRGKWQRRYRRIYDLIELCGSLHHIWQN
                     LLQTEENLLDFVRFMGVMSSCNNPAVNYWFHKTIGNFKPYYPWNAPPNENPYHARRGI
                     KEHVIQNAFRKAQIQGLSMLATGGEPRGDATSETSSDEDTGRQGSDVELESSDDELPY
                     IDPNMEPVQQRPVMFVSRVPAKKPRKLPWPTPKTHPVKRTNVKTSDRSDKAEAQSTPE
                     RPGPSEQSSVTVEPAHPTPVEMPMVILHQPPPVPKPVPVKPTPPPSRRRRGACVVYDD
                     DVIEVIDVETTEDSSSVSQPNKPHRKHQDGFQRSGRRQKRAAPPTVSPSDTGPPAVGP
                     PAAGPPAAGPPAAGPPAAGPPAAGPPAAGPRILAPLSAGPPAAGPHIVTPPSARPRIM
                     APPVVRMFMRERQLPQSTGRKPQCFWEMRAGREITQMQQEPSSHLQSATQPTTPRPSW
                     APSVCALSVMDAGKAQPIESSHLSSMSPTQPISHEEQPRYEDPDAPLDLSLHPDVAAQ
                     PAPQAPYQGYQEPPAPQAPYQGYQEPPPPQAPYQGYQEPPAHGLQSSSYPGYAGPWTP
                     RSQHPCYRHPWAPWSQDPVHGHTQGPWDPRAPHLPPQWDGSAGHGQDQVSQFPHLQSE
                     TGPPRLQLSLVPLVSSSAPSWSSPQPRAPIRPIPTRFPPPPMPLQDSMAVGCDSSGTA
                     CPSMPFASDYSQGAFTPLDINATTPKRPRVEESSHGPARCSQATAEAQEILSDNSEIS
                     VFPKDAKQTDYDASTESELD"
     misc_feature    join(86083..86442,86517..89132)
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="EBNA-3C; Provisional; Region: PHA03377"
                     /db_xref="CDD:177614"
     misc_feature    86592..87386
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="Epstein-Barr virus nuclear antigen 3 (EBNA-3);
                     Region: EBV-NA3; pfam05009"
                     /db_xref="CDD:282817"
     misc_feature    <88257..88496
                     /gene="EBNA-3B/EBNA-3C"
                     /locus_tag="HHV4_EBNA-3B/EBNA-3C"
                     /note="WW-domain ligand protein; Region: WWbp; cl23807"
                     /db_xref="CDD:304964"
     variation       86839..89829
                     /note="=deletion in Raji"
                     /citation=[3]
     repeat_region   87834..88016
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=87834..87848
     repeat_region   88377..88493
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_unit_range=88377..88415
     gene            complement(89157..89828)
                     /gene="BZLF2"
                     /locus_tag="HHV4_BZLF2"
                     /note="gamma gene"
                     /db_xref="GeneID:3783745"
     CDS             complement(89157..89828)
                     /gene="BZLF2"
                     /locus_tag="HHV4_BZLF2"
                     /note="complexed with envelope glycoprotein H and envelope
                     glycoprotein L; binds MHC-II; role in cell entry"
                     /codon_start=1
                     /product="envelope glycoprotein 42"
                     /protein_id="YP_401672.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E6"
                     /db_xref="GeneID:3783745"
                     /translation="MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVAAAAITW
                     VPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEVKLPHWTPTLHTFQVPQNYTKANCTYC
                     NTREYTFSYKGCCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIE
                     SLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVS
                     QRSNS"
     misc_feature    complement(89181..89504)
                     /gene="BZLF2"
                     /locus_tag="HHV4_BZLF2"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cl02432"
                     /db_xref="CDD:413318"
     misc_feature    complement(order(89214..89219,89232..89234,89271..89273,
                     89406..89408))
                     /gene="BZLF2"
                     /locus_tag="HHV4_BZLF2"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     regulatory      89477..89482
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="EBNA-3B and EBNA-3C"
     gene            complement(89838..93925)
                     /gene="BRLF1"
                     /locus_tag="HHV4_BRLF1"
                     /note="gamma gene"
                     /db_xref="GeneID:3783727"
     mRNA            complement(join(89838..90053,90138..90242,90367..92897,
                     93838..93893))
                     /gene="BRLF1"
                     /locus_tag="HHV4_BRLF1"
                     /db_xref="GeneID:3783727"
     gene            complement(89838..90943)
                     /gene="BZLF1"
                     /locus_tag="HHV4_BZLF1"
                     /note="gamma gene"
                     /db_xref="GeneID:3783744"
     mRNA            complement(join(89838..90053,90138..90242,90367..90906))
                     /gene="BZLF1"
                     /locus_tag="HHV4_BZLF1"
                     /db_xref="GeneID:3783744"
     regulatory      complement(89863..89868)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="for BRLF1 and BZLF1"
     regulatory      complement(89867..89872)
                     /regulatory_class="TATA_box"
                     /gene="BZLF2"
                     /locus_tag="HHV4_BZLF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(89922..90053,90138..90242,90367..90867))
                     /gene="BZLF1"
                     /locus_tag="HHV4_BZLF1"
                     /note="ZEBRA, Zta, Z; bZIP protein; role in gene
                     regulation"
                     /codon_start=1
                     /product="protein Zta"
                     /protein_id="YP_401673.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E5"
                     /db_xref="GeneID:3783744"
                     /translation="MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPL
                     PCVLWPVLPEPLPQGQLTAYHVSTAPTGSWFSAPQPAPENAYQAYAAPQLFPVSDITQ
                     NQQTNQAGGEAPQPGDNSTVQTAAAVVFACPGANQGQQLADIGVPQPAPVAAPARRTR
                     KPQQPESLEECDSELEIKRYKNRVASRKCRAKFKQLLQHYREVAAAKSSENDRLRLLL
                     KQMCPSLDVDSIIPRTPDVLHEDLLNF"
     misc_feature    complement(join(89982..90053,90138..90221))
                     /gene="BZLF1"
                     /locus_tag="HHV4_BZLF1"
                     /note="Basic leucine zipper (bZIP) domain of blue light
                     (BL) receptor aureochrome (AUREO) and similar bZIP
                     domains; Region: bZIP_AUREO-like; cd14809"
                     /db_xref="CDD:269871"
     repeat_region   90293..90364
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
     regulatory      complement(90938..90943)
                     /regulatory_class="TATA_box"
                     /gene="BZLF1"
                     /locus_tag="HHV4_BZLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             complement(91078..92895)
                     /gene="BRLF1"
                     /locus_tag="HHV4_BRLF1"
                     /note="role in gene regulation; role in latency"
                     /codon_start=1
                     /product="protein Rta"
                     /protein_id="YP_401674.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E4"
                     /db_xref="GeneID:3783727"
                     /translation="MRPKKDGLEDFLRLTPEIKKQLGSLVSDYCNVLNKEFTAGSVEI
                     TLRSYKICKAFINEAKAHGREWGGLMATLNICNFWAILRNNRVRRRAENAGNDACSIA
                     CPIVMRYVLDHLIVVTDRFFIQAPSNRVMIPATIGTAMYKLLKHSRVRAYTYSKVLGV
                     DRAAIMASGKQVVEHLNRMEKEGLLSSKFKAFCKWVFTYPVLEEMFQTMVSSKTGHLT
                     DDVKDVRALIKTLPRASYSSHAGQRSYVSGVLPACLLSTKSKAVETPILVSGADRMDE
                     ELMGNDGGASHTEARYSESGQFHAFTDELESLPSPTMPLKPGAQSADCGDSSSSSSDS
                     GNSDTEQSEREEARAEAPRLRAPKSRRTSRPNRGQTPCPSNAAEPEQPWIAAVHQESD
                     ERPIFPHPSKPTFLPPVKRKKGLRDSREGMFLPKPEAGSAISDVFEGREVCQPKRIRP
                     FHPPGSPWANRPLPASLAPTPTGPVHEPVGSLTPAPVPQPLDPAPAVTPEASHLLEDP
                     DEETSQAVKALREMADTVIPQKEEAAICGQMDLSHPPPRGHLDELTTTLESMTEDLNL
                     DSPLTPELNEILDTFLNDECLLHAMHISTGLSIFDTSLF"
     misc_feature    complement(91144..92655)
                     /gene="BRLF1"
                     /locus_tag="HHV4_BRLF1"
                     /note="Herpesvirus transcription activation factor
                     (transactivator); Region: Herpes_TAF50; pfam03326"
                     /db_xref="CDD:308764"
     exon            complement(92638..92897)
                     /gene="BRLF1"
                     /locus_tag="HHV4_BRLF1"
                     /note="part of fused transcript from BRLF1 and BZLF1"
     gene            92728..93827
                     /gene="BRRF1"
                     /locus_tag="HHV4_BRRF1"
                     /note="gamma gene"
                     /db_xref="GeneID:3783728"
     regulatory      92728..92733
                     /regulatory_class="TATA_box"
                     /gene="BRRF1"
                     /locus_tag="HHV4_BRRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             92894..93826
                     /gene="BRRF1"
                     /locus_tag="HHV4_BRRF1"
                     /note="cooperates with protein Rta; role in gene
                     regulation"
                     /codon_start=1
                     /product="protein G49"
                     /protein_id="YP_401675.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E3"
                     /db_xref="GeneID:3783728"
                     /translation="MASSNRGNARPLKSFLHELYLKHYPEVGDVVHLLNTIGVDCDLP
                     PSHPLLTAQRGLFLARVLQAVQQHKLLEDTIVPKILKKLAYFLELLSYYSPKDEQRDI
                     AEVLDHLKTNRDLGLDDRLWALIRKLRQDRHHASVNVLMPGSDYTAVSLQYYDGISIG
                     MRKVIADVCRSGYASMPSMTATHNLSHQLLMASGPSEEPCAWRGFFNQVLLWTVALCK
                     FRRCIYYNYIQGSIATISQLLHLEIKALCSWIISQDGMRLFQHSRPLLTLWESVAANQ
                     EVTDAITLPDCAEYIDLLKHTKHVLENCSAMQYK"
     misc_feature    92957..93799
                     /gene="BRRF1"
                     /locus_tag="HHV4_BRRF1"
                     /note="BRRF1-like protein; Region: Herpes_BBRF1; cl27986"
                     /db_xref="CDD:391804"
     regulatory      93822..93827
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BRRF1"
                     /locus_tag="HHV4_BRRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      complement(93920..93925)
                     /regulatory_class="TATA_box"
                     /gene="BRLF1"
                     /locus_tag="HHV4_BRLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            93955..95631
                     /gene="BRRF2"
                     /locus_tag="HHV4_BRRF2"
                     /note="gamma gene"
                     /db_xref="GeneID:3783729"
     regulatory      93955..93960
                     /regulatory_class="TATA_box"
                     /gene="BRRF2"
                     /locus_tag="HHV4_BRRF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             94014..95627
                     /gene="BRRF2"
                     /locus_tag="HHV4_BRRF2"
                     /codon_start=1
                     /product="tegument protein G48"
                     /protein_id="YP_401676.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E2"
                     /db_xref="GeneID:3783729"
                     /translation="MSGQQRGSVILVPEHLAGALTKLMSDFITGQDVTLSGGNIAVKI
                     RDAINQTPGGGDVAILSSLFALWNALPTSGRQSSRDDLIPAAVQALTTAHNLCLGVIP
                     GETSHKDTPESLLRAIVTGLQKLWVDSCGCPECLQCLKGLKAIKPGLYEIPRIIPHTK
                     QCSPVNLLNMLVHKLVALRGHVQLAYDARVLTPDFHEIPDLDDSDAVFARTLLAALFH
                     LNMFFILKDYITQDSMSLKQALSGHWMSATGNPLPAAPETLRDYLEAFRNSDNHFYLP
                     TTGPLNTFQFPEELLGRVVVIDSSLCAASHVQDVITHGVGAGVPRPRFSALPPAPSRE
                     PQQTCSQLTSRGNESSRRNLGQPGGTSPAVPPVCPIVSLTASGAKQNRGGMGSLHLAK
                     PEETSPAVSPVCPIASPAASRSKQHCGVTGSSQAAPSFSSVAPVASLSGDLEEEEEGS
                     RESPSLPSSKKGDEEFEAWLEAQDANLEDVQREFSGLRVIGDEDEDGSEDGEFSDLDL
                     SDSDHEGDEGGGAVGGGRSLHSLYSLSVV"
     misc_feature    94020..94733
                     /gene="BRRF2"
                     /locus_tag="HHV4_BRRF2"
                     /note="Herpesvirus protein of unknown function (DUF832);
                     Region: DUF832; pfam05734"
                     /db_xref="CDD:283407"
     regulatory      95626..95631
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BRRF2"
                     /locus_tag="HHV4_BRRF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             95662..97587
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /note="chromosome-tethering protein; role in latency"
                     /codon_start=1
                     /product="nuclear antigen EBNA-1"
                     /protein_id="YP_401677.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E1"
                     /db_xref="GeneID:3783774"
                     /translation="MSDEGPGTGPGNGLGEKGDTSGPEGSGGSGPQRRGGDNHGRGRG
                     RGRGRGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGTHGGTGAGAGAGGAGAGG
                     AGAGGGAGAGGGAGGAGGAGGAGAGGGAGAGGGAGGAGGAGAGGGAGAGGGAGGAGAG
                     GGAGGAGGAGAGGGAGAGGGAGGAGAGGGAGGAGGAGAGGGAGAGGAGGAGGAGAGGA
                     GAGGGAGGAGGAGAGGAGAGGAGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAG
                     GAGAGGGAGGAGAGGAGGAGAGGAGGAGAGGAGGAGAGGGAGAGGAGAGGGGRGRGGS
                     GGRGRGGSGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSG
                     SPPRRPPPGRRPFFHPVGEADYFEYHQEGGPDGEPDVPPGAIEQGPADDPGEGPSTGP
                     RGQGDGGRRKKGGWFGKHRGQGGSNPKFENIAEGLRALLARSHVERTTDEGTWVAGVF
                     VYGGSKTSLYNLRRGTALAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFMVFL
                     QTHIFAEVLKDAIKDLVMTKPAPTCNIRVTVCSFDDGVDLPPWFPPMVEGAAAEGDDG
                     DDGDEGGDGDEGEEGQE"
     misc_feature    97051..97479
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /note="Epstein Barr virus nuclear antigen-1, DNA-binding
                     domain; Region: EBV-NA1; pfam02905"
                     /db_xref="CDD:367241"
     repeat_region   95929..96636
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.2"
                     /rpt_family="IR3; EBNA-1 triplet"
                     /rpt_type=direct
     gene            97617..99504
                     /gene="BKRF2"
                     /locus_tag="HHV4_BKRF2"
                     /note="core gene"
                     /db_xref="GeneID:3783710"
     regulatory      97617..97622
                     /regulatory_class="TATA_box"
                     /gene="BKRF2"
                     /locus_tag="HHV4_BKRF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      97649..97654
                     /regulatory_class="polyA_signal_sequence"
                     /gene="EBNA-1"
                     /locus_tag="HHV4_EBNA-1.1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             97670..98083
                     /gene="BKRF2"
                     /locus_tag="HHV4_BKRF2"
                     /function="virion glycoprotein gL"
                     /note="contains signal peptide; complexed with envelope
                     glycoprotein H; role in cell entry; role in cell-to-cell
                     spread"
                     /codon_start=1
                     /product="envelope glycoprotein L"
                     /protein_id="YP_401678.1"
                     /db_xref="UniProtKB/TrEMBL:Q777E0"
                     /db_xref="GeneID:3783710"
                     /translation="MRAVGVFLAICLVTIFVLPTWGNWAYPCCHVTQLRAQHLLALEN
                     ISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTG
                     HLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG"
     misc_feature    97751..98047
                     /gene="BKRF2"
                     /locus_tag="HHV4_BKRF2"
                     /note="Viral glycoprotein L; Region: Phage_glycop_gL;
                     pfam11108"
                     /db_xref="CDD:371377"
     gene            98065..99504
                     /gene="BKRF3"
                     /locus_tag="HHV4_BKRF3"
                     /note="core gene"
                     /db_xref="GeneID:3783711"
     CDS             98065..98832
                     /gene="BKRF3"
                     /locus_tag="HHV4_BKRF3"
                     /EC_number="3.2.2.3"
                     /note="role in DNA repair"
                     /codon_start=1
                     /product="uracil-DNA glycosylase"
                     /protein_id="YP_401679.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D9"
                     /db_xref="GeneID:3783711"
                     /translation="MASRGLDLWLDEHVWKRKQEIGVKGENLLLPDLWLDFLQLSPIF
                     QRKLAAVIACVRRLRTQATVYPEEDMCMAWARFCDPSDIKVVILGQDPYHGGQANGLA
                     FSVAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWASQGVLLLNTILTVQKGKPG
                     SHADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKASLINSKKHLVLTSQHPSPLA
                     QNSTRKSAQQKFLGNNHFVLANNFLREKGLGEIDWRL"
     misc_feature    98080..98829
                     /gene="BKRF3"
                     /locus_tag="HHV4_BKRF3"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03347"
                     /db_xref="CDD:177588"
     misc_feature    order(98329..98343,98410..98412,98509..98511,98635..98637,
                     98641..98643,98698..98703,98707..98715,98737..98742)
                     /gene="BKRF3"
                     /locus_tag="HHV4_BKRF3"
                     /note="active site"
                     /db_xref="CDD:381678"
     misc_feature    order(98329..98343,98509..98511,98701..98703)
                     /gene="BKRF3"
                     /locus_tag="HHV4_BKRF3"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:381678"
     misc_feature    98329..98343
                     /gene="BKRF3"
                     /locus_tag="HHV4_BKRF3"
                     /note="motif A [structural motif]; Region: motif A"
                     /db_xref="CDD:381678"
     gene            98846..99504
                     /gene="BKRF4"
                     /locus_tag="HHV4_BKRF4"
                     /note="gamma gene"
                     /db_xref="GeneID:3783712"
     CDS             98846..99499
                     /gene="BKRF4"
                     /locus_tag="HHV4_BKRF4"
                     /codon_start=1
                     /product="tegument protein G45"
                     /protein_id="YP_401680.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D8"
                     /db_xref="GeneID:3783712"
                     /translation="MAMFLKSRGVRSCRDRRLLSDEEEETSQSSSYTLGSQASQSIQE
                     EDVSDTDESDYSDEDEEIDLEEEYPSDEDPSEGSDSDPSWHPSDSDESDYSESDEDEA
                     TPGSQASRSSRVSPSTQQSSGLTPTPSFSRPRTRAPPRPPAPAPVRGRASAPPRPPAP
                     VQQSTKDKGPHRPTRPVLRGPAPRRPPPPSSPNTYNKHMMETTPPIKGNNNYNWPWL"
     misc_feature    <98987..99496
                     /gene="BKRF4"
                     /locus_tag="HHV4_BKRF4"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03151"
                     /db_xref="CDD:177546"
     regulatory      99499..99504
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="BKRF2, BKRF3 and BKRF4"
     gene            complement(99537..101971)
                     /gene="BBLF4"
                     /locus_tag="HHV4_BBLF4"
                     /note="core gene"
                     /db_xref="GeneID:3783685"
     regulatory      complement(99537..99542)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BBLF4"
                     /locus_tag="HHV4_BBLF4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(99542..101971)
                     /gene="BBLF4"
                     /locus_tag="HHV4_BBLF4"
                     /note="role in DNA replication"
                     /codon_start=1
                     /product="helicase-primase helicase subunit"
                     /protein_id="YP_401681.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D7"
                     /db_xref="GeneID:3783685"
                     /translation="MAEEPRAPEALSSTFMLNMTSDASVRRIVRRIGTLARRRVQQLP
                     DMETFSPEFDPELSEPPFLPFSAYVITGTAGAGKSTSVSCLHHTMDCLVTGATTVAAQ
                     NLSQTLRAYCPTVYSAFGFKSRHINMTQRVSSHGRSTDAALEELQRRDLAKYWPVLSD
                     IAAEFRRTKPRGLYSGVSGPAFEVLRDMHQGQLWTTNVIVVDEAGTLSVHILTAVVFC
                     YWFFNAWLRTPLYRRGRIPCIVCVGSPTQTDAFQSSFSHETQVNKIRECDNILTFLVG
                     NPRAATYVDVARNWALFINNKRCTDVQFGHLMKTLEYGLELSPDILAYVDRFVVPRAA
                     IMDPAQYVGWTRLFLSHAEVKTFLTTLHATLKTAGQGRAARGTGGDGGGVTMFTCPVE
                     CEVFLDPLAQYKTLVGLPGLTAHTWLQKNYARLGNYSQFADQDMVPVGTEQDEERVKV
                     TYNVTYVKHSSVSVNCKTKKSICGYTGTFGDFMDTLEADSFVEAHGHEQPEYVYSFLA
                     RLIYGGIYAFSHGGHSLCENGEYVAELGAVPLPGRTWDPEVTAGMELGELPLEVAWDG
                     ERSPAAVFYARVLAPPAANSAPLCSLLNIYNDLRAYFRQCLDVAVRYGGREFRDLPFC
                     TFTNNMLIRDNIEFTSDEPLLHGLLDYASTTENYTLLGYTHLNVFFGIRGKQQPQDAG
                     SSRMPRLMVKDEAGFVCCLEHNTNKLYETIEDKSLNLCSIRDYGISSKLAMTIAKAQG
                     LSLNKVAICFGSHRNIKPGHVYVALSRARHSNCVVMDRNPLSEMITGEGNPASGYIVD
                     ALKNSRALLVY"
     misc_feature    complement(99545..101947)
                     /gene="BBLF4"
                     /locus_tag="HHV4_BBLF4"
                     /note="Helicase; Region: Herpes_Helicase; pfam02689"
                     /db_xref="CDD:280797"
     gene            101588..104502
                     /gene="BBRF1"
                     /locus_tag="HHV4_BBRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783764"
     regulatory      101588..101593
                     /regulatory_class="TATA_box"
                     /gene="BBRF1"
                     /locus_tag="HHV4_BBRF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             101916..103757
                     /gene="BBRF1"
                     /locus_tag="HHV4_BBRF1"
                     /codon_start=1
                     /product="capsid portal protein"
                     /protein_id="YP_401682.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D6"
                     /db_xref="GeneID:3783764"
                     /translation="MFNMNVDESASGALGSSAIPVHPTPASVRLFEILQGKYAYVQGQ
                     TIYANLRNPGVFSRQVFTHLFKRAISHCTYDDVLHDWNKFEACIQKRWPSDDSCASRF
                     RESTFESWSTTMKLTVRDLLTTNIYRVLHSRSVLSYERYVDWICATGMVPAVKKPITQ
                     ELHSKIKSLRDRCVCRELGHERTIRSIGTELYEATKEIIESLNSTFIPQFTEVTIEYL
                     PRSDEYVAYYCGRRIRLHVLFPPAIFAGTVTFDSPVQRLYQNIFMCYRTLEHAKICQL
                     LNTAPLKAIVGHGGRDMYKDILAHLEQNSQRKDPKKELLNLLVKLSENKTISGVTDVV
                     EEFITDASNNLVDRNRLFGQPGETAAQGLKKKVSNTVVKCLTDQINEQFDQINGLEKE
                     RELYLKKIRSMESQLQASLGPGGNNPAASAPAAVAAEAASVDILTGSTASAIEKLFNS
                     PSASLGARVSGHNESILNSFVSQYIPPSREMTKDLTELWESELFNTFKLTPVVDNQGQ
                     RLYVRYSSDTISILLGPFTYLVAELSPVELVTDVYATLGIVEIIDELYRSSRLAIYIE
                     DLGRKYCPASATGGDHGIRQAPSARGDTEPDHAKSKPARDPPPGAGS"
     misc_feature    102000..103631
                     /gene="BBRF1"
                     /locus_tag="HHV4_BBRF1"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:396361"
     gene            103660..104502
                     /gene="BBRF2"
                     /locus_tag="HHV4_BBRF2"
                     /note="core gene"
                     /db_xref="GeneID:3783686"
     CDS             103660..104496
                     /gene="BBRF2"
                     /locus_tag="HHV4_BBRF2"
                     /note="role in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL7"
                     /protein_id="YP_401683.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D5"
                     /db_xref="GeneID:3783686"
                     /translation="MASGKHHQPGGTRSLTMQKVSLRVTPRLVLEVNRHNAICVATNV
                     PEFYNARGDLNIRDLRAHVKARMISSQFCGYVLVSLLDSEDQVDHLNIFPHVFSERMI
                     LYKPNNVNLMEMCALLSMIENAKSPSIGLCREVLGRLTLLHSKCNNLDSLFLYNGART
                     LLSTLVKYHDLEEGAATPGPWNEGLSLFKLHKELKRAPSEARDLMQSLFLTSGKMGCL
                     ARSPKDYCADLNKEEDANSGFTFNLFYQDSLLTKHFQCQTVLQTLRRKCLGSDTVSKI
                     IP"
     misc_feature    103741..104397
                     /gene="BBRF2"
                     /locus_tag="HHV4_BBRF2"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7;
                     pfam01677"
                     /db_xref="CDD:279943"
     gene            complement(104403..106750)
                     /gene="BBLF2/BBLF3"
                     /locus_tag="HHV4_BBLF2/BBLF3"
                     /note="core gene"
                     /db_xref="GeneID:3783684"
     regulatory      complement(104403..104408)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BBLF2/BBLF3"
                     /locus_tag="HHV4_BBLF2/BBLF3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(104493..105098,105227..106750))
                     /gene="BBLF2/BBLF3"
                     /locus_tag="HHV4_BBLF2/BBLF3"
                     /note="role in DNA replication"
                     /codon_start=1
                     /product="helicase-primase subunit"
                     /protein_id="YP_401684.3"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ7"
                     /db_xref="GeneID:3783684"
                     /translation="MMETPAESVRARVSSVTFYNVTQTAGRWWAIWVVGIVPIKREDV
                     ETLIVVQACQPPLGGSLEPPVVNAPSTTELNFLRWERELRRSGGLIAMLADAAEKDLF
                     DLSFRTRDRRLLSAARVEDEQGLIFQPLFPAQVVCQSCSGDDGRDQQPPPVDGFGSEM
                     EGEQTCPHAQRHSESPGQLDVYIRTPRGDVFTYSTETPDDPSPVPFRDILRPVTYEVD
                     LVSSDGATGRGGDARRHRVSLKILEPAGGFESWLVNSWSMAGGGLYAFLRSIYASCYA
                     NHRGTKPIFYLLDPELCPGGSDFQPYVPGFPFLPIHYVGRARPAFWHRAPHSEGLLLL
                     DLNLGVSGTPLADALLGLDARSGQRRGSLLLQQIWPPTRKEINPRHVCTREGGEGGGE
                     DETTVVGRAEATAILEADATWWLYELARCHLSARGAPVGTPDGGGQARDAQTWLRALH
                     RYGTSDTRRALGGLYTAVTRVLLHAAADLGLTWAYADEFILGFVAPTSAHPSEEPLAQ
                     AFLQGVKDSEDASRLDRDVMGGEATVARRHIRVKARRGPGCLLMAIFQGDLYVGGCRE
                     HSGPFLVWHEAFSWTLDQLAARPEADKAPPSHDHLLTLVRDLTRRLAPGRRRNRFWAL
                     PRAWLQRLRRAGLRLSGSHVCLLDKDGARPAPCQTATEHGLSPTAYFREIMAFLLDVI
                     SALHPGYTIPMEITRETDLLMTVLSLF"
     misc_feature    complement(join(104496..105098,105227..106750))
                     /gene="BBLF2/BBLF3"
                     /locus_tag="HHV4_BBLF2/BBLF3"
                     /note="helicase-primase subunit BBLF2/3; Provisional;
                     Region: PHA03312; cl28610"
                     /db_xref="CDD:333430"
     regulatory      104497..104502
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="BBRF1 and BBRF2"
     gene            106693..108075
                     /gene="BBRF3"
                     /locus_tag="HHV4_BBRF3"
                     /note="core gene"
                     /db_xref="GeneID:3783687"
     regulatory      106693..106698
                     /regulatory_class="TATA_box"
                     /gene="BBRF3"
                     /locus_tag="HHV4_BBRF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      106810..106815
                     /regulatory_class="TATA_box"
                     /gene="BBRF3"
                     /locus_tag="HHV4_BBRF3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             106849..108066
                     /gene="BBRF3"
                     /locus_tag="HHV4_BBRF3"
                     /note="type 3 membrane protein; 8 transmembrane domains;
                     complexed with envelope glycoprotein N; role in virion
                     morphogenesis; role in membrane fusion"
                     /codon_start=1
                     /product="envelope glycoprotein M"
                     /protein_id="YP_401685.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D4"
                     /db_xref="GeneID:3783687"
                     /translation="MKSSKNDTFVYRTWVKTLVVYFVMFVMSAVVPITAMFPNLGYPC
                     YFNALVDYGALNLTNYNLAHHLTPTLYLEPPEMFVYITLVFIADCVAFIYYACGEVAL
                     IKARKKVSGLTDLSAWVSAVGSPTVLFLAILKLWSIQVFIQVLSYKHVFLSAFVYFLH
                     FLASVLHACACVTRFSPVWVVKAQDNSIPQDTFLWWVVFYLKPVVTNLYLGCLALETL
                     VFSLSVFLALGNSFYFMVGDMVLGAVNLFLILPIFWYILTEVWLASFLRHNFGFYCGM
                     FIASIILILPLVRYEAVFVSAKLHTTVAINVAIIPILCSVAMLIRICRIFKSMRQGTD
                     YVPVSETVELELESEPRPRPSRTPSPGRNRRRSSTSSSSSRSTRRQRPVSTQALVSSV
                     LPMTTDSEEEIFP"
     misc_feature    106849..107931
                     /gene="BBRF3"
                     /locus_tag="HHV4_BBRF3"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     pfam01528"
                     /db_xref="CDD:279822"
     regulatory      108070..108075
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BBRF3"
                     /locus_tag="HHV4_BBRF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            complement(108459..112825)
                     /gene="BGLF3"
                     /locus_tag="HHV4_BGLF3"
                     /note="betagamma gene"
                     /db_xref="GeneID:3783703"
     gene            complement(108459..111829)
                     /gene="BGLF3.5"
                     /locus_tag="HHV4_BGLF3.5"
                     /note="core gene"
                     /db_xref="GeneID:3783766"
     gene            complement(108459..111326)
                     /gene="BGLF4"
                     /locus_tag="HHV4_BGLF4"
                     /note="core gene; PK family"
                     /db_xref="GeneID:3783704"
     gene            complement(108459..110053)
                     /gene="BGLF5"
                     /locus_tag="HHV4_BGLF5"
                     /note="core gene"
                     /db_xref="GeneID:3783773"
     gene            complement(108459..109043)
                     /gene="BBLF1"
                     /locus_tag="HHV4_BBLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783765"
     CDS             complement(108459..108686)
                     /gene="BBLF1"
                     /locus_tag="HHV4_BBLF1"
                     /note="envelope-associated; role in virion morphogenesis"
                     /codon_start=1
                     /product="myristylated tegument protein"
                     /protein_id="YP_401686.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D3"
                     /db_xref="GeneID:3783765"
                     /translation="MGALWSLCRRRVNSIGDVDGGIINLYNDYEEFNLETTKLIAAEE
                     GRACGETNEGLEYDEDSENDELLFLPNKKPN"
     misc_feature    complement(108462..108686)
                     /gene="BBLF1"
                     /locus_tag="HHV4_BBLF1"
                     /note="Alkaline exonuclease; Provisional; Region:
                     PHA03358"
                     /db_xref="CDD:177596"
     regulatory      complement(108471..108476)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BGLF3, BGLF3.5, BGLF4, BGLF5 and BBLF1"
     CDS             complement(108641..110053)
                     /gene="BGLF5"
                     /locus_tag="HHV4_BGLF5"
                     /note="role in DNA processing"
                     /codon_start=1
                     /product="deoxyribonuclease"
                     /protein_id="YP_401687.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D2"
                     /db_xref="GeneID:3783773"
                     /translation="MADVDELEDPMEEMTSYTFARFLRSPETEAFVRNLDRPPQMPAM
                     RFVYLYCLCKQIQEFSGETGFCDFVSSLVQENDSKDGPSLKSIYWGLQEATDEQRTVL
                     CSYVESMTRGQSENLMWDILRNGIISSSKLLSTIKNGPTKVFEPAPISTNHYFGGPVA
                     FGLRCEDTVKDIVCKLICGDASANRQFGFMISPTDGIFGVSLDLCVNVESQGDFILFT
                     DRSCIYEIKCRFKYLFSKSEFDPIYPSYTALYKRPCKRSFIRFINSIARPTVEYVPDG
                     RLPSEGDYLLTQDEAWNLKDVRKRKLGPGHDLVADSLAANRGVESMLYVMTDPSENAG
                     RIGIKDRVPVNIFINPRHNYFYQVLLQYKIVGDYVRHSGGGKPGRDCSPRVNIVTAFF
                     RKRSPLDPATCTLGSDLLLDASVEIPVAVLVTPVVLPDSVIRKTLSTAAGSWKAYADN
                     TFDTAPWVPSGLFADDESTP"
     misc_feature    complement(108668..110029)
                     /gene="BGLF5"
                     /locus_tag="HHV4_BGLF5"
                     /note="Herpesvirus alkaline exonuclease; Region:
                     Herpes_alk_exo; pfam01771"
                     /db_xref="CDD:396366"
     regulatory      complement(109038..109043)
                     /regulatory_class="TATA_box"
                     /gene="BBLF1"
                     /locus_tag="HHV4_BBLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(110037..111326)
                     /gene="BGLF4"
                     /locus_tag="HHV4_BGLF4"
                     /EC_number="2.7.11.1"
                     /note="role in protein phosphorylation"
                     /codon_start=1
                     /product="tegument serine/threonine protein kinase"
                     /protein_id="YP_401688.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D1"
                     /db_xref="GeneID:3783704"
                     /translation="MDVNMAAELSPTNSSSSGELSVSPEPPRETQAFLGKVTVIDYFT
                     FQHKHLKVTNIDDMTETLYVKLPENMTRCDHLPITCEYLLGRGSYGAVYAHADNATVK
                     LYDSVTELYHELMVCDMIQIGKATAEDGQDKALVDYLSACTSCHALFMPQFRCSLQDY
                     GHWHDGSIEPLVRGFQGLKDAVYFLNRHCGLFHSDISPSNILVDFTDTMWGMGRLVLT
                     DYGTASLHDRNKMLDVRLKSSKGRQLYRLYCQREPFSIAKDTYKPLCLLSKCYILRGA
                     GHIPDPSACGPVGAQTALRLDLQSLGYSLLYGIMHLADSTHKIPYPNPDMGFDRSDPL
                     YFLQFAAPKVVLLEVLSQMWNLNLDMGLTSCGESPCVDVTAEHMSQFLQWCRSLKKRF
                     KESYFFNCRPRFEHPHLPGLVAELLADDFFGPDGRRG"
     misc_feature    complement(<110604..111077)
                     /gene="BGLF4"
                     /locus_tag="HHV4_BGLF4"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:419665"
     misc_feature    complement(order(110604..110615,110661..110663,
                     110670..110672,110721..110723,110727..110732,
                     110736..110738,110742..110744,110853..110855,
                     110859..110861,110877..110879,110913..110918,
                     110958..110960,111021..111023,111051..111053,
                     111063..111077))
                     /gene="BGLF4"
                     /locus_tag="HHV4_BGLF4"
                     /note="active site"
                     /db_xref="CDD:270870"
     misc_feature    complement(order(110670..110672,110721..110723,
                     110727..110732,110736..110738,110742..110744,
                     110859..110861,110877..110879,110913..110918,
                     110958..110960,111021..111023,111051..111053,
                     111063..111077))
                     /gene="BGLF4"
                     /locus_tag="HHV4_BGLF4"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    complement(order(110604..110615,110661..110663,
                     110730..110732,110736..110738,110742..110744,
                     110853..110855,110859..110861,111063..111065))
                     /gene="BGLF4"
                     /locus_tag="HHV4_BGLF4"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    complement(order(110604..110627,110652..110675))
                     /gene="BGLF4"
                     /locus_tag="HHV4_BGLF4"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:270870"
     STS             110513..111602
                     /standard_name="Fgf8"
                     /db_xref="UniSTS:506892"
     CDS             complement(111205..111666)
                     /gene="BGLF3.5"
                     /locus_tag="HHV4_BGLF3.5"
                     /note="role in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL14"
                     /protein_id="YP_401724.1"
                     /db_xref="GeneID:3783766"
                     /translation="MKMSSSKRDLVAQQLRASVEKRAAVSARDRFGRDHALFETQFTS
                     ARGALESLRHARETFESKQLISTYQRVVTATKTQFPKINYKQLERVEELREQELEARD
                     ELRQALEPFEEHGCEYGCGVEPDELLQQWRVECLPRTPSRDPGLFGEGDCH"
     misc_feature    complement(111244..111657)
                     /gene="BGLF3.5"
                     /locus_tag="HHV4_BGLF3.5"
                     /note="Gammaherpesvirus protein of unknown function
                     (DUF848); Region: DUF848; pfam05852"
                     /db_xref="CDD:283504"
     CDS             complement(111653..112651)
                     /gene="BGLF3"
                     /locus_tag="HHV4_BGLF3"
                     /codon_start=1
                     /product="protein UL95"
                     /protein_id="YP_401689.1"
                     /db_xref="UniProtKB/TrEMBL:Q777D0"
                     /db_xref="GeneID:3783703"
                     /translation="MFNAVKADMPDDPMLARRYGQCLELALEACQDTPEQFKLVETPL
                     KSFLLVSNILPQDNRPWHEARSSGRVAEDDYDFSSLALELLPLNPRLPEEWQFGGQGW
                     SSRMEPSQPEMGMGLCFEVFDGDLMRIALAWNKDEVIGQALQILAHSQTWTSLVPEDP
                     LPWMWALFYGPRSHCEERHCVYAAARGKRGPILLPTAVYTPCANIEAFLAHLTRCVYA
                     LYLDVRDWKGEDIAPPFDVSRLNKMAKQLCLLPQEPFCITRVCLLCLLHKQNLNAQYK
                     RPVDTYDPCLILTGEAERYMVDAVGNYREASTGTTVLYPTYDLGSIVADMVTYEDE"
     misc_feature    complement(111662..112651)
                     /gene="BGLF3"
                     /locus_tag="HHV4_BGLF3"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     regulatory      complement(111824..111829)
                     /regulatory_class="TATA_box"
                     /gene="BGLF3.5"
                     /locus_tag="HHV4_BGLF3.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            112650..118064
                     /gene="BGRF1/BDRF1"
                     /locus_tag="HHV4_BGRF1/BDRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783767"
     CDS             join(112650..113585,116927..118063)
                     /gene="BGRF1/BDRF1"
                     /locus_tag="HHV4_BGRF1/BDRF1"
                     /note="contains an ATPase domain; role in DNA
                     encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 1"
                     /protein_id="YP_401690.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C9"
                     /db_xref="GeneID:3783767"
                     /translation="MLYASQRGRLTENLRNALQQDSTTQGCLGAETPSIMYTGAKSDR
                     WAHPLVGTIHASNLYCPMLRAYCRHYGPRPVFVASDESLPMFGASPALHTPVQVQMCL
                     LPELRDTLQRLLPPPNLEDSEALTEFKTSVSSARAILEDPNFLEMREFVTSLASFLSG
                     QYKHKPARLEAFQKQVVLHSFYFLISIKSLEITDTMFDIFQSAFGLEEMTLEKLHIFK
                     QKASVFLIPRRHGKTWIVVAIISLILSNLSNVQIGYVAHQKHVASAVFTEIIDTLTKS
                     FDSKRVEVNKETSTITFRHSGKISSTVMCATCFNKNSIRGQTFHLLFVDEANFIKKEA
                     LPAILGFMLQKDAKIIFISSVNSADQATSFLYKLKDAQERLLNVVSYVCQEHRQDFDM
                     QDSMVSCPCFRLHIPSYITMDSNIRATTNLFLDGAFSTELMGDTSSLSQGSLSRTVRD
                     DAINQLELCRVDTLNPRVAGRLASSLYVYVDPAYTNNTSASGTGIAAVTHDRADPNRV
                     IVLGLEHFFLKDLTGDAALQIATCVVALVSSIVTLHPHLEEVKVAVEGNSSQDSAVAI
                     ASIIGESCPLPCAFVHTKDKTSSLQWPMYLLTNEKSKAFERLIYAVNTASLSASQVTV
                     SNTIQLSFDPVLYLISQIRAIKPIPLRDGTYTYTGKQRNLSDDVLVALVMAHFLATTQ
                     KHTFKKVH"
     misc_feature    join(112779..113585,116927..116935)
                     /gene="BGRF1/BDRF1"
                     /locus_tag="HHV4_BGRF1/BDRF1"
                     /note="Probable DNA packing protein, N-terminus; Region:
                     DNA_pack_N; pfam02500"
                     /db_xref="CDD:280634"
     misc_feature    117014..118051
                     /gene="BGRF1/BDRF1"
                     /locus_tag="HHV4_BGRF1/BDRF1"
                     /note="Probable DNA packing protein, C-terminus; Region:
                     DNA_pack_C; pfam02499"
                     /db_xref="CDD:280633"
     regulatory      complement(112820..112825)
                     /regulatory_class="TATA_box"
                     /gene="BGLF3"
                     /locus_tag="HHV4_BGLF3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(113191..117016)
                     /gene="BDLF3.5"
                     /locus_tag="HHV4_BDLF3.5"
                     /note="betagamma gene"
                     /db_xref="GeneID:3783769"
     gene            complement(113191..116766)
                     /gene="BDLF4"
                     /locus_tag="HHV4_BDLF4"
                     /note="betagamma gene"
                     /db_xref="GeneID:3783695"
     gene            complement(113191..116144)
                     /gene="BGLF1"
                     /locus_tag="HHV4_BGLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783702"
     gene            complement(113191..114641)
                     /gene="BGLF2"
                     /locus_tag="HHV4_BGLF2"
                     /note="core gene"
                     /db_xref="GeneID:3783768"
     regulatory      complement(113191..113196)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BDLF3.5, BDLF4, BGLF1 and BGLF2"
     CDS             complement(113575..114585)
                     /gene="BGLF2"
                     /locus_tag="HHV4_BGLF2"
                     /note="involved possibly in virion morphogenesis"
                     /codon_start=1
                     /product="tegument protein UL16"
                     /protein_id="YP_401691.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C8"
                     /db_xref="GeneID:3783768"
                     /translation="MASAANSSREQLRKFLNKECLWVLSDASTPQMKVYTATTAVSAV
                     YVPQIAGPPKTYMNVTLIVLKPKKKPTYVTVYINGTLATVARPEVLFTKAVQGPHSLT
                     LMYFGVFSDAVGEAVPVEIRGNPVVTCTDLTTAHVFTTSTAVKTVEELQDITPSEIIP
                     LGRGGAWYAEGALYMFFVNMDMLMCCPNMPTFPSLTHFINLLTRCDNGECVTCYGAGA
                     HVNILRGWTEDDSPGTSGTCPCLLPCTALNNDYVPITGHRALLGLMFKPEDAPFVVGL
                     RFNPPKMHPDMSRVLQGVLANGKEVPCTAQPWTLLRFSDLYSRAMLYNCQVLKRQVLH
                     SY"
     misc_feature    complement(113596..114558)
                     /gene="BGLF2"
                     /locus_tag="HHV4_BGLF2"
                     /note="Herpesvirus UL16/UL94 family; Region: Herpes_UL16;
                     pfam03044"
                     /db_xref="CDD:281094"
     CDS             complement(114563..116086)
                     /gene="BGLF1"
                     /locus_tag="HHV4_BGLF1"
                     /note="capsid-associated; involved in DNA encapsidation;
                     involved in capsid transport"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL17"
                     /protein_id="YP_401692.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C7"
                     /db_xref="GeneID:3783702"
                     /translation="MDVHIDNQVLSGLGTPLLVHLFVPDTVMAELCPNRVPNCEGAWC
                     QTLFSDRTGLTRVCRVFAARGMLPGRPSHRGTFTSVPVYCDEGLPELYNPFHVAALRF
                     YDEGGLVGELQIYYLSLFEGAKRALTDGHLIREASGVQESAAAMQPIPIDPGPPGGAG
                     IEHMPVAAAQVEHPKTYDLKQILLEITQEENRGEQRLGHAGSPALCLGLRLRAGAETK
                     AAAETSVSKHHPALENPSNIRGSAGGEGGGGRAGTGGTVGVGSGALSRVPVSFSKTRR
                     AIRESRALVRGIAHIFSPHALYVVTYPELSAQGRLHRMTAVTHASPATDLAEVSILGA
                     PEREFRFLISVALRISASFREKLAMQAWTAQQEIPVVIPTSYSRIYKNSDLIREAFFT
                     VQTRVSWESCWVKATISNAPKTPDACLWIDSHPLYEEGASAWGKVIDSRPPGGLVGAA
                     SQLVALGTDGHCVHLATTSDGQAFLVLPGGFVIKGQLALTPEERGYILARHGIRREQ"
     misc_feature    complement(114620..116086)
                     /gene="BGLF1"
                     /locus_tag="HHV4_BGLF1"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:398316"
     regulatory      complement(114636..114641)
                     /regulatory_class="TATA_box"
                     /gene="BGLF2"
                     /locus_tag="HHV4_BGLF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(116056..116733)
                     /gene="BDLF4"
                     /locus_tag="HHV4_BDLF4"
                     /codon_start=1
                     /product="protein UL92"
                     /protein_id="YP_401693.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C6"
                     /db_xref="GeneID:3783695"
                     /translation="MSDQGRLSLPRGEGGTDEPNPRHLCSYSKLEFHLPLPESMASVF
                     ACWGCGEYHVCDGSSECTLIETHEGVVCALTGNYMGPHFQPALRPWTEIRQDTQDQRD
                     KWEPEQVQGLVKTVVNHLYHYFLNENVISGVSEALFDQEGALRPHIPALVSFVFPCCL
                     MLFRGASSEKVVDVVLSLYIHVIISIYSQKTVYGALLFKSTRNKRYDAVAKRMRELWM
                     STLTTKC"
     misc_feature    complement(116074..116661)
                     /gene="BDLF4"
                     /locus_tag="HHV4_BDLF4"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     regulatory      complement(116139..116144)
                     /regulatory_class="TATA_box"
                     /gene="BGLF1"
                     /locus_tag="HHV4_BGLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(116712..116945)
                     /gene="BDLF3.5"
                     /locus_tag="HHV4_BDLF3.5"
                     /codon_start=1
                     /product="protein UL91"
                     /protein_id="YP_401725.1"
                     /db_xref="GeneID:3783769"
                     /translation="MSAPGCSERQDKKRGTIGEREFGELLSWDPTDLPRTVARVYVAV
                     GGLFEQEVSEVQRLENICTLLDLAGVECQTKAD"
     misc_feature    complement(116715..116945)
                     /gene="BDLF3.5"
                     /locus_tag="HHV4_BDLF3.5"
                     /note="BDLF3; Provisional; Region: PHA03256"
                     /db_xref="CDD:165514"
     regulatory      complement(116761..116766)
                     /regulatory_class="TATA_box"
                     /gene="BDLF4"
                     /locus_tag="HHV4_BDLF4"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     regulatory      complement(117011..117016)
                     /regulatory_class="TATA_box"
                     /gene="BDLF3.5"
                     /locus_tag="HHV4_BDLF3.5"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     regulatory      118059..118064
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BGRF1/BDRF1"
                     /locus_tag="HHV4_BGRF1/BDRF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(118066..121098)
                     /gene="BDLF1"
                     /locus_tag="HHV4_BDLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783692"
     gene            complement(118066..120188)
                     /gene="BDLF2"
                     /locus_tag="HHV4_BDLF2"
                     /note="gamma gene"
                     /db_xref="GeneID:3783693"
     gene            complement(118066..118816)
                     /gene="BDLF3"
                     /locus_tag="HHV4_BDLF3"
                     /note="gamma gene"
                     /db_xref="GeneID:3783694"
     regulatory      complement(118066..118071)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BDLF1, BDLF2 and BDLF3"
     CDS             complement(118074..118778)
                     /gene="BDLF3"
                     /locus_tag="HHV4_BDLF3"
                     /note="type 1 membrane protein; role possibly in immune
                     regulation"
                     /codon_start=1
                     /product="envelope glycoprotein 150"
                     /protein_id="YP_401694.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C5"
                     /db_xref="GeneID:3783694"
                     /translation="MAHARDKAGAVMAMILICETSLIWTSSGSSTASAGNVTGTTAVT
                     TPSPSASGPSTNQSTTLTTTSAPITTTAILSTNTTTVTFTGTTVTPVPTTSNASTINV
                     TTKVTAQNITATEAGTGTSTGVTSNVTTRSSSTTSATTRITNATTLAPTLSSKGTSNA
                     TKTTAELPTVPDERQPSLSYGLPLWTLVFVGLTFLMLILIFAAGLMMSAKNKPLDEAL
                     LTNAVTRDPSLYKGLV"
     misc_feature    complement(118077..118778)
                     /gene="BDLF3"
                     /locus_tag="HHV4_BDLF3"
                     /note="BDLF3; Provisional; Region: PHA03255"
                     /db_xref="CDD:165513"
     regulatory      complement(118811..118816)
                     /regulatory_class="TATA_box"
                     /gene="BDLF3"
                     /locus_tag="HHV4_BDLF3"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(118839..120101)
                     /gene="BDLF2"
                     /locus_tag="HHV4_BDLF2"
                     /note="type 2 membrane protein; role in cell-to-cell
                     spread"
                     /codon_start=1
                     /product="envelope glycoprotein 48"
                     /protein_id="YP_401695.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C4"
                     /db_xref="GeneID:3783693"
                     /translation="MVDEQVAVEHGTVSHTISREEDGVVHERRVLASGERVEVFYKAP
                     APRPREGRASTFHDFTVPAAAAVPGPEPEPEPHPPMPIHANGGGETKTNTQDQNQNQT
                     TRTRTNAKAEERTAEMDDTMASSGGQRGAPISADLLSLSSLTGRMAAMAPSWMKSEVC
                     GERMRFKEDVYDGEAETLAEPPRCFMLSFVFIYYCCYLAFLALLAFGFNPLFLPSFMP
                     VGAKVLRGKGRDFGVPLSYGCPTNPFCKVYTLIPAVVINNVTYYPNNTDSHGGHGGFE
                     AAALHVAALFESGCPNLQAVTNRNRTFNVTRASGRVERRLVQDMQRVLASAVVVMHHH
                     CHYETYYVFDGVGPEFGTIPTPCFKDVLAFRPSLVTNCTAPLKTSVKGPNWSGAAGGM
                     KRKQCRVDRLTDRSFPAYLEEVMYVMVQ"
     CDS             complement(120112..121017)
                     /gene="BDLF1"
                     /locus_tag="HHV4_BDLF1"
                     /function="capsid triplex protein"
                     /note="complexed 2:1 with capsid triplex subunit 1 to
                     connect capsid hexons and pentons; role in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid triplex subunit 2"
                     /protein_id="YP_401696.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C3"
                     /db_xref="GeneID:3783692"
                     /translation="MDLKVVVSLSSRLYTDEIAKMQQRIGCILPLASTHGTQNVQGLG
                     LGQVYSLETVPDYVSMYNYLSDCTLAVLDEVSVDSLILTKIVPGQTYAIKNKYQPFFQ
                     WHGTGSLSVMPPVFGREHATVKLESNDVDIVFPMVLPTPIAEEVLQKILLFNVYSRVV
                     MQAPGNADMLDVHMHLGSVSYLGHHYELALPEVPGPLGLALLDNLSLYFCIMVTLLPR
                     ASMRLVRGLIRHEHHDLLNLFQEMVPDEIARIDLDDLSVADDLSRMRVMMTYLQSLAS
                     LFNLGPRLATAAYSQETLTATCWLR"
     misc_feature    complement(120115..121017)
                     /gene="BDLF1"
                     /locus_tag="HHV4_BDLF1"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03258"
                     /db_xref="CDD:165516"
     regulatory      complement(120183..120188)
                     /regulatory_class="TATA_box"
                     /gene="BDLF2"
                     /locus_tag="HHV4_BDLF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(121019..125422)
                     /gene="BcLF1"
                     /locus_tag="HHV4_BcLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783688"
     regulatory      complement(121019..121024)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BcLF1"
                     /locus_tag="HHV4_BcLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             complement(121033..125178)
                     /gene="BcLF1"
                     /locus_tag="HHV4_BcLF1"
                     /note="6 copies form hexons, 5 copies form pentons; role
                     in capsid morphogenesis"
                     /codon_start=1
                     /product="major capsid protein"
                     /protein_id="YP_401697.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C2"
                     /db_xref="GeneID:3783688"
                     /translation="MASNEGVENRPFPYLTVDADLLSNLRQSAAEGLFHSFDLLVGKD
                     AREAGIKFEVLLGVYTNAIQYVRFLETALAVSCVNTEFKDLSRMTDGKIQFRISVPTI
                     AHGDGRRPSKQRTFIVVKNCHKHHISTEMELSMLDLEILHSIPETPVEYAEYVGAVKT
                     VASALQFGVDALERGLINTVLSVKLRHAPPMFILQTLADPTFTERGFSKTVKSDLIAM
                     FKRHLLEHSFFLDRAENMGSGFSQYVRSRLSEMVAAVSGESVLKGVSTYTTAKGGEPV
                     GGVFIVTDNVLRQLLTFLGEEADNQIMGPSSYASFVVRGENLVTAVSYGRVMRTFEHF
                     MARIVDSPEKAGSTKSDLPAVAAGVEDQPRVPISAAVIKLGNHAVAVESLQKMYNDTQ
                     SPYPLNRRMQYSYYFPVGLFMPNPKYTTSAAIKMLDNPTQQLPVEAWIVNKNNLLLAF
                     NLQNALKVLCHPRLHTPAHTLNSLNAAPAPRDRRETYSLQHRRPNHMNVLVIVDEFYD
                     NKYAAPVTDIALKCGLPTEDFLHPSNYDLLRLELHPLYDIYIGRDAGERARHRAVHRL
                     MVGNLPTPLAPAAFQEARGQQFETATSLAHVVDQAVIETVQDTAYDTAYPAFFYVVEA
                     MIHGFEEKFVMNVPLVSLCINTYWERSGRLAFVNSFSMIKFICRHLGNNAISKEAYSM
                     YRKIYGELIALEQALMRLAGSDVVGDESVGQYVCALLDPNLLPPVAYTDIFTHLLTVS
                     DRAPQIIIGNEVYADTLAAPQFIERVGNMDEMAAQFVALYGYRVNGDHDHDFRLHLGP
                     YVDEGHADVLEKIFYYVFLPTCTNAHMCGLGVDFQHVAQTLAYNGPAFSHHFTRDEDI
                     LDNLENGTLRDLLEISDLRPTVGMIRDLSASFMTCPTFTRAVRVSVDNDVTQQLAPNP
                     ADKRTEQTVLVNGLVAFAFSERTRAVTQCLFHAIPFHMFYGDPRVAATMHQDVATFVM
                     RNPQQRAVEAFNRPEQLFAEYREWHRSPMGKYAAECLPSLVSISGMTAMHIKMSPMAY
                     IAQAKLKIHPGVAMTVVRTDEILSENILFSSRASTSMFIGTPNVSRREARVDAVTFEV
                     HHEMASIDTGLSYSSTMTPARVAAITTDMGIHTQDFFSVFPAEAFGNQQVNDYIKAKV
                     GAQRNGTLLRDPRTYLAGMTNVNGAPGLCHGQQATCEIIVTPVTADVAYFQKSNSPRG
                     RAACVVSCENYNQEVAEGLIYDHSRPDAAYEYRSTVNPWASQLGSLGDIMYNSSYRQT
                     AVPGLYSPCRAFFNKEELLRNNRGLYNMVNEYSQRLGGHPATSNTEVQFVVIAGTDVF
                     LEQPCSFLQEAFPALSASSRALIDEFMSVKQTHAPIHYGHYIIEEVAPVRRILKFGNK
                     VVF"
     misc_feature    complement(121060..125136)
                     /gene="BcLF1"
                     /locus_tag="HHV4_BcLF1"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:397301"
     regulatory      complement(121059..121064)
                     /regulatory_class="TATA_box"
                     /gene="BDLF1"
                     /locus_tag="HHV4_BDLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     regulatory      complement(121093..121098)
                     /regulatory_class="TATA_box"
                     /gene="BDLF1"
                     /locus_tag="HHV4_BDLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            125073..128686
                     /gene="BcRF1"
                     /locus_tag="HHV4_BcRF1.2"
                     /note="betagamma gene"
                     /db_xref="GeneID:3783690"
     regulatory      125073..125078
                     /regulatory_class="TATA_box"
                     /gene="BcRF1"
                     /locus_tag="HHV4_BcRF1.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             125177..127429
                     /gene="BcRF1"
                     /locus_tag="HHV4_BcRF1.2"
                     /codon_start=1
                     /product="protein UL87"
                     /protein_id="YP_401698.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ6"
                     /db_xref="GeneID:3783690"
                     /translation="MTQGKREMGGGLEGFSSQLGLFYALACNRSPPTLPEDATLLIKW
                     LDTALGREATFYACRAMRRLLLGVIRMNDCQELPPGLIILSPGTVPGPLGVQSLEHTD
                     CEIWSSAHPDHAAHLPVPRVITYTDCPGSINTSSMFRLIIRYLSHHQFERCFEQFCRV
                     VPRRFLGTCKRNSAKMLAHLNQVTRIPPCPPFSGREARLKFHFFSWSTFMLSWPNNAT
                     LREIRTRAATNLTHHPHLVDTLYHASPQTPFLTRSGALYRFVTCCNCTLPNISIQQCK
                     AGDRPGDLEIILQSNGGGRPASFQFPSSPTGSLLRCIVAASLLPEVSVGHQELSPLRS
                     RSQGGQTDVRSGPDPARRLVALLRREDGAPKDPPLGPFGHPRGPGPAKSEDEESERRD
                     APPPPLDSSFQASRLVPVGPGFRLLVFNTNRVINTKLVCSEPLVKMRVCNVPRLINNF
                     VARKYVVKETAFTVSLFFTDGVGANLAINVNISGTYLSFLLAMTSLRCFLPVEAIYPA
                     AVSNWNSTLDLHGLENQSLVRENRSGVFWTTNFPSVVSCRDGLNVSWFKAATATISRV
                     HGQTLEQHLIREITPIVTHREAKISRIKNRLFTLLELRNRSQIQVLHKRFLEGLLDCA
                     SLLRLDPSCINRIASEGLFDFSKRSIAHSKNRHECALLGHRHSANVTKLVVNERKTRL
                     DILGRNANFLTRCKHQVNLRQSPIFLTLLRHIRRRLGLGRASVKREITLLLAHLRKKT
                     APIHCRDAQV"
     misc_feature    125177..127378
                     /gene="BcRF1"
                     /locus_tag="HHV4_BcRF1.2"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03374"
                     /db_xref="CDD:223063"
     regulatory      complement(125417..125422)
                     /regulatory_class="TATA_box"
                     /gene="BcLF1"
                     /locus_tag="HHV4_BcLF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            127416..128686
                     /gene="BTRF1"
                     /locus_tag="HHV4_BTRF1"
                     /note="betagamma gene"
                     /db_xref="GeneID:3783770"
     CDS             127416..128630
                     /gene="BTRF1"
                     /locus_tag="HHV4_BTRF1"
                     /codon_start=1
                     /product="tegument protein UL88"
                     /protein_id="YP_401699.3"
                     /db_xref="UniProtKB/TrEMBL:Q777C1"
                     /db_xref="GeneID:3783770"
                     /translation="MLKCKQPGARFIHGAVHLPSGQIVFHTIHSPTLASALGLPGENV
                     PIPALFRASGLNVRESLPMTNMRAPIISLARLILAPNPYILEGQLTVGMTQDNGIPVL
                     FARPVIEVKSGPESNIKASSQLMIAEDSCLNQIAPFSASEHPAFSMVESVKRVRVDEG
                     ANTRRTIRDILEIPVTVLSSLQLSPTKSILKKAPEPPPPEPQATFDATPYARIFYDIG
                     RQVPKLGNAPAAQVSNVLIANRSHNSLRLVPNPDLLPLQHLYLKHVVLKSLNLENIVQ
                     DFEAIFTSPSDTISEAETKAFEKLVEQAKNTVENIVFCLNSICSTSTLPDVVPDVNNP
                     NISLALEKYFLMFPPSGTIMRNVRFATPIVRLLCQGAELGTMAQFLGKYIKVKKETGM
                     YTLVKLYYLLRI"
     misc_feature    127416..128627
                     /gene="BTRF1"
                     /locus_tag="HHV4_BTRF1"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03148"
                     /db_xref="CDD:223001"
     gene            complement(128608..132846)
                     /gene="BXLF1"
                     /locus_tag="HHV4_BXLF1"
                     /note="core gene"
                     /db_xref="GeneID:3783741"
     gene            complement(128608..131021)
                     /gene="BXLF2"
                     /locus_tag="HHV4_BXLF2"
                     /note="core gene"
                     /db_xref="GeneID:3783742"
     regulatory      complement(128608..128613)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BXLF1 and BXLF2"
     CDS             complement(128627..130747)
                     /gene="BXLF2"
                     /locus_tag="HHV4_BXLF2"
                     /note="type 1 membrane protein; possible membrane fusogen;
                     complexed with envelope glycoprotein L; role in cell
                     entry; role in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein H"
                     /protein_id="YP_401700.1"
                     /db_xref="UniProtKB/TrEMBL:Q777C0"
                     /db_xref="GeneID:3783742"
                     /translation="MQLLCVFCLVLLWEVGAASLSEVKLHLDIEGHASHYTIPWTELM
                     AKVPGLSPEALWREANVTEDLASMLNRYKLIYKTSGTLGIALAEPVDIPAVSEGSMQV
                     DASKVHPGVISGLNSPACMLSAPLEKQLFYYIGTMLPNTRPHSYVFYQLRCHLSYVAL
                     SINGDKFQYTGAMTSKFLMGTYKRVTEKGDEHVLSLVFGKTKDLPDLRGPFSYPSLTS
                     AQSGDYSLVIVTTFVHYANFHNYFVPNLKDMFSRAVTMTAASYARYVLQKLVLLEMKG
                     GCREPELDTETLTTMFEVSVAFFKVGHAVGETGNGCVDLRWLAKSFFELTVLKDIIGI
                     CYGATVKGMQSYGLERLAAMLMATVKMEELGHLTTEKQEYALRLATVGYPKAGVYSGL
                     IGGATSVLLSAYNRHPLFQPLHTVMRETLFIGSHVVLRELRLNVTTQGPNLALYQLLS
                     TALCSALEIGEVLRGLALGTESGLFSPCYLSLRFDLTRDKLLSMAPQEATLDQAAVSN
                     AVDGFLGRLSLEREDRDAWHLPAYKCVDRLDKVLMIIPLINVTFIISSDREVRGSALY
                     EASTTYLSSSLFLSPVIMNKCSQGAVAGEPRQIPKIQNFTRTQKSCIFCGFALLSYDE
                     KEGLETTTYITSQEVQNSILSSNYFDFDNLHVHYLLLTTNGTVMEIAGLYEERAHVVL
                     AIILYFIAFALGIFLVHKIVMFFL"
     misc_feature    complement(129179..130654)
                     /gene="BXLF2"
                     /locus_tag="HHV4_BXLF2"
                     /note="Herpesvirus glycoprotein H main domain; Region:
                     Herpes_glycop_H; pfam02489"
                     /db_xref="CDD:396858"
     misc_feature    complement(128732..129157)
                     /gene="BXLF2"
                     /locus_tag="HHV4_BXLF2"
                     /note="Herpesvirus glycoprotein H C-terminal domain;
                     Region: Herpes_glycoH_C; pfam17488"
                     /db_xref="CDD:407519"
     regulatory      128681..128686
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BcRF1 and BTRF1"
     CDS             complement(130749..132572)
                     /gene="BXLF1"
                     /locus_tag="HHV4_BXLF1"
                     /EC_number="2.7.1.21"
                     /note="role in nucleotide metabolism"
                     /codon_start=1
                     /product="thymidine kinase"
                     /protein_id="YP_401701.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B9"
                     /db_xref="GeneID:3783741"
                     /translation="MAGFPGKEAGPPGGWRKCQEDESPENERHENFYAEIDDFAPSVL
                     TPTGSDSGAGEEDDDGLYQVPTHWPPLMAPTGLSGERVPCRTQAAVTSNTGNSPGSRH
                     TSCPFTLPRGAQPPAPAHQKPTAPTPKPRSRECGPSKTPDPFSWFRKTSCTEGGADST
                     SRSFMYQKGFEEGLAGLGLDDKSDCESEDESNFRRPSSHSALKQKNGGKGKPSGLFEH
                     LAAHGREFSKLSKHAAQLKRLSGSVMNVLNLDDAQDTRQAKAQRKESMRVPIVTHLTN
                     HVPVIKPACSLFLEGAPGVGKTTMLNHLKAVFGDLTIVVPEPMRYWTHVYENAIKAMH
                     KNVTRARHGREDTSAEVLACQMKFTTPFRVLASRKRSLLVTESGARSVAPLDCWILHD
                     RHLLSASVVFPLMLLRSQLLSYSDFIQVLATFTADPGDTIVWMKLNVEENMRRLKKRG
                     RKHESGLDAGYLKSVNDAYHAVYCAWLLTQYFAPEDIVKVCAGLTTITTVCHQSHTPI
                     IRSGVAEKLYKNSIFSVLKEVIQPFRADAVLLEVCLAFTRTLAYLQFVLVDLSEFQDD
                     LPGCWTEIYMQALKNPAIRSQFFDWAGLSKVISDFERGNRD"
     misc_feature    complement(130752..132563)
                     /gene="BXLF1"
                     /locus_tag="HHV4_BXLF1"
                     /note="thymidine kinase; Provisional; Region: PHA03132"
                     /db_xref="CDD:222997"
     regulatory      complement(131016..131021)
                     /regulatory_class="TATA_box"
                     /gene="BXLF2"
                     /locus_tag="HHV4_BXLF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            132571..134886
                     /gene="BXRF1"
                     /locus_tag="HHV4_BXRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783743"
     CDS             132571..133317
                     /gene="BXRF1"
                     /locus_tag="HHV4_BXRF1"
                     /codon_start=1
                     /product="nuclear protein UL24"
                     /protein_id="YP_401702.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B8"
                     /db_xref="GeneID:3783743"
                     /translation="MDPTRGLCALSTHDLAKFHSLPPARKAAGKRAHLRCYSKLLSLK
                     SWEQLASFLSLPPGPTFTDFRLFFEVTLGRRIADCVVVALQPYPRCYIVEFKTAMSNT
                     ANPQSVTRKAQRLEGTAQLCDCANFLRTSCPPVLGSQGLEVLAALVFKNQRSLRTLQV
                     EFPALGQKTLPTSTTGLLNLLSRWQDGALRARLDRPRPTAQGHRPRTHVGPKPSQLTA
                     RVPRSARAGRAGGRKGQVGAVGQVCPGAQK"
     misc_feature    132628..133146
                     /gene="BXRF1"
                     /locus_tag="HHV4_BXRF1"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; pfam01646"
                     /db_xref="CDD:307668"
     regulatory      complement(132839..132844)
                     /regulatory_class="TATA_box"
                     /gene="BXLF1"
                     /locus_tag="HHV4_BXLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            133013..134886
                     /gene="BVRF1"
                     /locus_tag="HHV4_BVRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783732"
     regulatory      133013..133018
                     /regulatory_class="TATA_box"
                     /gene="BVRF1"
                     /locus_tag="HHV4_BVRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             133127..134839
                     /gene="BVRF1"
                     /locus_tag="HHV4_BVRF1"
                     /note="located on capsid near vertices; possibly
                     stabilizes the capsid and retains the genome; role in DNA
                     encapsidation"
                     /codon_start=1
                     /product="DNA packaging tegument protein UL25"
                     /protein_id="YP_401703.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B7"
                     /db_xref="GeneID:3783732"
                     /translation="MALSGHVLIDPARLPRDTGPELMWAPSLRNSLRVSPEALELAER
                     EAERARSERWDRCAQVLKNRLLRVELDGIMRDHLARAEEIRQDLDAVVAFSDGLESMQ
                     VRSPSTGGRSAPAPPSPSPAQPFTRLTGNAQYAVSISPTDPPLMVAGSLAQTLLGNLY
                     GNINQWVPSFGPWYRTMSANAMQRRVFPKQLRGNLNFTNSVSLKLMTEVVAVLEGTTQ
                     DFFSDVRHLPDLQAALILSVAYLLLQGGSSHQQRPLPASREELLELGPESLEKIIADL
                     KAKSPGGNFMILTSGNKEARQSIAPLNRQAAYPPGTFADNKIYNLFVGAGLLPTTAAL
                     NVPGAAGRDRDLVYRIANQIFGEDVPPFSSHQWNLRVGLAALEALMLVYTLCETANLA
                     EAATRRLHLSSLLPQAMQRRKPAMASAGMPGAYPVQTLFRHGELFRFIWAHYVRPTVA
                     ADPQASISSLFPGLVLLALELKLMDGQAPSHYAINLTGQKFDTLFEIINQKLLFHDPA
                     AMLAARTQLRLAFEDGVGVALGRPSPMLAAREILERQFSASDDYDRLYFLTLGYLASP
                     VAPS"
     misc_feature    133193..134764
                     /gene="BVRF1"
                     /locus_tag="HHV4_BVRF1"
                     /note="Herpesvirus UL25 family; Region: Herpes_UL25;
                     pfam01499"
                     /db_xref="CDD:396196"
     gene            complement(134632..135627)
                     /gene="BVLF1"
                     /locus_tag="HHV4_BVLF1"
                     /note="betagamma gene"
                     /db_xref="GeneID:3783771"
     regulatory      complement(134632..134637)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BVLF1"
                     /locus_tag="HHV4_BVLF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(134809..135627)
                     /gene="BVLF1"
                     /locus_tag="HHV4_BVLF1"
                     /note="required for expression of late genes; role in
                     transcriptional regulation"
                     /codon_start=1
                     /product="protein UL79"
                     /protein_id="YP_401726.1"
                     /db_xref="GeneID:3783771"
                     /translation="MLMGLGVRGDDARMTPGIHGLLLKMLKNWPLCALREDELRFLHL
                     SLTKLLTLSVNFYLWREAVINTGNRTNRVLARKVPDEYWYLLYRALARVGFPAEALRP
                     GNRSRSLCLFLHDRPDVTGAVCACVWAQLGLRRAPDLSQVTLADGNLLFNLGSVLPNR
                     LVVGVLYCLVHWGADEHETRVRARLRPLFVAFLCLAGYLLLDRAILSDAHDYEGLWHA
                     VALSMAAWHGLTPLPETRDEKEAKPPCDEFIYLFANDPLQCEELAQLGATGEAR"
     misc_feature    complement(134863..135621)
                     /gene="BVLF1"
                     /locus_tag="HHV4_BVLF1"
                     /note="UL79 family; Region: Herpes_UL79; cl28065"
                     /db_xref="CDD:332886"
     regulatory      134881..134886
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BXRF1 and BVRF1"
     gene            135432..137455
                     /gene="BVRF2"
                     /locus_tag="HHV4_BVRF2"
                     /note="core gene"
                     /db_xref="GeneID:3783733"
     regulatory      135432..135437
                     /regulatory_class="TATA_box"
                     /gene="BVRF2"
                     /locus_tag="HHV4_BVRF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             135638..137455
                     /gene="BVRF2"
                     /locus_tag="HHV4_BVRF2"
                     /EC_number="3.4.21.97"
                     /note="serine protease (N-terminal region); minor scaffold
                     protein (remainder of protein, clipped near C terminus);
                     role in capsid morphogenesis"
                     /codon_start=1
                     /product="capsid maturation protease"
                     /protein_id="YP_401704.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B6"
                     /db_xref="GeneID:3783733"
                     /translation="MVQAPSVYVCGFVERPDAPPKDACLHLDPLTVKSQLPLKKPLPL
                     TVEHLPDAPVGSVFGLYQSRAGLFSAASITSGDFLSLLDSIYHDCDIAQSQRLPLPRE
                     PKVEALHAWLPSLSLASLHPDIPQTTADGGKLSFFDHVSICALGRRRGTTAVYGTDLA
                     WVLKHFSDLEPSIAAQIENDANAAKRESGCPEDHPLPLTKLIAKAIDAGFLRNRVETL
                     RQDRGVANIPAESYLKASDAPDLQKPDKALQSPPPASTDPATMLSGNAGEGATACGGS
                     AAAGQDLISVPRNTFMTLLQTNLDNKPPRQTPLPYAAPLPPFSHQAIATAPSYGPGAG
                     AVAPAGGYFTSPGGYYAGPAGGDPGAFLAMDAHTYHPHPHPPPAYFGLPGLFGPPPPV
                     PPYYGSHLRADYVPAPSRSNKRKRDPEEDEEGGGLFPGEDATLYRKDIAGLSKSVNEL
                     QHTLQALRRETLSYGHTGVGYCPQQGPCYTHSGPYGFQPHQSYEVPRYVPHPPPPPTS
                     HQAAQAQPPPPGTQAPEAHCVAESTIPEAGAAGNSGPREDTNPQQPTTEGHHRGKKLV
                     QASASGVAQSKEPTTPKAKSVSAHLKSIFCEELLNKRVA"
     misc_feature    135707..136615
                     /gene="BVRF2"
                     /locus_tag="HHV4_BVRF2"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; pfam00716"
                     /db_xref="CDD:279105"
     STS             136046..136337
                     /gene="BVRF2"
                     /locus_tag="HHV4_BVRF2"
                     /standard_name="SHGC-154725"
                     /db_xref="UniSTS:184380"
     gene            136331..137455
                     /gene="BdRF1"
                     /locus_tag="HHV4_BdRF1"
                     /note="core gene"
                     /db_xref="GeneID:3783696"
     regulatory      136331..136336
                     /regulatory_class="TATA_box"
                     /gene="BdRF1"
                     /locus_tag="HHV4_BdRF1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             136418..137455
                     /gene="BdRF1"
                     /locus_tag="HHV4_BdRF1"
                     /note="clipped near C terminus; role in capsid
                     morphogenesis"
                     /codon_start=1
                     /product="capsid scaffold protein"
                     /protein_id="YP_401705.1"
                     /db_xref="UniProtKB/TrEMBL:Q66541"
                     /db_xref="GeneID:3783696"
                     /translation="MLSGNAGEGATACGGSAAAGQDLISVPRNTFMTLLQTNLDNKPP
                     RQTPLPYAAPLPPFSHQAIATAPSYGPGAGAVAPAGGYFTSPGGYYAGPAGGDPGAFL
                     AMDAHTYHPHPHPPPAYFGLPGLFGPPPPVPPYYGSHLRADYVPAPSRSNKRKRDPEE
                     DEEGGGLFPGEDATLYRKDIAGLSKSVNELQHTLQALRRETLSYGHTGVGYCPQQGPC
                     YTHSGPYGFQPHQSYEVPRYVPHPPPPPTSHQAAQAQPPPPGTQAPEAHCVAESTIPE
                     AGAAGNSGPREDTNPQQPTTEGHHRGKKLVQASASGVAQSKEPTTPKAKSVSAHLKSI
                     FCEELLNKRVA"
     misc_feature    <136457..137443
                     /gene="BdRF1"
                     /locus_tag="HHV4_BdRF1"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     regulatory      137438..137443
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BVRF2 and BdRF1"
     gene            complement(137464..138282)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /db_xref="GeneID:3783708"
     regulatory      complement(137464..137469)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     CDS             complement(137490..138236)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="type 1 membrane glycoprotein; contains Ig domain"
                     /codon_start=1
                     /product="membrane protein BILF2"
                     /protein_id="YP_401706.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B4"
                     /db_xref="GeneID:3783708"
                     /translation="MTHLVLLLCCCVGSVCAFFSDLVKFENVTAHAGARVNLTCSVPS
                     NESVSRIELGRGYTPGDGQLPLAVATSNNGTHITNGGYNYSLTLEWVNDSNTSVSLII
                     PNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEEDDQYHANRTLTQRMHLTVIPATT
                     IAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFPIDPWRPKTTWVHWALLLITCA
                     VVAPVLLIIIISCLGWLAGWGRRRKGWIPL"
     misc_feature    complement(138144..138158)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409353"
     misc_feature    complement(137865..138155)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:416386"
     misc_feature    complement(138108..138137)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    complement(138024..138044)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    complement(138012..138020)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409353"
     misc_feature    complement(137976..137993)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409353"
     misc_feature    complement(137925..137951)
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     regulatory      complement(138277..138282)
                     /regulatory_class="TATA_box"
                     /gene="BILF2"
                     /locus_tag="HHV4_BILF2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            138352..160531
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /db_xref="GeneID:3783757"
     mRNA            join(138352..138480,149581..149712,149923..150077,
                     150237..150348,155267..156737,156846..156928,
                     158625..160531)
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /note="BART mRNAS, of which RMPS1 and part of A73 are
                     included as representatives, are complex spliced
                     transcripts"
                     /db_xref="GeneID:3783757"
     repeat_region   138947..139329
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
     ncRNA           139087..139107
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART3*"
                     /db_xref="GeneID:3783757"
     ncRNA           139124..139145
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART3"
                     /db_xref="GeneID:3783757"
     ncRNA           139228..139249
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART4"
                     /db_xref="GeneID:3783757"
     ncRNA           139266..139288
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART4*"
                     /db_xref="GeneID:3783757"
     ncRNA           139351..139374
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART1-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           139387..139408
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART1-3p"
                     /db_xref="GeneID:3783757"
     ncRNA           139553..139574
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART15"
                     /db_xref="GeneID:3783757"
     ncRNA           139675..139698
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART5"
                     /db_xref="GeneID:3783757"
     ncRNA           139717..139734
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART5*"
                     /db_xref="GeneID:3783757"
     misc_feature    139724..151554
                     /note="B95-8 deletion restored from Raji"
                     /citation=[2]
     ncRNA           139795..139818
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART16"
                     /db_xref="GeneID:3783757"
     ncRNA           139915..139936
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART17-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           139953..139975
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART17-3p"
                     /db_xref="GeneID:3783757"
     ncRNA           140033..140054
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART6-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           140072..140093
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART6-3p"
                     /db_xref="GeneID:3783757"
     gene            complement(140570..143711)
                     /gene="LF3"
                     /locus_tag="HHV4_LF3"
                     /db_xref="GeneID:3783749"
     CDS             complement(140570..143344)
                     /gene="LF3"
                     /locus_tag="HHV4_LF3"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein LF3"
                     /protein_id="YP_401707.1"
                     /db_xref="GeneID:3783749"
                     /translation="MKRVARGPCLAPGSGLGAHPHPRRSGAADPADPVGHPAAPRAPG
                     PEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPV
                     GHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRR
                     SGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPR
                     TRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPA
                     APRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAA
                     DPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQ
                     PATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRA
                     PGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPAD
                     PVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATP
                     RRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPE
                     PRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGH
                     PAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSG
                     AADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAPRAPGPEPRTR
                     LQPATPRRSGAADPADPVGHPAAPRAPGPEPRTRLQPATPRRSGAADPADPVGHPAAP
                     ELQGWVLRPKGTGGDFRGIGVTINWLNLHHVYVVFHAAYRLEGQVVIGSEILETRVPL
                     KQGALLPLLF"
     misc_feature    complement(141590..>143188)
                     /gene="LF3"
                     /locus_tag="HHV4_LF3"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     misc_feature    complement(140762..>142372)
                     /gene="LF3"
                     /locus_tag="HHV4_LF3"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      complement(140706..140711)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="LF3"
                     /locus_tag="HHV4_LF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     repeat_region   140765..143281
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /rpt_family="IR4; PstI"
                     /rpt_type=direct
                     /rpt_unit_range=140765..140865
     rep_origin      143207..144444
                     /note="region containing oriLyt, core lytic cycle origin
                     of DNA replication"
     repeat_region   143272..144328
                     /note="DRright, similar to 40366..41409"
                     /rpt_family="DR"
                     /rpt_type=direct
     regulatory      complement(143442..143447)
                     /regulatory_class="TATA_box"
                     /gene="LF3"
                     /locus_tag="HHV4_LF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      complement(143706..143711)
                     /regulatory_class="TATA_box"
                     /gene="LF3"
                     /locus_tag="HHV4_LF3"
                     /experiment="experimental evidence, no additional details
                     recorded"
     ncRNA           145514..145534
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART21-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           145548..145569
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART21-3p"
                     /db_xref="GeneID:3783757"
     ncRNA           145998..146019
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART18-3p"
                     /db_xref="GeneID:3783757"
     ncRNA           146439..146460
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART7*"
                     /db_xref="GeneID:3783757"
     ncRNA           146475..146496
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART7"
                     /db_xref="GeneID:3783757"
     ncRNA           146772..146793
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART8"
                     /db_xref="GeneID:3783757"
     ncRNA           146807..146829
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART8*"
                     /db_xref="GeneID:3783757"
     ncRNA           146959..146980
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART9*"
                     /db_xref="GeneID:3783757"
     ncRNA           146997..147019
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART9"
                     /db_xref="GeneID:3783757"
     ncRNA           147203..147225
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /db_xref="GeneID:3783757"
     ncRNA           147321..147342
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART10*"
                     /db_xref="GeneID:3783757"
     ncRNA           147356..147378
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART10"
                     /db_xref="GeneID:3783757"
     ncRNA           147537..147560
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART11-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           147575..147595
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART11-3p"
                     /db_xref="GeneID:3783757"
     ncRNA           147936..147957
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART12"
                     /db_xref="GeneID:3783757"
     ncRNA           148215..148237
                     /ncRNA_class="piRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART19-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           148254..148274
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART19-3p"
                     /db_xref="GeneID:3783757"
     ncRNA           148339..148359
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART20-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           148374..148395
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART20-3p"
                     /db_xref="GeneID:3783757"
     ncRNA           148526..148547
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART13*"
                     /db_xref="GeneID:3783757"
     ncRNA           148563..148585
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART13"
                     /db_xref="GeneID:3783757"
     ncRNA           148744..148765
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART14*"
                     /db_xref="GeneID:3783757"
     ncRNA           148778..148799
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART14"
                     /db_xref="GeneID:3783757"
     gene            complement(149025..152641)
                     /gene="BILF1"
                     /locus_tag="HHV4_BILF1"
                     /note="gamma gene; GPCR family"
                     /db_xref="GeneID:3783707"
     gene            complement(149025..151694)
                     /gene="LF1"
                     /locus_tag="HHV4_LF1"
                     /note="betagamma gene; DURP family"
                     /db_xref="GeneID:3783747"
     gene            complement(149025..150417)
                     /gene="LF2"
                     /locus_tag="HHV4_LF2"
                     /note="betagamma gene; DURP family"
                     /db_xref="GeneID:3783748"
     regulatory      complement(149025..149030)
                     /regulatory_class="polyA_signal_sequence"
                     /inference="non-experimental evidence, no additional
                     details recorded"
                     /note="LF1, LF2 and BILF1"
     CDS             complement(149035..150324)
                     /gene="LF2"
                     /locus_tag="HHV4_LF2"
                     /codon_start=1
                     /product="virion protein G11"
                     /protein_id="YP_401708.1"
                     /db_xref="GeneID:3783748"
                     /translation="MAEAYPGGAHAALASRRSSFRNSLRRLRPTEKPDTSFMRGVWKY
                     EIFPSYVRVTNKQVLQLDAQCQELPPCPSVGQILSFKLPSFSFNTTTYGSRYFTVAFL
                     FFGAEDNEVFLKPFFVMHSDQDIVLSVLNPRSLFIEKGKFTWYIVPIRLVKNPYLYLQ
                     ILPGQSDIQLTRSCTQSGDKLNTSEPQIFLSGSPVTSQDECLPYLLAQHTPPFLKSYA
                     RIHTFPGKVCPVNAIRRGKGYVRVSVDTPDLKREGPLNVKVGMTLLDDVIIAFRYNPY
                     PKSHWRWDGESTDIRYFGSPVIIPPNFITELEYNNTYEAPLSSKITAVVVSHSSNPVF
                     YVYPQEWKPGQTLKLTVRNISNNPITIVTGQSMAQAFFIYAGDPSISTIMRRYIQRQG
                     CALTLPGNIVVESSSLPTFERINKTFNGNIVASEGTL"
     misc_feature    complement(149062..150315)
                     /gene="LF2"
                     /locus_tag="HHV4_LF2"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03365"
                     /db_xref="CDD:177602"
     CDS             complement(150285..151694)
                     /gene="LF1"
                     /locus_tag="HHV4_LF1"
                     /codon_start=1
                     /product="protein G10"
                     /protein_id="YP_401709.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ5"
                     /db_xref="GeneID:3783747"
                     /translation="MALQTDTQAWRVEIGTRGLMFSNCVPLHLPEGQYHKLRLPVSAY
                     EALAVARYGLVGSLWEVPAVNSALQCLAAAAPCKDVKIYPSCIFQVHAPMFVTIKTSL
                     RCLNPHDLCLCLICVGAAILDIPLLCAPRDGAGARAAEGQAAAAQGGKLRVWGRLSPS
                     SPTSLSLAFPYAGPPPVAWYRHSINLTRSEGVGIGKDCAQDHACPVPPQGHASSAADQ
                     AGVPERGRKRAHEGPGAGEAASAGRGDVALSQSRALLWRGLGWDTGRGRLAPGLAMSR
                     DAASGSVHLDIQVDRAEEGWVCDVLLEPGPPTAREGCSLSMDPGLVTLKDAWTLFPLH
                     PEHDAVVPPKEEIHVMAQGHLQGGTPSLWGFTFQEAACDQWVLRPRVWTAHSPIKMTV
                     YNCGHKPLHIGPSTRLGLALFWPAERSDNLDAGRIFYQLTSGELYWGRTVARPPTLTL
                     PVDELRPWPKLTPEEPMQH"
     misc_feature    complement(150378..151682)
                     /gene="LF1"
                     /locus_tag="HHV4_LF1"
                     /note="Herpesvirus dUTPase protein; Region: Herpes_ORF11;
                     pfam04797"
                     /db_xref="CDD:309783"
     CDS             join(150323..150348,155267..155552)
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein RPMS1"
                     /protein_id="YP_401710.1"
                     /db_xref="UniProtKB/TrEMBL:Q9Q2P0"
                     /db_xref="GeneID:3783757"
                     /translation="MAGARRRARCPASAGCAYSARPPPLSTRGRRISAGSGQPRWWPW
                     GSPPPPDTRYRRPGPGRRARSCLHAGPRGRPPHSRTRARRTSPGAGGGGWRGGSCTSQ
                     R"
     regulatory      complement(150412..150417)
                     /regulatory_class="TATA_box"
                     /gene="LF2"
                     /locus_tag="HHV4_LF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(151372..156288)
                     /gene="BALF5"
                     /locus_tag="HHV4_BALF5"
                     /note="core gene"
                     /db_xref="GeneID:3783681"
     CDS             complement(151703..152641)
                     /gene="BILF1"
                     /locus_tag="HHV4_BILF1"
                     /note="type 3 membrane protein; 7 transmembrane domains;
                     chemokine receptor; role in intracellular signalling"
                     /codon_start=1
                     /product="membrane protein BILF1"
                     /protein_id="YP_401711.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B2"
                     /db_xref="GeneID:3783707"
                     /translation="MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLL
                     VLLILLTLAGILFIIFVRKLVHRMDVWLIALLIELLLWVLGKMIQEFSSTGLCLLTQN
                     MMFLGLMCSVWTHLGMALEKTLALFSRTPKRTSHRNVCLYLMGVFCLVLLLIIILLIT
                     MGPDANLNRGPNMCREGPTKGMHTAVQGLKAGCYLLAAVLIVLLTVIIIWKLLRTKFG
                     RKPRLICNVTFTGLICAFSWFMLSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLAL
                     LLIILYAWSFSHFMDSLKNQVTVTARYFRRVPSQST"
     ncRNA           152747..152768
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART2-5p"
                     /db_xref="GeneID:3783757"
     ncRNA           152783..152806
                     /ncRNA_class="miRNA"
                     /gene="RPMS1"
                     /locus_tag="HHV4_RPMS1"
                     /product="ebv-miR-BART2-3p"
                     /db_xref="GeneID:3783757"
     CDS             complement(153241..156288)
                     /gene="BALF5"
                     /locus_tag="HHV4_BALF5"
                     /EC_number="2.7.7.7"
                     /note="role in DNA replication"
                     /codon_start=1
                     /product="DNA polymerase catalytic subunit"
                     /protein_id="YP_401712.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B1"
                     /db_xref="GeneID:3783681"
                     /translation="MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDV
                     RGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILET
                     VYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLD
                     VEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHPNSVCHVAT
                     WLQDKHGCRIFEANVDATRRFVLDNDFVTFGWYSCRRAIPRLQHRDSYAELEYDCEVG
                     DLSVRREDSSWPSYQALAFDIECLGEEGFPTATNEADLILQISCVLWSTGEEAGRYRR
                     ILLTLGTCEDIEGVEVYEFPSELDMLYAFFQLIRDLSVEIVTGYNVANFDWPYILDRA
                     RHIYSINPASLGKIRAGGVCEVRRPHDAGKGFLRANTKVRITGLIPIDMYAVCRDKLS
                     LSDYKLDTVARHLLGAKKEDVHYKEIPRLFAAGPEGRRRLGMYCVQDSALVMDLLNHF
                     VIHVEVAEIAKIAHIPCRRVLDDGQQIRVFSCLLAAAQKENFILPMPSASDRDGYQGA
                     TVIQPLSGFYNSPVLVVDFASLYPSIIQAHNLCYSTMITPGEEHRLAGLRPGEDYESF
                     RLTGGVYHFVKKHVHESFLASLLTSWLAKRKAIKKLLAACEDPRQRTILDKQQLAIKC
                     TCNAVYGFTGVANGLFPCLSIAETVTLQGRTMLERAKAFVEALSPANLQALAPSPDAW
                     APLNPEGQLRVIYGDTDSLFIECRGFSESETLRFADALAAHTTRSLFVAPISLEAEKT
                     FSCLMLITKKRYVGVLTDGKTLMKGVELVRKTACKFVQTRCRRVLDLVLADARVKEAA
                     SLLSHRPFQESFTQGLPVGFLPVIDILNQAYTDLREGRVPMGELCFSTELSRKLSAYK
                     STQMPHLAVYQKFVERNEELPQIHDRIQYVFVEPKGGVKGARKTEMAEDPAYAERHGV
                     PVAVDHYFDKLLQGAANILQCLFDNNSGAALSVLQNFTARPPF"
     misc_feature    complement(154912..155883)
                     /gene="BALF5"
                     /locus_tag="HHV4_BALF5"
                     /note="DNA polymerase family B, exonuclease domain;
                     Region: DNA_pol_B_exo1; pfam03104"
                     /db_xref="CDD:397292"
     misc_feature    complement(153307..154722)
                     /gene="BALF5"
                     /locus_tag="HHV4_BALF5"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:395085"
     gene            <155549..160531
                     /gene="A73"
                     /locus_tag="HHV4_A73"
                     /db_xref="GeneID:3783676"
     mRNA            join(<155549..156737,156846..156928,158625..158751,
                     159781..160531)
                     /gene="A73"
                     /locus_tag="HHV4_A73"
                     /note="BART mRNAS, of which RMPS1 and part of A73 are
                     included as representatives, are complex spliced
                     transcripts"
                     /db_xref="GeneID:3783676"
     gene            complement(156244..160908)
                     /gene="BALF3"
                     /locus_tag="HHV4_BALF3"
                     /note="core gene"
                     /db_xref="GeneID:3783679"
     gene            complement(156244..158912)
                     /gene="BALF4"
                     /locus_tag="HHV4_BALF4"
                     /note="core gene"
                     /db_xref="GeneID:3783680"
     regulatory      complement(156244..156249)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="BALF3 and BALF4"
     CDS             complement(156291..158864)
                     /gene="BALF4"
                     /locus_tag="HHV4_BALF4"
                     /note="type 1 membrane protein; possible membrane fusogen;
                     binds cell surface heparan sulphate; role in cell entry;
                     role in cell-to-cell spread"
                     /codon_start=1
                     /product="envelope glycoprotein B"
                     /protein_id="YP_401713.1"
                     /db_xref="UniProtKB/TrEMBL:Q777B0"
                     /db_xref="GeneID:3783680"
                     /translation="MTRRRVLSVVVLLAALACRLGAQTPEQPAPPATTVQPTATRQQT
                     SFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKI
                     VTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRD
                     GVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSP
                     FDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAF
                     LDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGI
                     ELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLAT
                     VKNLTELTTPTSSPPSSPSPPAPSAARGSTPAAVLRRRRRDAGNATTPVPPTAPGKSL
                     GTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSS
                     IYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRVPGSETMCYSRPLVSFSFINDTK
                     TYEGQLGTDNEIFLTKKMTEVCQATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQT
                     FISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLDNAV
                     SNGRNQFVDGLGELMDSLGSVGQSITNLVSTVGGLFSSLVSGFISFFKNPFGGMLILV
                     LVAGVVILVISLTRRTRQMSQQPVQMLYPGIDELAQQHASGEGPGINPISKTELQAIM
                     LALHEQNQEQKRAAQRAAGPSVASRALQAARDRFPGLRRRRYHDPETAAALLGEAETE
                     F"
     misc_feature    complement(156345..158795)
                     /gene="BALF4"
                     /locus_tag="HHV4_BALF4"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     CDS             join(156652..156737,156846..156928,158625..158751,
                     159781..159865)
                     /gene="A73"
                     /locus_tag="HHV4_A73"
                     /note="questionable whether a protein function is encoded"
                     /codon_start=1
                     /product="protein A73"
                     /protein_id="YP_401714.1"
                     /db_xref="UniProtKB/TrEMBL:Q9Q2P1"
                     /db_xref="GeneID:3783676"
                     /translation="MSMPPKGFLKKEMKPETRLLNKPPTVLTRPAMFCAWKLYSRKMP
                     SRSKTLEARCSSRPPCDSPACQTRDTGCPRRSGTGRRGWRARRLGKESWFADAWRMAR
                     YWGCAVKAAAQSAFSASTASPEEL"
     CDS             complement(158851..160908)
                     /gene="BALF3"
                     /locus_tag="HHV4_BALF3"
                     /note="role in DNA encapsidation"
                     /codon_start=1
                     /product="DNA packaging terminase subunit 2"
                     /protein_id="YP_401715.3"
                     /db_xref="UniProtKB/TrEMBL:Q777A8"
                     /db_xref="GeneID:3783679"
                     /translation="MSGLLAAAYSQVYALAVELSVCTRLDPRSLDVAAVVRNAGLLAE
                     LEAILLPRLRRQNDRACSALSLELVHLLENSREASAALLAPGRKGTRVPPLRTPSVAY
                     SVEFYGGHKVDVSLCLINDIEILMKRINSVFYCMSHTMGLESLERALDLLGRFRGVSP
                     IPDPRLYITSVPCWRCVGELMVLPNHGNPSTAEGTHVSCNHLAVPVNPEPVSGLFENE
                     VRQAGLGHLLEAEEKARPGGPEEGAVPGPGRPEAEGATRALDTYNVFSTVPPEVAELS
                     ELLYWNSGGHAIGATGQGEGGGHSRLSALFARERRLALVRGACEEALAGARLTHLFDA
                     VAPGATERLFCGGVYSSSGDAVEALKADCAAAFTAHPQYRAILQKRNELYTRLNRAMQ
                     RLGRGEEEASRESPEVPRPAGAREPGPSGALSDALKRKEQYLRQVATEGLAKLQSCLA
                     QQSETLTETLCLRVWGDVVYWELARMRNHFLYRRAFVSGPWEDRRAGEGAAFENSKYI
                     KTHLFTQTLSSEHLHALTHSLYTFITGPLAEESGLFPPPSNVALARCCDAAGTLPHQK
                     AFLTSLIWPGIEPSDWIETSFNSFYSVPGGSLASSQQILCRALREAVLTVSLYNKTWG
                     RSLILRRADAVSPGQALPPDGLYLTYDSDRPLILLYKGRGWVFKDLYALLYLHLQMRD
                     DSA"
     misc_feature    complement(159100..160905)
                     /gene="BALF3"
                     /locus_tag="HHV4_BALF3"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     regulatory      complement(158907..158912)
                     /regulatory_class="TATA_box"
                     /gene="BALF4"
                     /locus_tag="HHV4_BALF4"
                     /experiment="experimental evidence, no additional details
                     recorded"
     gene            <159121..160536
                     /gene="BARF0"
                     /locus_tag="HHV4_BARF0"
                     /db_xref="GeneID:3783682"
     CDS             <159121..160536
                     /gene="BARF0"
                     /locus_tag="HHV4_BARF0"
                     /trans_splicing
                     /note="it is questionable whether a protein function is
                     encoded"
                     /codon_start=1
                     /product="protein BARF0"
                     /protein_id="YP_401716.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ4"
                     /db_xref="GeneID:3783682"
                     /translation="APGYAVEAVEGGLYPVARLDAWPYQGSQECLLVGQRTCGVTAAS
                     QGHVAGWGKEPALLRQGPRDEGVQAVRQRVQVLRAQGLGKQVCFDVLGILKGGTLAGA
                     PVLPGTRDEGPSVEEVVAHAGQLPVDHVPPDAQAQGLGQGLALLRQAGLQLGQTLGGH
                     LAQVLLLALERVREGAGRAGLSCPSRPGHLRALPGRLLLASAQPLHGSVEPRVQLVPL
                     LQDGPVLGVRREGGGAVRLQRLHRVARGAVDPAAEEPLRGPGSHGVKQVSQPCPRQRL
                     LAGPPHQGQATLPGKQGREAGMAATLPLPRCTDSMAARVPIEELRELRHLRGHCREDV
                     VGVQRSGRPLCLRPPRARDRALLWAARPRLLLSLQQVPEPRLADFILKQSRDRLRIHR
                     HRQVVTGDVGPLCRGRVAVVGQNHQLAHTAPAGHRGDVEARVWDGTYAPKAAQQIQGP
                     FQALQPHGVRHAIKHAIDSLH"
     regulatory      160508..160513
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="RPMS1 and A73"
     gene            complement(160550..164356)
                     /gene="BALF2"
                     /locus_tag="HHV4_BALF2"
                     /note="core gene"
                     /db_xref="GeneID:3783678"
     regulatory      complement(160550..160555)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BALF2"
                     /locus_tag="HHV4_BALF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(160926..164312)
                     /gene="BALF2"
                     /locus_tag="HHV4_BALF2"
                     /note="contains a zinc-finger; role in DNA replication;
                     role possibly in gene regulation"
                     /codon_start=1
                     /product="single-stranded DNA-binding protein"
                     /protein_id="YP_401717.1"
                     /db_xref="UniProtKB/TrEMBL:Q777A7"
                     /db_xref="GeneID:3783678"
                     /translation="MQGAQTSEDNLGSQSQPGPCGYIYFYPLATYPLREVATLGTGYA
                     GHRCLTVPLLCGITVEPGFSINVKALHRRPDPNCGLLRATSYHRDIYVFHNAHMVPPI
                     FEGPGLEALCGETREVFGYDAYSALPRESSKPGDFFPEGLDPSAYLGAVAITEAFKER
                     LYSGNLVAIPSLKQEVAVGQSASVRVPLYDKEVFPEGVPQLRQFYNSDLSRCMHEALY
                     TGLAQALRVRRVGKLVELLEKQSLQDQAKVAKVAPLKEFPASTISHPDSGALMIVDSA
                     ACELAVSYAPAMLEASHETPASLNYDSWPLFADCEGPEARVAALHRYNASLAPHVSTQ
                     IFATNSVLYVSGVSKSTGQGKESLFNSFYMTHGLGTLQEGTWDPCRRPCFSGWGGPDV
                     TGTNGPGNYAVEHLVYAASFSPNLLARYAYYLQFCQGQKSSLTPVPETGSYVAGAAAS
                     PMCSLCEGRAPAVCLNTLFFRLRDRFPPVMSTQRRDPYVISGASGSYNETDFLGNFLN
                     FIDKEDDGQRPDDEPRYTYWQLNQNLLERLSRLGIDAEGKLEKEPHGPRDFVKMFKDV
                     DAAVDAEVVQFMNSMAKNNITYKDLVKSCYHVMQYSCNPFAQPACPIFTQLFYRSLLT
                     ILQDISLPICMCYENDNPGLGQSPPEWLKGHYQTLCTNFRSLAIDKGVLTAKEAKVVH
                     GEPTCDLPDLDAALQGRVYGRRLPVRMSKVLMLCPRNIKIKNRVVFTGENAALQNSFI
                     KSTTRRENYIINGPYMKFLNTYHKTLFPDTKLSSLYLWHNFSRRRSVPVPSGASAEEY
                     SDLALFVDGGSRAHEESNVIDVVPGNLVTYAKQRLNNAILKACGQTQFYISLIQGLVP
                     RTQSVPARDYPHVLGTRAVESAAAYAEATSSLTATTVVCAATDCLSQVCKARPVVTLP
                     VTINKYTGVNGNNQIFQAGNLGYFMGRGVDRNLLQAPGAGLRKQAGGSSMRKKFVFAT
                     PTLGLTVKRRTQAATTYEIENIRAGLEAIISQKQEEDCVFDVVCNLVDAMGEACASLT
                     RDDAEYLLGRFSVLADSVLETLATIASSGIEWTAEAARDFLEGVWGGPGAAQDNFISV
                     AEPVSTASQASAGLLLGGGGQGSGGRRKRRLATVLPGLEV"
     misc_feature    complement(161013..164297)
                     /gene="BALF2"
                     /locus_tag="HHV4_BALF2"
                     /note="single-stranded DNA binding protein; Provisional;
                     Region: PHA03367"
                     /db_xref="CDD:223059"
     variation       163520..166177
                     /note="deletion in Raji"
                     /citation=[3]
     regulatory      complement(164351..164356)
                     /regulatory_class="TATA_box"
                     /gene="BALF2"
                     /locus_tag="HHV4_BALF2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            complement(164388..164984)
                     /gene="BALF1"
                     /locus_tag="HHV4_BALF1"
                     /note="gamma gene; Bcl-2 family"
                     /db_xref="GeneID:3783677"
     regulatory      complement(164388..164393)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BALF1"
                     /locus_tag="HHV4_BALF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(164397..164945)
                     /gene="BALF1"
                     /locus_tag="HHV4_BALF1"
                     /note="role in apoptosis"
                     /codon_start=1
                     /product="apoptosis regulator BALF1"
                     /protein_id="YP_401718.3"
                     /db_xref="UniProtKB/TrEMBL:Q777A6"
                     /db_xref="GeneID:3783677"
                     /translation="MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF
                     TRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYN
                     DHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
                     SLRRQFPVTWALASLTDFLKSL"
     misc_feature    complement(164400..164945)
                     /gene="BALF1"
                     /locus_tag="HHV4_BALF1"
                     /note="BALF1 protein; Region: BALF1; pfam06861"
                     /db_xref="CDD:115513"
     regulatory      complement(164979..164984)
                     /regulatory_class="TATA_box"
                     /gene="BALF1"
                     /locus_tag="HHV4_BALF1"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     gene            165008..165712
                     /gene="BARF1"
                     /locus_tag="HHV4_BARF1.2"
                     /db_xref="GeneID:3783772"
     regulatory      165008..165013
                     /regulatory_class="TATA_box"
                     /gene="BARF1"
                     /locus_tag="HHV4_BARF1.2"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             165046..165711
                     /gene="BARF1"
                     /locus_tag="HHV4_BARF1.2"
                     /note="secreted glycoprotein; contains 2 Ig domains;
                     structurally similar to CD80; binds to CSF-1; role in
                     transformation"
                     /codon_start=1
                     /product="protein BARF1"
                     /protein_id="YP_401719.1"
                     /db_xref="UniProtKB/TrEMBL:Q777A5"
                     /db_xref="GeneID:3783772"
                     /translation="MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEI
                     EVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNY
                     LCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLM
                     PEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGY
                     LSQ"
     misc_feature    165046..165708
                     /gene="BARF1"
                     /locus_tag="HHV4_BARF1.2"
                     /note="BARF1; Provisional; Region: PHA03376"
                     /db_xref="CDD:177613"
     regulatory      165707..165712
                     /regulatory_class="polyA_signal_sequence"
                     /gene="BARF1"
                     /locus_tag="HHV4_BARF1.2"
                     /experiment="experimental evidence, no additional details
                     recorded"
     regulatory      166012..166017
                     /regulatory_class="TATA_box"
                     /gene="LMP-2A"
                     /locus_tag="HHV4_LMP-2A"
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            166040..166458
                     /gene="LMP-2A"
                     /locus_tag="HHV4_LMP-2A"
                     /note="LMP-2A first exon"
     gene            complement(166483..169088)
                     /gene="LMP-1"
                     /locus_tag="HHV4_LMP-1"
                     /db_xref="GeneID:3783750"
     mRNA            complement(join(166483..168507,168584..168670,
                     168749..169056))
                     /gene="LMP-1"
                     /locus_tag="HHV4_LMP-1"
                     /db_xref="GeneID:3783750"
     gene            complement(166483..167067)
                     /gene="BNLF2a"
                     /locus_tag="HHV4_BNLF2a"
                     /db_xref="GeneID:3783720"
     gene            complement(166483..166836)
                     /gene="BNLF2b"
                     /locus_tag="HHV4_BNLF2b"
                     /db_xref="GeneID:3783721"
     regulatory      complement(166483..166488)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="LMP-1, BNLF2a and BNLF2b"
     regulatory      complement(166487..166492)
                     /regulatory_class="polyA_signal_sequence"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="LMP-1, BNLF2a and BNLF2b"
     CDS             complement(166540..166836)
                     /gene="BNLF2b"
                     /locus_tag="HHV4_BNLF2b"
                     /codon_start=1
                     /product="protein BNLF2b"
                     /protein_id="YP_401720.3"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ3"
                     /db_xref="GeneID:3783721"
                     /translation="MRPGRPLAGFYATLRRSFRRMSKRSKNKAKKERVPVEDRPPTPM
                     PTSQRLIRRNALGGGVRPDAEDCIQRFHPLEPALGVSTKNFDLLSLRCELGWCG"
     CDS             complement(166846..167028)
                     /gene="BNLF2a"
                     /locus_tag="HHV4_BNLF2a"
                     /codon_start=1
                     /product="protein BNLF2a"
                     /protein_id="YP_401721.1"
                     /db_xref="UniProtKB/TrEMBL:Q8AZJ2"
                     /db_xref="GeneID:3783720"
                     /translation="MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLL
                     LVVLCVLFGLLCLLLI"
     regulatory      complement(167062..167067)
                     /regulatory_class="TATA_box"
                     /gene="BNLF2a"
                     /locus_tag="HHV4_BNLF2a"
                     /inference="non-experimental evidence, no additional
                     details recorded"
     CDS             complement(join(167702..168507,168584..168670,
                     168749..169016))
                     /gene="LMP-1"
                     /locus_tag="HHV4_LMP-1"
                     /note="role in intracellular signalling; role in latency"
                     /codon_start=1
                     /product="latent membrane protein LMP-1"
                     /protein_id="YP_401722.1"
                     /db_xref="UniProtKB/TrEMBL:Q777A4"
                     /db_xref="GeneID:3783750"
                     /translation="MEHDLERGPPGPRRPPRGPPLSSSLGLALLLLLLALLFWLYIVM
                     SDWTGGALLVLYSFALMLIIIILIIFIFRRDLLCPLGALCILLLMITLLLIALWNLHG
                     QALFLGIVLFIFGCLLVLGIWIYLLEMLWRLGATIWQLLAFFLAFFLDLILLIIALYL
                     QQNWWTLLVDLLWLLLFLAILIWMYYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSN
                     SNEGRHHLLVSGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPH
                     DPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHSPSDSAGNDGGPPQLTEEVENKGGDQ
                     GPPLMTDGGGGHSHDSGHGGGDPHLPTLLLGSSGSGGDDDDPHGPVQLSYYD"
     misc_feature    complement(join(167705..168507,168584..168670,
                     168749..169016))
                     /gene="LMP-1"
                     /locus_tag="HHV4_LMP-1"
                     /note="Herpesvirus latent membrane protein 1 (LMP1);
                     Region: Herpes_LMP1; pfam05297"
                     /db_xref="CDD:283060"
     misc_feature    complement(167963..>168106)
                     /gene="LMP-1"
                     /locus_tag="HHV4_LMP-1"
                     /note="hypothetical protein; Provisional; Region:
                     PHA02644"
                     /db_xref="CDD:165026"
     repeat_region   167941..168116
                     /gene="LMP-2A"
                     /locus_tag="HHV4_LMP-2A"
                     /rpt_unit_range=167941..167973
     regulatory      complement(168738..168743)
                     /regulatory_class="TATA_box"
                     /gene="LMP-1"
                     /locus_tag="HHV4_LMP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
                     /note="lytic LMP-1"
     regulatory      complement(169083..169088)
                     /regulatory_class="TATA_box"
                     /gene="LMP-1"
                     /locus_tag="HHV4_LMP-1"
                     /experiment="experimental evidence, no additional details
                     recorded"
     exon            169294..169448
                     /gene="LMP-2B"
                     /locus_tag="HHV4_LMP-2B"
                     /note="LMP-2B first exon"
     repeat_region   169636..171772
                     /gene="LMP-2B"
                     /locus_tag="HHV4_LMP-2B"
                     /rpt_family="TR"
                     /rpt_type=direct
                     /rpt_unit_range=169636..170173
     repeat_region   169636..170173
                     /rpt_family="TR"
                     /rpt_type=direct
     repeat_region   170174..170696
                     /rpt_family="TR"
                     /rpt_type=direct
     repeat_region   170697..171234
                     /rpt_family="TR"
                     /rpt_type=direct
     repeat_region   171235..171772
                     /rpt_family="TR"
                     /rpt_type=direct
ORIGIN      
        1 agaattcgtc ttgctctatt cacccttact tttcttcttg cccgttctct ttcttagtat
       61 gaatccagta tgcctgcctg taattgttgc gccctacctc ttttggctgg cggctattgc
      121 cgcctcgtgt ttcacggcct cagttagtac cgttgtgacc gccaccggct tggccctctc
      181 acttctactc ttggcagcag tggccagctc atatgccgct gcacaaagga aactgctgac
      241 accggtgaca gtgcttactg cggttgtcac ttgtgagtac acacgcacca tttacaatgc
      301 atgatgttcg tgagattgat ctgtctctaa cagttcactt cctctgcttt tctcctcagt
      361 ctttgcaatt tgcctaacat ggaggattga ggacccacct tttaattctc ttctgtttgc
      421 attgctggcc gcagctggcg gactacaagg catttacggt tagtgtgcct ctgttatgaa
      481 atgcaggttt gacttcatat gtatgccttg gcatgacgtc aactttactt ttatttcagt
      541 tctggtgatg cttgtgctcc tgatactagc gtacagaagg agatggcgcc gtttgactgt
      601 ttgtggcggc atcatgtttt tggcatgtgt acttgtcctc atcgtcgacg ctgttttgca
      661 gctgagtccc ctccttggag ctgtaactgt ggtttccatg acgctgctgc tactggcttt
      721 cgtcctctgg ctctcttcgc cagggggcct aggtactctt ggtgcagccc ttttaacatt
      781 ggcagcaggt aagccacacg tgtgacattg cttgcctttt tgccacatgt tttctggaca
      841 caggactaac catgccatct ctgattatag ctctggcact gctagcgtca ctgattttgg
      901 gcacacttaa cttgactaca atgttccttc tcatgctcct atggacactt ggtaagtttt
      961 cccttccttt aactcattac ttgttctttt gtaatcgcag ctctaacttg gcatctcttt
     1021 tacagtggtt ctcctgattt gctcttcgtg ctcttcatgt ccactgagca agatccttct
     1081 ggcacgactg ttcctatatg ctctcgcact cttgttgcta gcctccgcgc taatcgctgg
     1141 tggcagtatt ttgcaaacaa acttcaagag tttaagcagc actgaattta tacccagtga
     1201 gtatctattt gttactcctg tttagttgaa gaaaacaagc tattggattg taacacacat
     1261 tttacgcttt gttccttaga tttgttctgc atgttattac tgattgtcgc tggcatactc
     1321 ttcattcttg ctatcctgac cgaatggggc agtggaaata gaacatacgg tccagttttt
     1381 atgtgcctcg gtggcctgct caccatggta gccggcgctg tgtggctgac ggtgatgtct
     1441 aacacgcttt tgtctgcctg gattcttaca gcaggattcc tgattttcct cattggtaag
     1501 tgtgacacca acaggtgttg ccttgttatg tcaccgttct gacacatgac ttacatgggt
     1561 ttggcttttg taggctttgc cctctttggg gtcattagat gctgccgcta ctgctgctac
     1621 tactgcctta cactggaaag tgaggagcgc ccaccgaccc catatcgcaa cactgtataa
     1681 aggtaagtat tattaaattt tagagacact atcacgtgta acttgacgtg caaggatgga
     1741 agagaggggc agggaaacgc aaatgccggt tgcccggtat gggggcccgt ttattatggt
     1801 aaggctcttc gggcaagatg gagaggcaaa catacaggag gaaaggctat atgagctact
     1861 ctctgaccca cgctccgcgc tcggcctaga cccggggccc ctgattgctg agaacctgct
     1921 gctagtggcg ctgcgtggca ccaacaacga tcccaggcct cagcgtcagg agagggccag
     1981 agaactggcc ctcgttggca ttctactagg aaacggcgag cagggtgaac acttgggcac
     2041 ggagagtgcc ctggaggcct caggcaacaa ctatgtgtat gcctacggac cagactggat
     2101 ggcaaggcct tccacatggt ccgcggaaat ccagcaattc ctgcgactcc tgggcgccac
     2161 gtacgtgctt cgcgtggaga tgggcaggca gtttggcttc gaggtgcata gaagccggcc
     2221 ctccttccgt cagttccagg ccatcaatca ccttgtcctg tttgacaacg cccttcgcaa
     2281 gtacgattcc ggccaggtgg cggcgggctt ccagagggcc cttctggtgg ccgggccaga
     2341 gaccgctgac acgaggccgg acctccgcaa gctgaatgag tgggtgtttg gtggcagggc
     2401 tgctggtggc agacagctgg ccgacgagct aaagatcgtg tccgcgctgc gagacactta
     2461 ctcgggccac ttggtccttc agcccacgga gacccttgac acatggaagg tgttgagcag
     2521 ggacacacga accgctcata gtttggagca cggattcatt catgccgcgg ggaccatcca
     2581 ggccaactgc ccacagctgt ttatgagacg ccagcacccc ggcctctttc ccttcgttaa
     2641 tgcaatagca tcatcgctgg gctggtacta ccagaccgcc accggccccg gagcagatgc
     2701 cagggcggcg gcccggcgcc aacaggcctt tcagaccagg gcggcggctg aatgccatgc
     2761 caaaagcggg gtgccggtcg tggccggctt ctacaggacc atcaacgcca cgctcaaggg
     2821 aggagagggc ctacagccca ctatgtttaa cggggagctg ggggccatca agcaccaggc
     2881 acttgacact gtgaggtatg actacggcca ctatctcata atgttggggc cattccagcc
     2941 atggagcgga ctgacggccc ctccgtgccc ctacgccgaa agttcatggg cacaggcggc
     3001 cgtgcagacg gccctcgagc tgttctcggc cctgtacccg gccccgtgca tctcgggcta
     3061 cgcgcgcccc ccgggcccca gtgctgtgat cgagcatctg gggtccctag ttccaaaggg
     3121 gggtctgctg ttgtttctgt ctcacctacc ggatgatgtt aaggacgggc tcggagaaat
     3181 ggggccggcc agggccacgg gacctggaat gcagcagttt gtcagcagct acttcctcaa
     3241 ccccgcctgt tccaacgtct tcattacagt gaggcagcga ggggagaaga tcaacggccg
     3301 taccgtcctc caagcgctcg gacgcgcatg cgatatggca ggctgccagc actatgtgct
     3361 gggctccacg gttcccctcg gtggactcaa ctttgtcaac gacctggcgt ccccggtttc
     3421 caccgccgag atgatggatg atttctctcc cttcttcacc gtggagtttc ccccgattca
     3481 agaggagggc gcaagttctc cggtaccctt agatgtggac gagagcatgg acatctctcc
     3541 gtcttacgag ttgccctggc tctcgctgga gtcatgcctc acaagcatcc tgtcacaccc
     3601 caccgtggga agcaaggagc acttggtcag gcacacggac agggtcagcg gaggacgcgt
     3661 ggcacagcag cccggggtag gtcccctgga cctgccgctg gcggactacg ccttcgttgc
     3721 ccacagtcag gtctggacca ggcccggtgg ggctcctccc ttgccctatc gtacctggga
     3781 tcgaatgaca gagaagctgc ttgtctccgc aaaacccggc ggagagaacg ttaaggtttc
     3841 aggtaccgtg attacattgg gagaacaggg gtacaaagtg tcgttggatc tgagggaggg
     3901 aaccaggctg gcaatggctg aggcgctgct gaacgcagca tgtgccccaa tcttggatcc
     3961 ggaagacgtc ttgctcaccc tgcatctaca cctggatccg cgccgggcag acaactcggc
     4021 cgtgatggag gctatgacgg cggcgagtga ctacgcgcgt ggcctgggcg tgaagctgac
     4081 ctttggctcg gcctcctgcc ccgagaccgg ctcgtccgcc tccaacttca tgaccgtggt
     4141 ggcctctgtc tccgccccag gggaattctc gggtcctctg atcacgccag tgcttcagaa
     4201 gacgggcagt ctcctgattg cggtgcgttg cggggatggc aagatccagg gagggtcgct
     4261 gtttgagcag ctctttagcg acgtggccac gaccccacgg gcacccgagg cgttgtctct
     4321 gaagaatctc ttccgggcag tccagcagct ggtcaagagc ggcatcgtgc tgtcagggca
     4381 tgacatcagc gacgggggcc tggtgacctg cctggtggag atggccctgg ccgggcagcg
     4441 gggagtgacc atcactatgc cggtggcctc cgactacctc ccggagatgt ttgcagagca
     4501 ccccggcctg gtgtttgagg tggaggagcg cagcgtgggt gaggtgctgc agaccctgcg
     4561 ctccatgaac atgtacccgg cagtcctcgg tcgagtgggc gagcaaggtc cagatcaaat
     4621 gtttgaggtg cagcacggcc cagagacggt gttgcgccag tcgctgcgcc tgctgctggg
     4681 aacctggtca tcctttgcca gcgagcagta cgagtgcctg cgaccagatc ggattaaccg
     4741 gtccatgcac gtgtccgact acggctataa cgaagcactg gcagtctccc cgttgacagg
     4801 aaagaatctc agcccacgcc ggttggtgac agagcctgac ccacgatgtc aggtggccgt
     4861 gctatgcgcc ccgggcacca ggggccatga aagcctcctg gcggccttca cgaatgccgg
     4921 atgcctgtgc cgacgggtgt tctttcgcga ggttagggac aacacgttcc tcgacaagta
     4981 cgtgggtctg gccatcggag gagttcatgg ggccagggac tctgccctgg caggccgtgc
     5041 caccgtggcg ctgattaatc gtttccccgc cctgcgtgac gctattctaa agttcctcaa
     5101 caggccagat acgttctcgg tggccttggg ggagctgggg gtgcaagttt tggctggcct
     5161 gggggccgtg gggtcaacag ataatccacc cgcccctggc gtggaagtta atgtccagag
     5221 atcacctctg attctggccc ccaacgcctc tggcatgttt gagtcccgct ggctgaacat
     5281 tagcatcccg gcgaccacca gctctgtcat gctgcgtggc ctccggggct gcgtcctgcc
     5341 ttgttgggtg caaggctcgt gcctgggcct gcaatttact aacctcggga tgccatatgt
     5401 tttgcagaat gcccaccaga tcgcctgcca cttccacagc aatggcacgg atgcctggcg
     5461 ctttgctatg aattatccaa gaaaccccac ggagcagggc aacattgcag ggctctgttc
     5521 acgcgatggt cgtcatctgg ctctcctgtg tgacccctca ctttgtacag acttttggca
     5581 atgggagcac attccccccg cctttgggca ccccacgggg tgctccccct ggacacttat
     5641 gtttcaagca gctcacctat ggtcactcag gcacggtcgc ccctccgagt gaccagtcac
     5701 cttccagact atgcatacac tgaatttagc ctgatattgt ccccctagcc ccgggcccag
     5761 ccctcctcag aaaactctgc atggagaagc tggacgtgaa cctccccccc agacctgtgt
     5821 gctgtattta caaacactac aataaaccca atgtgcaaat gtggtttgta tggctacttt
     5881 gtgttcctaa aaaatgcaac aatagaagtg gaaaccctca gtcacgggac attaacctca
     5941 accacaaaat gggggttgga gaaagtaacc acatatactg gagatgattc atgggctggg
     6001 ggttcccgga caatacaccc atctggagtt caacctaatt acatggtaga taaattaaga
     6061 gtccctcctc accactcgaa actatggcag acattctata agataacgag gagagatgag
     6121 gtgagggcag aggacattgg gcaggtgtgg gccacggggc agctggccat atcccccgca
     6181 ctacagaagt gtaagcaaag tgaagggctc ggaaggcagg cggggcctag caatgtcaca
     6241 gctaaatgcc caccagggca cacactcaag cggggtctcg gagctcctag gtcagaccac
     6301 gaaaggtcag cctgcaaggt ggatggcgtg ttttctgagg ttatccccgc tacgtgcagt
     6361 gctgggtgat agagacccta gaatgtgtcg aaatgaccaa gcgtccccgc agcggggctc
     6421 ccaacacggg ttcccagaga gggtaaaaga gggggccata aagcccaggg tgtaaaacac
     6481 cgaccgcgcc accagatggc acacgtgggg gaaatgaggg ttagcatagg caacccccgc
     6541 ctacacacca actatagcaa accccgcccc gtcacggtga cgtagtctgt cttgaggaga
     6601 tgtagacttg tagacactgc aaaacctcag gacctacgct gccctagagg ttttgctagg
     6661 gaggagacgt gtgtggctgt agccacccgt cccgggtaca agtcccgggt ggtgaggacg
     6721 gtgtctgtgg ttgtcttccc agactctgct ttctgccgtc ttcggtcaag taccagctgg
     6781 tggtccgcat gttttgatcc aaacttttgt tttaggattt atgcatccat tatcccgcag
     6841 ttccacctaa acggggctta acgttgcatc ccagaagatg cacgcttaac cccgcctaca
     6901 accgtgacgt agctgtttac cagcatgtat agagttacgg ttcgctacat caaacaggac
     6961 agccgttgcc ctagtggttt cggacacacc gccaacgctc agtgcggtgc taccgacccg
     7021 aggtcaagtc ccgggggagg agaagagagg cttcccgcct agagcatttg caagtcagga
     7081 ttctctaatc cctctgggag aagggtattc ggcttgtccg ctattttttt gtggctagtt
     7141 ttgcacccac aacatgtaag ggcccgctac ccctacaaca caaaacaaac tatctcccct
     7201 aaccatcctt ttgccaatca attctgtgac agggtttcct ggacacccag tcttagttca
     7261 ggtagacacc cagttatgca gtgccaccaa ttccaaccat ttttaaacct cctggaattc
     7321 tatcattaaa cggcatgcag gaaaaggaca agcagcgaaa attcacgccc ccttgggagg
     7381 tggcggcata tgcaaaggat agcactccca ctctactact gggtatcata tgctgactgt
     7441 atatgcatga ggatagcata tgctacccgg atacagatta ggatagcata tactacccag
     7501 atatagatta ggatagcata tgctacccag atatagatta ggatagccta tgctacccag
     7561 atataaatta ggatagcata tactacccag atatagatta ggatagcata tgctacccag
     7621 atatagatta ggatagccta tgctacccag atatagatta ggatagcata tgctacccag
     7681 atatagatta ggatagcata tgctatccag atatttgggt agtatatgct acccagatat
     7741 aaattaggat agcatatact accctaatct ctattaggat agcatatgct acccggatac
     7801 agattaggat agcatatact acccagatat agattaggat agcatatgct acccagatat
     7861 agattaggat agcctatgct acccagatat aaattaggat agcatatact acccagatat
     7921 agattaggat agcatatgct acccagatat agattaggat agcctatgct acccagatat
     7981 agattaggat agcatatgct atccagatat ttgggtagta tatgctaccc atggcaacat
     8041 tagcccaccg tgctctcagc gacctcgtga atatgaggac caacaaccct gtgcttggcg
     8101 ctcaggcgca agtgtgtgta atttgtcctc cagatcgcag caatcgcgcc cctatcttgg
     8161 cccgcccacc tacttatgca ggtattcccc ggggtgccat tagtggtttt gtgggcaagt
     8221 ggtttgaccg cagtggttag cggggttaca atcagccaag ttattacacc cttattttac
     8281 agtccaaaac cgcagggcgg cgtgtggggg ctgacgcgtg cccccactcc acaatttcaa
     8341 aaaaaagagt ggccacttgt ctttgtttat gggccccatt ggcgtggagc cccgtttaat
     8401 tttcgggggt gttagagaca accagtggag tccgctgctg tcggcgtcca ctctctttcc
     8461 ccttgttaca aatagagtgt aacaacatgg ttcacctgtc ttggtccctg cctgggacac
     8521 atcttaataa ccccagtatc atattgcact aggattatgt gttgcccata gccataaatt
     8581 cgtgtgagat ggacatccag tctttacggc ttgtccccac cccatggatt tctattgtta
     8641 aagatattca gaatgtttca ttcctacact agtatttatt gcccaagggg tttgtgaggg
     8701 ttatattggt gtcatagcac aatgccacca ctgaaccccc cgtccaaatt ttattctggg
     8761 ggcgtcacct gaaaccttgt tttcgagcac ctcacataca ccttactgtt cacaactcag
     8821 cagttattct attagctaaa cgaaggagaa tgaagaagca ggcgaagatt caggagagtt
     8881 cactgcccgc tccttgatct tcagccactg cccttgtgac taaaatggtt cactaccctc
     8941 gtggaatcct gaccccatgt aaataaaacc gtgacagctc atggggtggg agatatcgct
     9001 gttccttagg acccttttac taaccctaat tcgatagcat atgcttcccg ttgggtaaca
     9061 tatgctattg aattagggtt agtctggata gtatatacta ctacccggga agcatatgct
     9121 acccgtttag ggttaacaag ggggccttat aaacactatt gctaatgccc tcttgagggt
     9181 ccgcttatcg gtagctacac aggcccctct gattgacgtt ggtgtagcct cccgtagtct
     9241 tcctgggccc ctgggaggta catgtccccc agcattggtg taagagcttc agccaagagt
     9301 tacacataaa ggcaatgttg tgttgcagtc cacagactgc aaagtctgct ccaggatgaa
     9361 agccactcag tgttggcaaa tgtgcacatc catttataag gatgtcaact acagtcagag
     9421 aacccctttg tgtttggtcc ccccccgtgt cacatgtgga acagggccca gttggcaagt
     9481 tgtaccaacc aactgaaggg attacatgca ctgccccgcg ggaaatacgt cctacccagg
     9541 aacccgaaac agtgtttccc agaagctgta aaaatagaac gccctggaac tgccccactg
     9601 tgcaatgcag cttttagcca tgccatgctc tataaatcac ttccctatct caggtaggcc
     9661 tgcacacctt aggtatggag cgaaggttag tggtcactct gcagtgcctg gtgctgcttt
     9721 acctggcacc tgagtgtgga ggtacagacc aatgtgacaa ttttccccaa atgttgaggg
     9781 acctaagaga tgccttcagt cgtgttaaaa cctttttcca gacaaaggac gaggtagata
     9841 accttttgct caaggagtct ctgctagagg actttaaggg ctaccttgga tgccaggccc
     9901 tgtcagaaat gatccaattc tacctggagg aagtcatgcc acaggctgaa aaccaggacc
     9961 ctgaagccaa agaccatgtc aattctttgg gtgaaaatct aaagacccta cggctccgcc
    10021 tgcgcaggtg ccacaggttc ctgccgtgtg agaacaagag taaagctgtg gaacagataa
    10081 aaaatgcctt taacaagctg caggaaaaag gaatttacaa agccatgagt gaatttgaca
    10141 tttttattaa ctacatagaa gcatacatga caattaaagc caggtgataa ttccataccc
    10201 tggaagcagg agatgggtgc atttcacccc aaccccccct ttcgactgtc atttacaata
    10261 aaatgaaacc ttttattctt gattgcctct tgtgttcttg ccgcccaggt accttcctgt
    10321 gttctcccca cgggaaaaag aatagcttct gcagaaggcc attgacgcaa gttttgcccg
    10381 tggggattac ccgacccagc cacttacagc acattttgtt ctaggtccat cttaggagcc
    10441 cgggccagca ttctatcagc ttaacgggaa gagaagtggg gagggcactc gcccactaac
    10501 cttaacacct gcagcctaca aaagtacact agctgtttgc tctattcgcc actagagacc
    10561 gccaagatgc gaaactacag gcccgggccc aggccttgca gggcagacgg ttaggctgac
    10621 aaggggacaa gtgtggcagg tgggcgggaa ggggcacaag aatgccggcg aaactggacc
    10681 acggtccacc ccgccctcaa gcgtccggga gccgggcggc tcggctaagg agggcggcct
    10741 tgcgaacaat tattagtagc taccaacaag ggcccccaga tgccccccac cagtcacccg
    10801 gccgtgtcca ctcacatatt ccactcttat ttttaaatta atgtgtccca attagaaacc
    10861 caagcgcaga aattagttga gaggctagtg ttttaaacat gcaccctagg ccagccagag
    10921 ataatgtcac aagattatca agttggtgta aacacgccgt gggaaaaaat ttatggttca
    10981 gtgcgtcgag tgctatcttt ggaacagtag aaaattgaac cttgttggcg ggagaaggaa
    11041 taacgcctta tctgggagga gcgacggatt atagccaata agagagctca agacgcaggg
    11101 ctcgcaaagt atagtggccc cgtgggacct tagaggtgga gcaacgtcta aagtggtaat
    11161 aacaccaggc ggggctgggc aaaggggtcc tacgggcggg attaattacg ccttgcttac
    11221 gcaagctcag ttaattcgcc cacgacttga aaaatgtagc ccttaaccaa ttggcggccc
    11281 ctaagggggg gactaaggtc ccactacaaa aactctgtgt tctgctgcaa attttagatc
    11341 agatggcata gagacaagga caccgaagac ccccagagcc ctcatcgcag ggttcttacc
    11401 atgcggccat gtaggcccac ttaacactac aagacctacg cctctccatt catcatgtaa
    11461 cccacaaatc atctaaaccg taagtctaag ggcctcctga ggttttctca ggaggcccta
    11521 atgtataatt aatcatgcat ttgattttaa aaaagtaggt tacactcatt ttaggccaga
    11581 ctttatttgc agattaataa tttatgtgat tctccttccc tctaggactg aagaaacagc
    11641 ctcctgcacg tgagcatgta tctgaaataa ttattatgtc ataagtgtaa tgattagaaa
    11701 gtcataaacc cacttccctt tacatgaatc tgggcactga attttggggt acttctaaag
    11761 actaacgtgt tcgatttcgg ggtcacttcc ccttttataa gtgtgtgaac agtgatttca
    11821 gtaaaaccta agagatattt ggtgtcactt ccgcatttta agtttcagaa aattttaaaa
    11881 ttaaaattga aatttctctc aaaataattc caatgaaaac ttcaaagaat cttatgtatg
    11941 taattctttt gccccaaact gggcttcaga tgccttctat tgcactctca caaaaacatt
    12001 ctggacacat gtgccagacg cctgggcctc taaggccctc gggtccccct ggaccccggc
    12061 ctcagcaacc ctgctgctcc cctcctgcca ccccagcctc cccccctccc cgtccccctt
    12121 cgctcctgtt cctcccccgg tccccagtag ggccgcctgc ccccctgcac ccagtacctg
    12181 cccctcttgg ccacgcaccc cgggccaggc caccttagac ccggccaagc cccatccctg
    12241 aagacccagc ggccattctc tctggtaacg agcagagaag aagtagaggc ccgcggccat
    12301 tgggcccaga ttgagagacc agtccagggg cccgaggttg gagccagcgg gcacccgagg
    12361 tcccagcacc cggtccctcc ggggggcaga gacaggcagg gccccccggc agctggcccc
    12421 gaggaggcgc ccggagtggg gccggtcggc tgggctggcc gagcccgggt ctgggaggtc
    12481 tggggtggcg agcctgctgt ctcaggaggg gcctggctcc gccgggtggc cctggggtaa
    12541 gtctgggagg cagagggtcg gcctaggccc ggggaagtgg agggggatcg cccgggtctc
    12601 tgttggcaga gtccgggcga tcctctgaga ccctccgggc ccggacggtc gccctcagcc
    12661 ccccagacag accccagggt ctccaggcag ggtccggcat cttcaggggc agcaggctca
    12721 ccaccacagg ccccccagac ccgggtctcg gccagccgag ccgaccggcc ccgcgcctgg
    12781 cgcctcctcg gggccagccg ccggggttgg ttctgcccct ctctctgtcc ttcagaggaa
    12841 ccagggacct cgggcacccc agagcccctc gggcccgcct ccaggcgccc tcctggtctc
    12901 cgctcccctc tgagccccgt taaacccaaa gaatgtctga ggggagccac cctcggggcc
    12961 caggccccag agtccagagg tcaggggcac ctcagggtgc ctccccgggt cccaggccag
    13021 ccggagggac cccggcagcc cgggcggccc cagaggccgg ttcctcgccc cttccccggg
    13081 cttcagagcc caggatgtcc cccagaaggg accctaggcg tcccctctcc tcccctccag
    13141 gcccgagcct ctccctcgcg gagaggggcc tctttgggcc ctcaagtcca gccccaccga
    13201 gacccgagtg gcccggatcc ccccaccggc ccttctctct gtccccctgc tcctctccaa
    13261 ccttcgctcc accctagacc ccagcttctg gcctccccgg gtccaccagg ccagccggag
    13321 ggaccccggc agcccgggcg agtcgccttc cctctcccct ggcctctcct tcccgcctcc
    13381 cacccgagcc ccctcagctt gcctccccac cgggtccatc aggccggccg gagggacccc
    13441 ggcggcccgg tgtcagtccc ccctgcagcc gcccagtctc tgcctccagg caagggcgcc
    13501 agcttttctc cccccagcct gaggcccagt ctcctgtgca ctgtctgtaa agtccagcct
    13561 cccacgcccg tccacggctc ccgggcccag cctcgtccac ccctccccac ggtggacagg
    13621 ccctctgtcc acccgggcca tccccgcccc cctgtgtcca ccccagtccc gtccaggggg
    13681 gactttatgt gacccttggg cctggctccc catagactcc catgtaagcc tgcctcgagt
    13741 aggtgcctcc agagcccctt ttgcccccct ggcggcccag cccgaccccc gggcgccccc
    13801 aaactttgtc cagatgtcca ggggtccccg agggtgaggc ccagccccct cccgcccctg
    13861 tccactgccc cggtcccccc agaagccccc aaaagtagag gctcaggcca tgcgcgccct
    13921 gtcaccaggc ctgccaaaga gccagatcta aggccgggag aggcagcccc aaagcgggtg
    13981 cagtaacagg taatctctgg tagtgatttg gacccgaaat ctgacacttt agagctctgg
    14041 aggactttaa aactctaaaa atcaaaactt tagaggcgaa tgggcgccat tttgtcccca
    14101 cgcgcgcata atggcggacc taggcctaaa acccccagga agcgggtcta tggttggctg
    14161 cgctgctgct atctttagag gggaaaagag gaataagccc ccagacaggg gagtgggctt
    14221 gtttgtgact tcaccaaagg tcagggccca agggggttcg cgttgctagg ccaccttctc
    14281 agtccagcgc gtttacgtaa gccagacagc agccaattgt cagttctagg gagggggacc
    14341 actgcccctg gtataaagtg gtcctgcagc tatttctggt cgcatcagag cgccaggagt
    14401 ccacacaaat gtaagagggg gtcttctacc tctccctagc cctccgcccc ctccaaggac
    14461 tcgggcccag tttctaactt ttccccttcc ctccctcgtc ttgccctgcg cccggggcca
    14521 ccttcatcac cgtcgctgac tccgccatcc aagcctaggg gagaccgaag tgaaggccct
    14581 ggaccaaccc ggcccgggcc ccccggtatc gggccagagg taagtggact ttaatttttt
    14641 ctgctaagcc caacactcca ccacacccag gcacacacta cacacaccca cccgtctcag
    14701 ggtcccctcg gacagctcct aagaaggcac cggtcgccca gtcctaccag agggggccaa
    14761 gaacccagac gagtccgtag aagggtcctc gtccagcaag aagaggaggt ggtaagcggt
    14821 tcaccttcag gggtaagtaa cctgacctct ccagggctca cataaaggga ggcttagtat
    14881 acatgcttct tgcttttcac aggaacctgg gggctagtct gggtgggatt aggctgcctc
    14941 aagttgcatc agccagggct tcatgccctc ctcagttccc tagtccccgg gcttcaggcc
    15001 ccctccgtcc ccgtcctcca gagacccggg cttcaggccc tgcctctcct gttacccttt
    15061 tagaaccaca gcctggacac atgtgccaga cgccttggcc tctaaggccc tcgggtcccc
    15121 ctggaccccg gcctcagcaa ccctgctgct cccctcctgc caccccagcc tccccccctc
    15181 cccgtccccc ttcgctcctg atcctccccc ggtccccagt agggccgcct gcccccctgc
    15241 acccagtacc tgcccctctt ggccacgcac cccgggccag gccaccttag acccggccaa
    15301 gccccatccc tgaagaccca gcggccattc tctctggtaa cgagcagaga agaagtagag
    15361 gcccgcggcc attgggccca gattgagaga ccagtccagg ggcccgaggt tggagccagc
    15421 gggcacccga ggtcccagca cccggtccct ccggggggca gagacaggca gggccccccg
    15481 gcagctggcc ccgaggaggc gcccggagtg gggccggtcg gctgggctgg ccgagcccgg
    15541 gtctgggagg tctggggtgg cgagcctgct gtctcaggag gggcctggct ccgccgggtg
    15601 gccctggggt aagtctggga ggcagagggt cggcctaggc ccggggaagt ggagggggat
    15661 cgcccgggtc tctgttggca gagtccgggc gatcctctga gaccctccgg gcccggacgg
    15721 tcgccctcag ccccccagac agaccccagg gtctccaggc agggtccggc atcttcaggg
    15781 gcagcaggct caccaccaca ggccccccag acccgggtct cggccagccg agccgaccgg
    15841 ccccgcgcct ggcgcctcct cggggccagc cgccggggtt ggttctgccc ctctctctgt
    15901 ccttcagagg aaccagggac ctcgggcacc ccagagcccc tcgggcccgc ctccaggcgc
    15961 cctcctggtc tccgctcccc tctgagcccc gttaaaccca aagaatgtct gaggggagcc
    16021 accctcgggg cccaggcccc agagtccaga ggtcaggggc acctcagggt gcctccccgg
    16081 gtcccaggcc agccggaggg accccggcag cccgggcggc cccagaggcc ggttcctcgc
    16141 cccttccccg ggcttcagag cccaggatgt cccccagaag ggaccctagg cgtcccctct
    16201 cctcccctcc aggcccgagc ctctccctcg cggagagggg cctctttggg ccctcaagtc
    16261 cagccccacc gagacccgag tggcccggat ccccccaccg gcccttctct ctgtccccct
    16321 gctcctctcc aaccttcgct ccaccctaga ccccagcttc tggcctcccc gggtccacca
    16381 ggccagccgg agggaccccg gcagcccggg cgagtcgcct tccctctccc ctggcctctc
    16441 cttcccgcct cccacccgag ccccctcagc ttgcctcccc accgggtcca tcaggccggc
    16501 cggagggacc ccggcggccc ggtgtcagtc ccccctgcag ccgcccagtc tctgcctcca
    16561 ggcaagggcg ccagcttttc tccccccagc ctgaggccca gtctcctgtg cactgtctgt
    16621 aaagtccagc ctcccacgcc cgtccacggc tcccgggccc agcctcgtcc acccctcccc
    16681 acggtggaca ggccctctgt ccacccgggc catccccgcc cccctgtgtc caccccagtc
    16741 ccgtccaggg gggactttat gtgacccttg ggcctggctc cccatagact cccatgtaag
    16801 cctgcctcga gtaggtgcct ccagagcccc ttttgccccc ctggcggccc agcccgaccc
    16861 ccgggcgccc ccaaactttg tccagatgtc caggggtccc cgagggtgag gcccagcccc
    16921 ctcccgcccc tgtccactgc cccggtcccc ccagaagccc ccaaaagtag aggctcaggc
    16981 catgcgcgcc ctgtcaccag gcctgccaaa gagccagatc taaggccggg agaggcagcc
    17041 ccaaagcggg tgcagtaaca ggtaatctct ggtagtgatt tggacccgaa atctgacact
    17101 ttagagctct ggaggacttt aaaactctaa aaatcaaaac tttagaggcg aatgggcgcc
    17161 attttgtccc cacgcgcgca taatggcgga cctaggccta aaacccccag gaagcgggtc
    17221 tatggttggc tgcgctgctg ctatctttag aggggaaaag aggaataagc ccccagacag
    17281 gggagtgggc ttgtttgtga cttcaccaaa ggtcagggcc caagggggtt cgcgttgcta
    17341 ggccaccttc tcagtccagc gcgtttacgt aagccagaca gcagccaatt gtcagttcta
    17401 gggaggggga ccactgcccc tggtataaag tggtcctgca gctatttctg gtcgcatcag
    17461 agcgccagga gtccacacaa atgtaagagg gggtcttcta cctctcccta gccctccgcc
    17521 ccctccaagg actcgggccc agtttctaac ttttcccctt ccctccctcg tcttgccctg
    17581 cgcccggggc caccttcatc accgtcgctg actccgccat ccaagcctag gggagaccga
    17641 agtgaaggcc ctggaccaac ccggcccggg ccccccggta tcgggccaga ggtaagtgga
    17701 ctttaatttt ttctgctaag cccaacactc caccacaccc aggcacacac tacacacacc
    17761 cacccgtctc agggtcccct cggacagctc ctaagaaggc accggtcgcc cagtcctacc
    17821 agagggggcc aagaacccag acgagtccgt agaagggtcc tcgtccagca agaagaggag
    17881 gtggtaagcg gttcaccttc aggggtaagt aacctgacct ctccagggct cacataaagg
    17941 gaggcttagt atacatgctt cttgcttttc acaggaacct gggggctagt ctgggtggga
    18001 ttaggctgcc tcaagttgca tcagccaggg cttcatgccc tcctcagttc cctagtcccc
    18061 gggcttcagg ccccctccgt ccccgtcctc cagagacccg ggcttcaggc cctgcctctc
    18121 ctgttaccct tttagaacca cagcctggac acatgtgcca gacgccttgg cctctaaggc
    18181 cctcgggtcc ccctggaccc cggcctcagc aaccctgctg ctcccctcct gccaccccag
    18241 cctccccccc tccccgtccc ccttcgctcc tgatcctccc ccggtcccca gtagggccgc
    18301 ctgcccccct gcacccagta cctgcccctc ttggccacgc accccgggcc aggccacctt
    18361 agacccggcc aagccccatc cctgaagacc cagcggccat tctctctggt aacgagcaga
    18421 gaagaagtag aggcccgcgg ccattgggcc cagattgaga gaccagtcca ggggcccgag
    18481 gttggagcca gcgggcaccc gaggtcccag cacccggtcc ctccgggggg cagagacagg
    18541 cagggccccc cggcagctgg ccccgaggag gcgcccggag tggggccggt cggctgggct
    18601 ggccgagccc gggtctggga ggtctggggt ggcgagcctg ctgtctcagg aggggcctgg
    18661 ctccgccggg tggccctggg gtaagtctgg gaggcagagg gtcggcctag gcccggggaa
    18721 gtggaggggg atcgcccggg tctctgttgg cagagtccgg gcgatcctct gagaccctcc
    18781 gggcccggac ggtcgccctc agccccccag acagacccca gggtctccag gcagggtccg
    18841 gcatcttcag gggcagcagg ctcaccacca caggcccccc agacccgggt ctcggccagc
    18901 cgagccgacc ggccccgcgc ctggcgcctc ctcggggcca gccgccgggg ttggttctgc
    18961 ccctctctct gtccttcaga ggaaccaggg acctcgggca ccccagagcc cctcgggccc
    19021 gcctccaggc gccctcctgg tctccgctcc cctctgagcc ccgttaaacc caaagaatgt
    19081 ctgaggggag ccaccctcgg ggcccaggcc ccagagtcca gaggtcaggg gcacctcagg
    19141 gtgcctcccc gggtcccagg ccagccggag ggaccccggc agcccgggcg gccccagagg
    19201 ccggttcctc gccccttccc cgggcttcag agcccaggat gtcccccaga agggacccta
    19261 ggcgtcccct ctcctcccct ccaggcccga gcctctccct cgcggagagg ggcctctttg
    19321 ggccctcaag tccagcccca ccgagacccg agtggcccgg atccccccac cggcccttct
    19381 ctctgtcccc ctgctcctct ccaaccttcg ctccacccta gaccccagct tctggcctcc
    19441 ccgggtccac caggccagcc ggagggaccc cggcagcccg ggcgagtcgc cttccctctc
    19501 ccctggcctc tccttcccgc ctcccacccg agccccctca gcttgcctcc ccaccgggtc
    19561 catcaggccg gccggaggga ccccggcggc ccggtgtcag tcccccctgc agccgcccag
    19621 tctctgcctc caggcaaggg cgccagcttt tctcccccca gcctgaggcc cagtctcctg
    19681 tgcactgtct gtaaagtcca gcctcccacg cccgtccacg gctcccgggc ccagcctcgt
    19741 ccacccctcc ccacggtgga caggccctct gtccacccgg gccatccccg cccccctgtg
    19801 tccaccccag tcccgtccag gggggacttt atgtgaccct tgggcctggc tccccataga
    19861 ctcccatgta agcctgcctc gagtaggtgc ctccagagcc ccttttgccc ccctggcggc
    19921 ccagcccgac ccccgggcgc ccccaaactt tgtccagatg tccaggggtc cccgagggtg
    19981 aggcccagcc ccctcccgcc cctgtccact gccccggtcc ccccagaagc ccccaaaagt
    20041 agaggctcag gccatgcgcg ccctgtcacc aggcctgcca aagagccaga tctaaggccg
    20101 ggagaggcag ccccaaagcg ggtgcagtaa caggtaatct ctggtagtga tttggacccg
    20161 aaatctgaca ctttagagct ctggaggact ttaaaactct aaaaatcaaa actttagagg
    20221 cgaatgggcg ccattttgtc cccacgcgcg cataatggcg gacctaggcc taaaaccccc
    20281 aggaagcggg tctatggttg gctgcgctgc tgctatcttt agaggggaaa agaggaataa
    20341 gcccccagac aggggagtgg gcttgtttgt gacttcacca aaggtcaggg cccaaggggg
    20401 ttcgcgttgc taggccacct tctcagtcca gcgcgtttac gtaagccaga cagcagccaa
    20461 ttgtcagttc tagggagggg gaccactgcc cctggtataa agtggtcctg cagctatttc
    20521 tggtcgcatc agagcgccag gagtccacac aaatgtaaga gggggtcttc tacctctccc
    20581 tagccctccg ccccctccaa ggactcgggc ccagtttcta acttttcccc ttccctccct
    20641 cgtcttgccc tgcgcccggg gccaccttca tcaccgtcgc tgactccgcc atccaagcct
    20701 aggggagacc gaagtgaagg ccctggacca acccggcccg ggccccccgg tatcgggcca
    20761 gaggtaagtg gactttaatt ttttctgcta agcccaacac tccaccacac ccaggcacac
    20821 actacacaca cccacccgtc tcagggtccc ctcggacagc tcctaagaag gcaccggtcg
    20881 cccagtccta ccagaggggg ccaagaaccc agacgagtcc gtagaagggt cctcgtccag
    20941 caagaagagg aggtggtaag cggttcacct tcaggggtaa gtaacctgac ctctccaggg
    21001 ctcacataaa gggaggctta gtatacatgc ttcttgcttt tcacaggaac ctgggggcta
    21061 gtctgggtgg gattaggctg cctcaagttg catcagccag ggcttcatgc cctcctcagt
    21121 tccctagtcc ccgggcttca ggccccctcc gtccccgtcc tccagagacc cgggcttcag
    21181 gccctgcctc tcctgttacc cttttagaac cacagcctgg acacatgtgc cagacgcctt
    21241 ggcctctaag gccctcgggt ccccctggac cccggcctca gcaaccctgc tgctcccctc
    21301 ctgccacccc agcctccccc cctccccgtc ccccttcgct cctgatcctc ccccggtccc
    21361 cagtagggcc gcctgccccc ctgcacccag tacctgcccc tcttggccac gcaccccggg
    21421 ccaggccacc ttagacccgg ccaagcccca tccctgaaga cccagcggcc attctctctg
    21481 gtaacgagca gagaagaagt agaggcccgc ggccattggg cccagattga gagaccagtc
    21541 caggggcccg aggttggagc cagcgggcac ccgaggtccc agcacccggt ccctccgggg
    21601 ggcagagaca ggcagggccc cccggcagct ggccccgagg aggcgcccgg agtggggccg
    21661 gtcggctggg ctggccgagc ccgggtctgg gaggtctggg gtggcgagcc tgctgtctca
    21721 ggaggggcct ggctccgccg ggtggccctg gggtaagtct gggaggcaga gggtcggcct
    21781 aggcccgggg aagtggaggg ggatcgcccg ggtctctgtt ggcagagtcc gggcgatcct
    21841 ctgagaccct ccgggcccgg acggtcgccc tcagcccccc agacagaccc cagggtctcc
    21901 aggcagggtc cggcatcttc aggggcagca ggctcaccac cacaggcccc ccagacccgg
    21961 gtctcggcca gccgagccga ccggccccgc gcctggcgcc tcctcggggc cagccgccgg
    22021 ggttggttct gcccctctct ctgtccttca gaggaaccag ggacctcggg caccccagag
    22081 cccctcgggc ccgcctccag gcgccctcct ggtctccgct cccctctgag ccccgttaaa
    22141 cccaaagaat gtctgagggg agccaccctc ggggcccagg ccccagagtc cagaggtcag
    22201 gggcacctca gggtgcctcc ccgggtccca ggccagccgg agggaccccg gcagcccggg
    22261 cggccccaga ggccggttcc tcgccccttc cccgggcttc agagcccagg atgtccccca
    22321 gaagggaccc taggcgtccc ctctcctccc ctccaggccc gagcctctcc ctcgcggaga
    22381 ggggcctctt tgggccctca agtccagccc caccgagacc cgagtggccc ggatcccccc
    22441 accggccctt ctctctgtcc ccctgctcct ctccaacctt cgctccaccc tagaccccag
    22501 cttctggcct ccccgggtcc accaggccag ccggagggac cccggcagcc cgggcgagtc
    22561 gccttccctc tcccctggcc tctccttccc gcctcccacc cgagccccct cagcttgcct
    22621 ccccaccggg tccatcaggc cggccggagg gaccccggcg gcccggtgtc agtcccccct
    22681 gcagccgccc agtctctgcc tccaggcaag ggcgccagct tttctccccc cagcctgagg
    22741 cccagtctcc tgtgcactgt ctgtaaagtc cagcctccca cgcccgtcca cggctcccgg
    22801 gcccagcctc gtccacccct ccccacggtg gacaggccct ctgtccaccc gggccatccc
    22861 cgcccccctg tgtccacccc agtcccgtcc aggggggact ttatgtgacc cttgggcctg
    22921 gctccccata gactcccatg taagcctgcc tcgagtaggt gcctccagag ccccttttgc
    22981 ccccctggcg gcccagcccg acccccgggc gcccccaaac tttgtccaga tgtccagggg
    23041 tccccgaggg tgaggcccag ccccctcccg cccctgtcca ctgccccggt ccccccagaa
    23101 gcccccaaaa gtagaggctc aggccatgcg cgccctgtca ccaggcctgc caaagagcca
    23161 gatctaaggc cgggagaggc agccccaaag cgggtgcagt aacaggtaat ctctggtagt
    23221 gatttggacc cgaaatctga cactttagag ctctggagga ctttaaaact ctaaaaatca
    23281 aaactttaga ggcgaatggg cgccattttg tccccacgcg cgcataatgg cggacctagg
    23341 cctaaaaccc ccaggaagcg ggtctatggt tggctgcgct gctgctatct ttagagggga
    23401 aaagaggaat aagcccccag acaggggagt gggcttgttt gtgacttcac caaaggtcag
    23461 ggcccaaggg ggttcgcgtt gctaggccac cttctcagtc cagcgcgttt acgtaagcca
    23521 gacagcagcc aattgtcagt tctagggagg gggaccactg cccctggtat aaagtggtcc
    23581 tgcagctatt tctggtcgca tcagagcgcc aggagtccac acaaatgtaa gagggggtct
    23641 tctacctctc cctagccctc cgccccctcc aaggactcgg gcccagtttc taacttttcc
    23701 ccttccctcc ctcgtcttgc cctgcgcccg gggccacctt catcaccgtc gctgactccg
    23761 ccatccaagc ctaggggaga ccgaagtgaa ggccctggac caacccggcc cgggcccccc
    23821 ggtatcgggc cagaggtaag tggactttaa ttttttctgc taagcccaac actccaccac
    23881 acccaggcac acactacaca cacccacccg tctcagggtc ccctcggaca gctcctaaga
    23941 aggcaccggt cgcccagtcc taccagaggg ggccaagaac ccagacgagt ccgtagaagg
    24001 gtcctcgtcc agcaagaaga ggaggtggta agcggttcac cttcaggggt aagtaacctg
    24061 acctctccag ggctcacata aagggaggct tagtatacat gcttcttgct tttcacagga
    24121 acctgggggc tagtctgggt gggattaggc tgcctcaagt tgcatcagcc agggcttcat
    24181 gccctcctca gttccctagt ccccgggctt caggccccct ccgtccccgt cctccagaga
    24241 cccgggcttc aggccctgcc tctcctgtta cccttttaga accacagcct ggacacatgt
    24301 gccagacgcc ttggcctcta aggccctcgg gtccccctgg accccggcct cagcaaccct
    24361 gctgctcccc tcctgccacc ccagcctccc cccctccccg tcccccttcg ctcctgatcc
    24421 tcccccggtc cccagtaggg ccgcctgccc ccctgcaccc agtacctgcc cctcttggcc
    24481 acgcaccccg ggccaggcca ccttagaccc ggccaagccc catccctgaa gacccagcgg
    24541 ccattctctc tggtaacgag cagagaagaa gtagaggccc gcggccattg ggcccagatt
    24601 gagagaccag tccaggggcc cgaggttgga gccagcgggc acccgaggtc ccagcacccg
    24661 gtccctccgg ggggcagaga caggcagggc cccccggcag ctggccccga ggaggcgccc
    24721 ggagtggggc cggtcggctg ggctggccga gcccgggtct gggaggtctg gggtggcgag
    24781 cctgctgtct caggaggggc ctggctccgc cgggtggccc tggggtaagt ctgggaggca
    24841 gagggtcggc ctaggcccgg ggaagtggag ggggatcgcc cgggtctctg ttggcagagt
    24901 ccgggcgatc ctctgagacc ctccgggccc ggacggtcgc cctcagcccc ccagacagac
    24961 cccagggtct ccaggcaggg tccggcatct tcaggggcag caggctcacc accacaggcc
    25021 ccccagaccc gggtctcggc cagccgagcc gaccggcccc gcgcctggcg cctcctcggg
    25081 gccagccgcc ggggttggtt ctgcccctct ctctgtcctt cagaggaacc agggacctcg
    25141 ggcaccccag agcccctcgg gcccgcctcc aggcgccctc ctggtctccg ctcccctctg
    25201 agccccgtta aacccaaaga atgtctgagg ggagccaccc tcggggccca ggccccagag
    25261 tccagaggtc aggggcacct cagggtgcct ccccgggtcc caggccagcc ggagggaccc
    25321 cggcagcccg ggcggcccca gaggccggtt cctcgcccct tccccgggct tcagagccca
    25381 ggatgtcccc cagaagggac cctaggcgtc ccctctcctc ccctccaggc ccgagcctct
    25441 ccctcgcgga gaggggcctc tttgggccct caagtccagc cccaccgaga cccgagtggc
    25501 ccggatcccc ccaccggccc ttctctctgt ccccctgctc ctctccaacc ttcgctccac
    25561 cctagacccc agcttctggc ctccccgggt ccaccaggcc agccggaggg accccggcag
    25621 cccgggcgag tcgccttccc tctcccctgg cctctccttc ccgcctccca cccgagcccc
    25681 ctcagcttgc ctccccaccg ggtccatcag gccggccgga gggaccccgg cggcccggtg
    25741 tcagtccccc ctgcagccgc ccagtctctg cctccaggca agggcgccag cttttctccc
    25801 cccagcctga ggcccagtct cctgtgcact gtctgtaaag tccagcctcc cacgcccgtc
    25861 cacggctccc gggcccagcc tcgtccaccc ctccccacgg tggacaggcc ctctgtccac
    25921 ccgggccatc cccgcccccc tgtgtccacc ccagtcccgt ccagggggga ctttatgtga
    25981 cccttgggcc tggctcccca tagactccca tgtaagcctg cctcgagtag gtgcctccag
    26041 agcccctttt gcccccctgg cggcccagcc cgacccccgg gcgcccccaa actttgtcca
    26101 gatgtccagg ggtccccgag ggtgaggccc agccccctcc cgcccctgtc cactgccccg
    26161 gtccccccag aagcccccaa aagtagaggc tcaggccatg cgcgccctgt caccaggcct
    26221 gccaaagagc cagatctaag gccgggagag gcagccccaa agcgggtgca gtaacaggta
    26281 atctctggta gtgatttgga cccgaaatct gacactttag agctctggag gactttaaaa
    26341 ctctaaaaat caaaacttta gaggcgaatg ggcgccattt tgtccccacg cgcgcataat
    26401 ggcggaccta ggcctaaaac ccccaggaag cgggtctatg gttggctgcg ctgctgctat
    26461 ctttagaggg gaaaagagga ataagccccc agacagggga gtgggcttgt ttgtgacttc
    26521 accaaaggtc agggcccaag ggggttcgcg ttgctaggcc accttctcag tccagcgcgt
    26581 ttacgtaagc cagacagcag ccaattgtca gttctaggga gggggaccac tgcccctggt
    26641 ataaagtggt cctgcagcta tttctggtcg catcagagcg ccaggagtcc acacaaatgt
    26701 aagagggggt cttctacctc tccctagccc tccgccccct ccaaggactc gggcccagtt
    26761 tctaactttt ccccttccct ccctcgtctt gccctgcgcc cggggccacc ttcatcaccg
    26821 tcgctgactc cgccatccaa gcctagggga gaccgaagtg aaggccctgg accaacccgg
    26881 cccgggcccc ccggtatcgg gccagaggta agtggacttt aattttttct gctaagccca
    26941 acactccacc acacccaggc acacactaca cacacccacc cgtctcaggg tcccctcgga
    27001 cagctcctaa gaaggcaccg gtcgcccagt cctaccagag ggggccaaga acccagacga
    27061 gtccgtagaa gggtcctcgt ccagcaagaa gaggaggtgg taagcggttc accttcaggg
    27121 gtaagtaacc tgacctctcc agggctcaca taaagggagg cttagtatac atgcttcttg
    27181 cttttcacag gaacctgggg gctagtctgg gtgggattag gctgcctcaa gttgcatcag
    27241 ccagggcttc atgccctcct cagttcccta gtccccgggc ttcaggcccc ctccgtcccc
    27301 gtcctccaga gacccgggct tcaggccctg cctctcctgt taccctttta gaaccacagc
    27361 ctggacacat gtgccagacg ccttggcctc taaggccctc gggtccccct ggaccccggc
    27421 ctcagcaacc ctgctgctcc cctcctgcca ccccagcctc cccccctccc cgtccccctt
    27481 cgctcctgat cctcccccgg tccccagtag ggccgcctgc ccccctgcac ccagtacctg
    27541 cccctcttgg ccacgcaccc cgggccaggc caccttagac ccggccaagc cccatccctg
    27601 aagacccagc ggccattctc tctggtaacg agcagagaag aagtagaggc ccgcggccat
    27661 tgggcccaga ttgagagacc agtccagggg cccgaggttg gagccagcgg gcacccgagg
    27721 tcccagcacc cggtccctcc ggggggcaga gacaggcagg gccccccggc agctggcccc
    27781 gaggaggcgc ccggagtggg gccggtcggc tgggctggcc gagcccgggt ctgggaggtc
    27841 tggggtggcg agcctgctgt ctcaggaggg gcctggctcc gccgggtggc cctggggtaa
    27901 gtctgggagg cagagggtcg gcctaggccc ggggaagtgg agggggatcg cccgggtctc
    27961 tgttggcaga gtccgggcga tcctctgaga ccctccgggc ccggacggtc gccctcagcc
    28021 ccccagacag accccagggt ctccaggcag ggtccggcat cttcaggggc agcaggctca
    28081 ccaccacagg ccccccagac ccgggtctcg gccagccgag ccgaccggcc ccgcgcctgg
    28141 cgcctcctcg gggccagccg ccggggttgg ttctgcccct ctctctgtcc ttcagaggaa
    28201 ccagggacct cgggcacccc agagcccctc gggcccgcct ccaggcgccc tcctggtctc
    28261 cgctcccctc tgagccccgt taaacccaaa gaatgtctga ggggagccac cctcggggcc
    28321 caggccccag agtccagagg tcaggggcac ctcagggtgc ctccccgggt cccaggccag
    28381 ccggagggac cccggcagcc cgggcggccc cagaggccgg ttcctcgccc cttccccggg
    28441 cttcagagcc caggatgtcc cccagaaggg accctaggcg tcccctctcc tcccctccag
    28501 gcccgagcct ctccctcgcg gagaggggcc tctttgggcc ctcaagtcca gccccaccga
    28561 gacccgagtg gcccggatcc ccccaccggc ccttctctct gtccccctgc tcctctccaa
    28621 ccttcgctcc accctagacc ccagcttctg gcctccccgg gtccaccagg ccagccggag
    28681 ggaccccggc agcccgggcg agtcgccttc cctctcccct ggcctctcct tcccgcctcc
    28741 cacccgagcc ccctcagctt gcctccccac cgggtccatc aggccggccg gagggacccc
    28801 ggcggcccgg tgtcagtccc ccctgcagcc gcccagtctc tgcctccagg caagggcgcc
    28861 agcttttctc cccccagcct gaggcccagt ctcctgtgca ctgtctgtaa agtccagcct
    28921 cccacgcccg tccacggctc ccgggcccag cctcgtccac ccctccccac ggtggacagg
    28981 ccctctgtcc acccgggcca tccccgcccc cctgtgtcca ccccagtccc gtccaggggg
    29041 gactttatgt gacccttggg cctggctccc catagactcc catgtaagcc tgcctcgagt
    29101 aggtgcctcc agagcccctt ttgcccccct ggcggcccag cccgaccccc gggcgccccc
    29161 aaactttgtc cagatgtcca ggggtccccg agggtgaggc ccagccccct cccgcccctg
    29221 tccactgccc cggtcccccc agaagccccc aaaagtagag gctcaggcca tgcgcgccct
    29281 gtcaccaggc ctgccaaaga gccagatcta aggccgggag aggcagcccc aaagcgggtg
    29341 cagtaacagg taatctctgg tagtgatttg gacccgaaat ctgacacttt agagctctgg
    29401 aggactttaa aactctaaaa atcaaaactt tagaggcgaa tgggcgccat tttgtcccca
    29461 cgcgcgcata atggcggacc taggcctaaa acccccagga agcgggtcta tggttggctg
    29521 cgctgctgct atctttagag gggaaaagag gaataagccc ccagacaggg gagtgggctt
    29581 gtttgtgact tcaccaaagg tcagggccca agggggttcg cgttgctagg ccaccttctc
    29641 agtccagcgc gtttacgtaa gccagacagc agccaattgt cagttctagg gagggggacc
    29701 actgcccctg gtataaagtg gtcctgcagc tatttctggt cgcatcagag cgccaggagt
    29761 ccacacaaat gtaagagggg gtcttctacc tctccctagc cctccgcccc ctccaaggac
    29821 tcgggcccag tttctaactt ttccccttcc ctccctcgtc ttgccctgcg cccggggcca
    29881 ccttcatcac cgtcgctgac tccgccatcc aagcctaggg gagaccgaag tgaaggccct
    29941 ggaccaaccc ggcccgggcc ccccggtatc gggccagagg taagtggact ttaatttttt
    30001 ctgctaagcc caacactcca ccacacccag gcacacacta cacacaccca cccgtctcag
    30061 ggtcccctcg gacagctcct aagaaggcac cggtcgccca gtcctaccag agggggccaa
    30121 gaacccagac gagtccgtag aagggtcctc gtccagcaag aagaggaggt ggtaagcggt
    30181 tcaccttcag gggtaagtaa cctgacctct ccagggctca cataaaggga ggcttagtat
    30241 acatgcttct tgcttttcac aggaacctgg gggctagtct gggtgggatt aggctgcctc
    30301 aagttgcatc agccagggct tcatgccctc ctcagttccc tagtccccgg gcttcaggcc
    30361 ccctccgtcc ccgtcctcca gagacccggg cttcaggccc tgcctctcct gttacccttt
    30421 tagaaccaca gcctggacac atgtgccaga cgccttggcc tctaaggccc tcgggtcccc
    30481 ctggaccccg gcctcagcaa ccctgctgct cccctcctgc caccccagcc tccccccctc
    30541 cccgtccccc ttcgctcctg atcctccccc ggtccccagt agggccgcct gcccccctgc
    30601 acccagtacc tgcccctctt ggccacgcac cccgggccag gccaccttag acccggccaa
    30661 gccccatccc tgaagaccca gcggccattc tctctggtaa cgagcagaga agaagtagag
    30721 gcccgcggcc attgggccca gattgagaga ccagtccagg ggcccgaggt tggagccagc
    30781 gggcacccga ggtcccagca cccggtccct ccggggggca gagacaggca gggccccccg
    30841 gcagctggcc ccgaggaggc gcccggagtg gggccggtcg gctgggctgg ccgagcccgg
    30901 gtctgggagg tctggggtgg cgagcctgct gtctcaggag gggcctggct ccgccgggtg
    30961 gccctggggt aagtctggga ggcagagggt cggcctaggc ccggggaagt ggagggggat
    31021 cgcccgggtc tctgttggca gagtccgggc gatcctctga gaccctccgg gcccggacgg
    31081 tcgccctcag ccccccagac agaccccagg gtctccaggc agggtccggc atcttcaggg
    31141 gcagcaggct caccaccaca ggccccccag acccgggtct cggccagccg agccgaccgg
    31201 ccccgcgcct ggcgcctcct cggggccagc cgccggggtt ggttctgccc ctctctctgt
    31261 ccttcagagg aaccagggac ctcgggcacc ccagagcccc tcgggcccgc ctccaggcgc
    31321 cctcctggtc tccgctcccc tctgagcccc gttaaaccca aagaatgtct gaggggagcc
    31381 accctcgggg cccaggcccc agagtccaga ggtcaggggc acctcagggt gcctccccgg
    31441 gtcccaggcc agccggaggg accccggcag cccgggcggc cccagaggcc ggttcctcgc
    31501 cccttccccg ggcttcagag cccaggatgt cccccagaag ggaccctagg cgtcccctct
    31561 cctcccctcc aggcccgagc ctctccctcg cggagagggg cctctttggg ccctcaagtc
    31621 cagccccacc gagacccgag tggcccggat ccccccaccg gcccttctct ctgtccccct
    31681 gctcctctcc aaccttcgct ccaccctaga ccccagcttc tggcctcccc gggtccacca
    31741 ggccagccgg agggaccccg gcagcccggg cgagtcgcct tccctctccc ctggcctctc
    31801 cttcccgcct cccacccgag ccccctcagc ttgcctcccc accgggtcca tcaggccggc
    31861 cggagggacc ccggcggccc ggtgtcagtc ccccctgcag ccgcccagtc tctgcctcca
    31921 ggcaagggcg ccagcttttc tccccccagc ctgaggccca gtctcctgtg cactgtctgt
    31981 aaagtccagc ctcccacgcc cgtccacggc tcccgggccc agcctcgtcc acccctcccc
    32041 acggtggaca ggccctctgt ccacccgggc catccccgcc cccctgtgtc caccccagtc
    32101 ccgtccaggg gggactttat gtgacccttg ggcctggctc cccatagact cccatgtaag
    32161 cctgcctcga gtaggtgcct ccagagcccc ttttgccccc ctggcggccc agcccgaccc
    32221 ccgggcgccc ccaaactttg tccagatgtc caggggtccc cgagggtgag gcccagcccc
    32281 ctcccgcccc tgtccactgc cccggtcccc ccagaagccc ccaaaagtag aggctcaggc
    32341 catgcgcgcc ctgtcaccag gcctgccaaa gagccagatc taaggccggg agaggcagcc
    32401 ccaaagcggg tgcagtaaca ggtaatctct ggtagtgatt tggacccgaa atctgacact
    32461 ttagagctct ggaggacttt aaaactctaa aaatcaaaac tttagaggcg aatgggcgcc
    32521 attttgtccc cacgcgcgca taatggcgga cctaggccta aaacccccag gaagcgggtc
    32581 tatggttggc tgcgctgctg ctatctttag aggggaaaag aggaataagc ccccagacag
    32641 gggagtgggc ttgtttgtga cttcaccaaa ggtcagggcc caagggggtt cgcgttgcta
    32701 ggccaccttc tcagtccagc gcgtttacgt aagccagaca gcagccaatt gtcagttcta
    32761 gggaggggga ccactgcccc tggtataaag tggtcctgca gctatttctg gtcgcatcag
    32821 agcgccagga gtccacacaa atgtaagagg gggtcttcta cctctcccta gccctccgcc
    32881 ccctccaagg actcgggccc agtttctaac ttttcccctt ccctccctcg tcttgccctg
    32941 cgcccggggc caccttcatc accgtcgctg actccgccat ccaagcctag gggagaccga
    33001 agtgaaggcc ctggaccaac ccggcccggg ccccccggta tcgggccaga ggtaagtgga
    33061 ctttaatttt ttctgctaag cccaacactc caccacaccc aggcacacac tacacacacc
    33121 cacccgtctc agggtcccct cggacagctc ctaagaaggc accggtcgcc cagtcctacc
    33181 agagggggcc aagaacccag acgagtccgt agaagggtcc tcgtccagca agaagaggag
    33241 gtggtaagcg gttcaccttc aggggtaagt aacctgacct ctccagggct cacataaagg
    33301 gaggcttagt atacatgctt cttgcttttc acaggaacct gggggctagt ctgggtggga
    33361 ttaggctgcc tcaagttgca tcagccaggg cttcatgccc tcctcagttc cctagtcccc
    33421 gggcttcagg ccccctccgt ccccgtcctc cagagacccg ggcttcaggc cctgcctctc
    33481 ctgttaccct tttagaacca cagcctggac acatgtgcca gacgccttgg cctctaaggc
    33541 cctcgggtcc ccctggaccc cggcctcagc aaccctgctg ctcccctcct gccaccccag
    33601 cctccccccc tccccgtccc ccttcgctcc tgatcctccc ccggtcccca gtagggccgc
    33661 ctgcccccct gcacccagta cctgcccctc ttggccacgc accccgggcc aggccacctt
    33721 agacccggcc aagccccatc cctgaagacc cagcggccat tctctctggt aacgagcaga
    33781 gaagaagtag aggcccgcgg ccattgggcc cagattgaga gaccagtcca ggggcccgag
    33841 gttggagcca gcgggcaccc gaggtcccag cacccggtcc ctccgggggg cagagacagg
    33901 cagggccccc cggcagctgg ccccgaggag gcgcccggag tggggccggt cggctgggct
    33961 ggccgagccc gggtctggga ggtctggggt ggcgagcctg ctgtctcagg aggggcctgg
    34021 ctccgccggg tggccctggg gtaagtctgg gaggcagagg gtcggcctag gcccggggaa
    34081 gtggaggggg atcgcccggg tctctgttgg cagagtccgg gcgatcctct gagaccctcc
    34141 gggcccggac ggtcgccctc agccccccag acagacccca gggtctccag gcagggtccg
    34201 gcatcttcag gggcagcagg ctcaccacca caggcccccc agacccgggt ctcggccagc
    34261 cgagccgacc ggccccgcgc ctggcgcctc ctcggggcca gccgccgggg ttggttctgc
    34321 ccctctctct gtccttcaga ggaaccaggg acctcgggca ccccagagcc cctcgggccc
    34381 gcctccaggc gccctcctgg tctccgctcc cctctgagcc ccgttaaacc caaagaatgt
    34441 ctgaggggag ccaccctcgg ggcccaggcc ccagagtcca gaggtcaggg gcacctcagg
    34501 gtgcctcccc gggtcccagg ccagccggag ggaccccggc agcccgggcg gccccagagg
    34561 ccggttcctc gccccttccc cgggcttcag agcccaggat gtcccccaga agggacccta
    34621 ggcgtcccct ctcctcccct ccaggcccga gcctctccct cgcggagagg ggcctctttg
    34681 ggccctcaag tccagcccca ccgagacccg agtggcccgg atccccccac cggcccttct
    34741 ctctgtcccc ctgctcctct ccaaccttcg ctccacccta gaccccagct tctggcctcc
    34801 ccgggtccac caggccagcc ggagggaccc cggcagcccg ggcgagtcgc cttccctctc
    34861 ccctggcctc tccttcccgc ctcccacccg agccccctca gcttgcctcc ccaccgggtc
    34921 catcaggccg gccggaggga ccccggcggc ccggtgtcag tcccccctgc agccgcccag
    34981 tctctgcctc caggcaaggg cgccagcttt tctcccccca gcctgaggcc cagtctcctg
    35041 tgcactgtct gtaaagtcca gcctcccacg cccgtccacg gctcccgggc ccagcctcgt
    35101 ccacccctcc ccacggtgga caggccctct gtccacccgg gccatccccg cccccctgtg
    35161 tccaccccag tcccgtccag gggggacttt atgtgaccct tgggcctggc tccccataga
    35221 ctcccatgta agcctgcctc gagtaggtgc ctccagagcc ccttttgccc ccctggcggc
    35281 ccagcccgac ccccgggcgc ccccaaactt tgtccagatg tccaggggtc cccgagggtg
    35341 aggcccagcc ccctctcgcc caagctgctt tgattcctgg gatatttttg ggaatggtgt
    35401 taactttctc cccttgtatt tgctattcaa tcaacctgat tccccctgct catacctcca
    35461 cttacaacca agccactacg gccacgtccc cggcctcccg ctcgggtaag tgctttttca
    35521 tttttagccc cagcccctcc tctataagtt ctaggcaaac ctccaatcac cagccacctt
    35581 ccaatgtagt ctcttagaga gtggctgcta cgcattagag accactttga gccacccaca
    35641 gtaaccaccc agcgccaatc tgtctacata gaagaagaag aggatgaaga ctaagtcaca
    35701 ggcttagcca ggtgatttgt gaatttcagt ttatttactt tcttccaatc aagctttccc
    35761 agcctccgct tgttaggtcc tagttatggg ttttccatgg gggacttagt atccgttcta
    35821 ttagattaac gtgcaagacg ctaaacttaa ccaaggtcag ccaagggacg cgtgttatcc
    35881 caggctgccc accctgagga tttcccccca aaatcctcct accctctctt tatgccatgt
    35941 gtgttgttgg cttgtgttag tgctatgtaa tgcgttgccg ccaggtggca gcctgtttat
    36001 agatgtgcag taccccttaa tgttaggtct gctttagggc tgccaggtgg cgcaatctag
    36061 gattaattca cctgtatccc tttccctcca cccgcagtaa cccagcactg gcgtgtgacg
    36121 tggtgtaaag ttttgcctga acctgtggtt gggcaggtac atgccaacaa ccttctaagc
    36181 acccgcgctt gtgttttgct ttatctgccg ccatcatgcc tacattctat cttgcgttac
    36241 atgggggaca aacatatcat ctaattgttg acacggatag tcttggaaac ccgtcactct
    36301 cagtaattcc ctcgaatccc taccaggaac aactgtcaga cactccatta attccactaa
    36361 caatctttgt tggggaaaac acgggggtgc ccccaccact cccaccaccc cccccaccac
    36421 cacccccacc acccccacca cccccaccac ccccaccacc cccaccacct ccaccacctt
    36481 caccaccacc cccgccccca ccacccccac cacctcagcg cagggatgcc tggacacaag
    36541 agccatcacc tcttgatagg gatccgctag gatatgacgt cgggcatgga cctctagcat
    36601 ctgctatgcg aatgctttgg atggctaatt atattgtaag acaatcacgg ggtgaccggg
    36661 gccttatttt gccacaaggc ccacaaacag cccctcaggc caggttggtc cagccacatg
    36721 tcccccctct acgcccgaca gcacccacca ttttgtcacc tctgtcacaa ccgaggctta
    36781 cccctccaca accactcatg atgccaccaa ggcctacccc tcctacccct ctgccacctg
    36841 caacactaac ggtgccacca aggcctaccc gtcctaccac tctgccaccc acaccactac
    36901 tcacggtact acaaaggcct accgaacttc aacccacacc atcaccacca cgcatgcatc
    36961 tccctgtctt gcatgtgcca gaccaatcaa tgcaccctct tactcatcaa agcaccccaa
    37021 atgatccaga tagtccagaa ccacggtccc cgactgtatt ttataacatt ccacctatgc
    37081 cattaccccc ctcacaattg ccaccaccag cagcaccagc acagccacct ccaggggtca
    37141 tcaacgacca acaattacat catctaccct cggggccacc atggtggcca cccatctgcg
    37201 accccccgca accctctaag actcaaggcc agagccgggg acagagcagg gggaggggca
    37261 ggggcagggg caggggcagg ggcaagggca agtccaggga caagcaacgc aagcccggtg
    37321 gaccttggag accagagcca aacacctcca gtcctagcat gcctgaacta agtccagtcc
    37381 tcggtcttca tcagggacaa ggggctgggg actcaccaac tcctggccca tccaatgccg
    37441 cccccgtttg tagaaattca cacacggcaa cccctaacgt ttcaccaata catgaaccgg
    37501 agtcccataa tagcccagag gctcccattc tcttccccga tgattggtat cctccatcta
    37561 tagaccccgc agacttagac gaaagttggg attacatttt tgagacaaca gaatctccta
    37621 gctcagatga agattatgtg gagggaccca gtaaaagacc tcgcccctcc atccagtaaa
    37681 aacccttgcc ctctccagca accaatgtat cccaaataaa tgttacttct tttgctctta
    37741 accattgaca cgcctgtcat tctatcaatt aaacaaggga aaaaggttta gctattccac
    37801 caacacgacc ccaaggaagg cttgccaaaa ttggtgcctt gctctcagca ctttgccagc
    37861 aacttatagc atggtaggca gctcaactcg gcccgtctta ctgcccagcc tactctccac
    37921 tcccagtcca tgttcgcact cctatgcatt tcctgccctc ccacttttac cccagtccca
    37981 acccaaaacc acacacaaca catagaattg ttagtttaaa cagtttattg ataggtggct
    38041 gcttttagcc taattgtgta ttgctctcgt tgccaaaacc tgttgtaagg gccggcaccc
    38101 gcaacatggg gaaaacataa ccgccgccat cccatgggga gggtagaggc ggttgacatg
    38161 taggtgagta gtgtaagaag catggcgaag tagacaggtt acttttagag tgtagtgtac
    38221 agggccgggc gcaacagtgc caccaacccg gggtctgagc attccatggg cagcagggac
    38281 actgcactac cgccaggtcc tggggcagcc ggggttcctg gcgctccggg ggcagccggg
    38341 cggccgccgg tgggtccgct gggccgctgc cccgctccgg gtggggggtg gccccgctgg
    38401 gcaccgctgc gccgccgcca ggtcctgggg cagccggggt tcctggcgct ccgggggcag
    38461 ccgggcggcc gccggtgggt ccgctgggcc gctgccccgc tccgggtggg gggtggcccc
    38521 gctgggcacc gctgcgccgc cgccaggtcc tggggcagcc ggggttcctg gcgctccggg
    38581 ggcagccggg cggccgccgg tgggtccgct gggccgctgc cccgctccgg gtggggggtg
    38641 gccccgctgg gcaccgctgc gccgccgcca ggtcctgggg cagccggggt tcctggcgct
    38701 ccgggggcag ccgggcggcc gccggtgggt ccgctgggcc gctgccccgc tccgggtggg
    38761 gggtggcccc gctgggcacc gctgcgccgc cgccaggtcc tggggcagcc ggggttcctg
    38821 gcgctccggg ggcagccggg cggccgccgg tgggtccgct gggccgctgc cccgctccgg
    38881 gtggggggtg gccccgctgg gcaccgctgc gccgccgcca ggtcctgggg cagccggggt
    38941 tcctggcgct ccgggggcag ccgggcggcc gccggtgggt ccgctgggcc gctgccccgc
    39001 tccgggtggg gggtggcccc gctgggcacc gctgcgccgc cgccaggtcc tggggcagcc
    39061 ggggttcctg gcgctccggg ggcagccggg cggccgccgg tgggtccgct gggccgctgc
    39121 cccgctccgg gtggggggtg gccccgctgg gcaccgctgc gccgccgcca ggtcctgggg
    39181 cagccggggt tcctggcgct ccgggggcag ccgggcggcc gccggtgggt ccgctgggcc
    39241 gctgccccgc tccgggtggg gggtggcccc gctgggcacc gctgcgccgc cgccaggtcc
    39301 tggggcagcc ggggttcctg gcgctccggg ggcagccggg cggccgccgg tgggtccgct
    39361 gggccgctgc cccgctccgg gtggggggtg gccccgctgg gcaccgctgc gccgccgcca
    39421 ggtcctgggg cagccggggt tcctggcgct ccgggggcag ccgggcggcc gccggtgggt
    39481 ccgctgggcc gctgccccgc tccgggtggg gggtggcccc gctgggcacc gctgcgccgc
    39541 cgccaggtcc tggggcagcc ggggttcctg gcgctccggg ggcagccggg cggccgccgg
    39601 tgggtccgct gggccgctgc cccgctccgg gtggggggtg gccccgctgg gcaccgctgc
    39661 gccgccgcca ggtcctgggg cagccggggt tcctggcgct ccgggggcag ccgggcggcc
    39721 gccggtgggt ccgctgggcc gctgccccgc tccgggtggg gggtggcccc gctgggcacc
    39781 gctgcgccgc cgccaggtcc tggggcagcc ggggttcctg gcgctccact gcacctggaa
    39841 tgcagggtgg gggcgtggtc ccctggaccc cagccccgcc gatccctccc ccagggcgta
    39901 cccggcttgc ctggttctgg ggctcctctg ggggtcgctg catccgccgg tagggttcga
    39961 atgggcgtgg tccgcttgct ctgctggccc ggtacgcctg gattgccggc tgggggctgg
    40021 ggtcccggga cgccccctcc ctgctcccac ccggttccct cccccagggc gtgccccgct
    40081 tgcctggtcc tggagctcat ccggggatgc tgcatccgct agtccgacct gggtgggtgc
    40141 ggtccgctgg ccccaccctg ggggtagccg ccgggtctgc tggtccggtg cacctggaag
    40201 gcaggggggg gggcagtgag ggaggggcgt ggtcctggga ccccgcgccg actggcaggg
    40261 ggtccccatg gcacaggcct aggggtccag ggggcagccg cggcccagcg cgccccgttc
    40321 acgggggagg accgcggccg agccaccagg ggcccggcgg gggtgggggg tgcgctccca
    40381 ggccggaccc tggtgccagg cagggacccc gcgccacccg cttcatgggg ggggaggccg
    40441 ccgcaaggac gccgggccgg ctgggaggtg tgcacccccc gagcgtctgg acgacgctgg
    40501 cgagccgggc cggctcgcct tcttttatcc tctttttggg gtctctgtgt aatactttaa
    40561 ggtttgctca ggagtggggg cttcttattg gttaattcag gtgtgtcatt ttagcccgtt
    40621 gggtttcatt aaggtgtgtc accaggtggg tggtacctgg aggttattct attgggataa
    40681 cgagaggagg aggggctaga ggtccgcgag atttggggta ggcggagcct caggagggtc
    40741 ccctccatag ggttgaacca ggagggggag gattgggctc cgccccgata tacctagtgg
    40801 gtggagccta gaggtaggta tccatagggt tccattatcc tggaggtatc ctaagctccg
    40861 cccctatata ccaggtgggt ggagctaggt aggattcagc taggttccta ctggggtacc
    40921 cccctaccct accttaaggt gcgccaccct tcctccttcc gttttaatgg tagaataacc
    40981 tataggttat taacctagtg gtggaatagg gtattgcagc tgggtatata cctataggta
    41041 tatagaacct agaggaaggg aaccctatag tgtaatccct ccccccccta cccccccctc
    41101 ccttacggtt gcctgagccc atcccccacc ccagcacccc ggggtgacgt ggcaccccgc
    41161 gtgccttact gacttgtcac ctttgcacat ttggtcagct gaccgatgct cgccacttcc
    41221 tgggtcatga cctggcctgt gccttgtccc gtggacaatg tccctccagc gtggtggctg
    41281 cctttgggat gcatcacttt gagccactaa gcccccgttg ctcgccttgc ctgcctcacc
    41341 atgacacact aagcccctgc taatccatga gccccgcctt taggaagcac cacgtcccgg
    41401 ggacggaagg ggacttgggg tgattttcta tgtgggggtg gaaatatgag caagaataag
    41461 gacggctcct tattaacctg atcagccccg gagttgcctg tttcatcact aaccccgggc
    41521 ctgaagaggt tgacaagaag ggtcaaggtt tcgtctgtgt gttgaagggc aggggctgtt
    41581 gggtgcatct ggaacggctt acctcgggta actgtttgcc attaaaaggt tggggattag
    41641 gtttagcccc tttagctgcc atttcgaacc ggggtgtgca gatgcaggtc tccgggtggg
    41701 caggcagtac gagatgtcac gttgtgttgt ctttcctccc acccctgtcc tggctgtggc
    41761 aaatgcgacc ctcatagagt tgtgtttcag gtctgtgtcc tgttttgcgg tgggttattt
    41821 cttccctcag tgtttgccag cttatttccc cagttttcac gtactggggc ctgtggacac
    41881 ctgagggagc ggccgttggt gggtatgtgt tggaattgct cccaccctca attttcgctt
    41941 gccttcttcc cttgttaacc tgatagcata gcctctaggt ttccttgtag gtctgtttgg
    42001 gtttgttggt tcacgtggtg ctaacttgaa ttttttggtt ttctagttcc ctcttaatta
    42061 catttgtgcc agatcttgta gagcaagatg gcctattcaa caagggagat actgttagcc
    42121 ctgtgtatac gggacagtcg tgtgcatgga aatggtaccc tgcatcctgt gttggagcta
    42181 gcagcaagag aaacacctct ccgcctttcg ccagaggaca ctgtagttct gcgttatcat
    42241 gtgttgcttg aggagataat tgaacgaaat tcagagacat ttacagaaac ttggaacaga
    42301 tttataacac acaccgaaca tgtggatctg gattttaact cagtattttt agagatattt
    42361 caccgtggag acccaagcct tgggcgcgcg ttggcctgga tggcctggtg catgcatgcc
    42421 tgcaggacat tgtgttgtaa ccagtctact ccttactatg ttgtggacct gtcagttcgt
    42481 gggatgttag aagccagcga aggcctggat ggttggattc atcaacaggg cggctggtct
    42541 acattaattg aagacaacat tcctggatcc agaaggttta gctggacttt gtttcttgct
    42601 ggactgactt tgagtctgtt agttatatgt agttatttat ttatctccag aggaagacac
    42661 taatctatac attttctcag cactttatat gaatcagggt cattgggcct gcggggaact
    42721 gagccagtag gatattaggc aagggtgaca cagtgcccat gcattataat ttaaccaaac
    42781 agtggtcgtg agttttaggc cggccatggg ggcttacaag aataacatgc caatgacccg
    42841 gcccccactt ttaaattctg ttgcagcaga tagctgatac ccaatgttat cttttgcggc
    42901 agaaattgaa agtgctggcc atatctacaa ttgggtgtcc taggtgggat atacgcctgt
    42961 ggtgttctaa cgggaagtgt gtaagcacac acgtaatttg caagcggtgc ttcacgctct
    43021 tcgttaaaat aacacaagga caagatacta aagaaataac tgaggtgagt gtgggaagat
    43081 gggaatacta tgtgttatgt taacgggtga gagcctatac tgcagcccag actcgggggg
    43141 aggaggaaat ggtaagagtt atactctact tatctttttt gacactacat ttaactgtta
    43201 tgtaacaatg tttgcttatt ttcatgttca ataaacgcta tgttaatgat gaagaacctg
    43261 tgttctttgg aagtgggccc aatggggtag taggttttgg gagggtgccg tgctagatat
    43321 ttcaactgcc acagacccca ttttgtccca cctgttacca cattctaggt cctgcatcca
    43381 gtgggccagg tgtctcacca tggctctttc taggtggata ccacagtcca ggcccccaag
    43441 gctaccgtgc taattacctc ctcatgtcca cccccaccct gtgttactgt cgcctgatta
    43501 tcctggctta gcagcctcca agttttacaa gacgtcccat tgccctgccc ttggtccaag
    43561 tctcgccggt tttcagcagc ctgttgtagc ctgcccccaa gtttcgcagg tttcccccat
    43621 gcttccaccc gttaacccaa tagcatgaca gccaatccaa cacgaggcaa gttttaagag
    43681 ttaaaagcaa ctactgttta ttttccaaaa tgagctgggt atagttgatg atctgtaggc
    43741 gcagctcatc cccacattcc aggtccttga tggcctcgta gatggcatct tcgtcgacat
    43801 tgacagcctt ctcatatacc gtgtctctgg ggctgacctt tatacagaag gcgtccccta
    43861 ctaggtccac ggccagctcg taggtggggc ctatgttttc acataacagt ttcaagcagg
    43921 tctctgggat gtgaagggag gtgccctgga gcaggagatg catgattagg cgcccttttc
    43981 catttgtgct gaagatgggg cagatggtgc cacaaaagtg tccggtgacc aggtaagcgt
    44041 agagaaggct gggttgggaa agtccagcct ttactgcact gggagagctg ctgagcagag
    44101 acacatagaa ggtcttgttg ggtattatct tgtggacatt gttgaagaag gagagctggg
    44161 tggagctaaa ctcctgaggc acatgaacct gggacctatt gatgcagatc tcgcagtgag
    44221 accccagagt caggctgtgg ccgaagggag acaggcgaag gcagcgcccg ggggagagag
    44281 tgcacagtga cagtgggaga aacacggcct ctgagacatg tatgggggtg ttcatctcac
    44341 gcagaaaatc tttgcccagc tcaaagttgg cagagattcc cctgaagaag tcccgtagtg
    44401 aaaaatggga tctgtctaca ccatgtctgg tgtgccggga acatattgat cgggccacac
    44461 tgccaaccct ttccattctt cccagctctg agcgagattt tccacacctg gacaccgact
    44521 tcacgctatg cgccgaggcc tttgaggccg tgtagtttct gtggtgcgga tgcattaggc
    44581 ggcgcaatgc gggatctgcc ggtcgctgtt ggcgtgcatt cacggcatct ggggtgaccg
    44641 gggccatcgg gtttactttt cacacgtaga cctgggaagt ttgataggac tgtaccaggt
    44701 caaggccgtg gatgcgcagg accacgtcca gttccttagt gacatccacg aggattgttt
    44761 tgcccactct ggccacttgt gtggatttaa atatgtacac aagcgtaatt aacgagtcac
    44821 agaccccctg ttccagattc tgaccggctg caagcgctgc cttaaaggcc tggaagctgg
    44881 gtgggtaaat ctgaccaaac agcacgctcg gattcgtgat gctgtggttg atggcacaca
    44941 gggggtcgca gaacaggtgc ttgtggaagt cttgcggggt gcacatctgc agccaggccc
    45001 ttagcctggg gcatggcaca tccagcagcg tgttttgggt cttgatgagg aacacgatcc
    45061 tgtctaggat tttgatgttg ttgccgaacg agtcaagaat caggctcttg aagcggtcaa
    45121 gggtgtcctt ggcgtccggg tgggccccga ggctctcgca gagtgggcag atggtccgtg
    45181 aggcattctt gtgccttagt ccaaacatgg gggccaggag gcaggggccc tgcgaatggt
    45241 cgccagcctc cggtctggtg atggccaggg ccaactccgc cagctcatcg ccgctgtatt
    45301 ccgcgtttaa accgatagca tggtggcctg gccccccgag caggtccgtc ccctgccacg
    45361 tacctaatag tagtccacag tagtcggcct tggttgtaat ttcaggagag agtcctccct
    45421 tttcggccct gagaaatgga tgctgaactc ggtttctggt aggcaggtgg cagcacaggg
    45481 cggtgtacag gcccctgccg acgtcccctg ggacatcctg ggaatctttg caggttctgg
    45541 gtccagggag ggtaagaaaa gtgggggtgg ttctgggcca catggacttg aagcagaagt
    45601 tggccgggga ctggccggtg aggatggatt tcagaaactc caatttgtag tagccgaggt
    45661 tggcatttct aatcatgtca gaagaggaca cagggaggaa gcaccggcaa atgtaaaagt
    45721 gaagctggat gtcaatggca agaatcctgg agggcatgaa gagggaatcc aaccccccgg
    45781 ccatggggaa gtattttatc aggatgtgta aaaagtccat gcctgtgatg aggctagaga
    45841 tccaggctcg tggggcattt agacagtagt agcagagcag ggcatagtcc tcaaagaagg
    45901 ccacgggggc atctgagtga ttgaccaggg tgtcgagcag atcacaaact cggcaggtgc
    45961 tggctggaga gagggactcg taggtgtgga cgagtggtgg gtaggctatg ccttcttccg
    46021 cgttggctgg aagataggag tgggccatca aaaggccgac tgcctcgaac tggcttttca
    46081 gattgtccac ggtccagggc acaaagtcct ccatctttgg agttctgccc gcgatctgtg
    46141 ccacctctgt tacgccactc ctcgtgaggg ggcagctgga cagtcttttt ccggtcaggg
    46201 ggtttggctc gtttgcgctc gtgactttgt gagccatgac acatctgggt ggcaaggtga
    46261 ggtcttctgg gtttttaata ccggggtcgg caccagtttc tgggacaccg ccacaaggac
    46321 aaggtgggct agcaagttct cgagtctacg aagactccgg gggcagtctt ttgagtttct
    46381 cgcctatgat ccaccccaat ctcgcccccc taattgcgcc atctgcctac gcgaggctga
    46441 acctcctgaa tcactgcatc tttcttgagg cgtttaaaga agagaatagt ggccagggcc
    46501 tcggtggggt ccagcgtgag gtcttatttt tgaaaaggga tattataaaa caggtcattg
    46561 ctcggattgt ggcagccgat agcaccctag atctagtgaa tcatggcgag cccggaagag
    46621 aggctcctag acgagctcaa taacgtaatt gtgtcatttc tgtgtgactc tgggtctctg
    46681 gaagtggaga gatgctccgg ggcgcatgtg ttctccaggg gcagctccca acccctctgc
    46741 accgtgaagc tgcgccacgg acagatttac cacctggagt ttgtctacaa gttcctggcc
    46801 tttaagctga agaactgcaa ctacccctcc tcgcccgtgt ttgtgatatc caacaacggc
    46861 ctggccacca ccctgaggtg ctttttgcac gagccgtcgg gtctcagatc gggccagagc
    46921 ggcccttgcc tgggtctctc aacggatgtt gacctaccaa agaactccat cattatgctg
    46981 ggccaggatg acttcattaa gttcaaaagc cccctggtct tccctgctga gcttgatctc
    47041 ctgaaatcta tggtggtctg ccgggcctac atcacggaac accggacgac gatgcagttt
    47101 ctggtgtttc aggccgccaa cgcccagaag gcctcgcggg tcatggatat gattagtgat
    47161 atgtctcagc aactgtctcg gtctggtcaa gtcgaggata cgggcgccag agtcacaggt
    47221 ggaggaggtc ccaggcctgg cgtcacgcac tcggggtgtc ttggggactc acacgttagg
    47281 gggcgcggtg gttgggactt ggataacttt tcagaagctg agaccgaaga cgaggcgagt
    47341 tacgctcctt ggagggacaa agactcgtgg tcggaatccg aggcggcgcc gtggaagaag
    47401 gaactcgtga ggcaccccat ccgcaggcac cggacacgcg agactcgccg tatgcgcggg
    47461 agccattcac gggtggaaca cgtgcccccc gagacccggg agacggtggt ggggggagca
    47521 tggcgttatt cttggcgcgc cacaccttat ctggcacggg tgctggctgt cacggccgtg
    47581 gccctgctcc tgatgtttct gaggtggacc tgacgttgca ggcccttggg gagcgggggt
    47641 tctccaggct cctggatctg gggctggcct gcctggatct gagctatgtg gaaatgaggg
    47701 aatttgtggt ttggggcagg cccccagctt ctgaggcggc tgtggcctct acgccaggct
    47761 cgcttttccg aagccactcg tccgcctact ggttgtcgga ggtggagagg cccgggggcc
    47821 ttgtccgctg ggccaggtca cagaccagcc cctcatccct gaccctcgcg ccccatcttg
    47881 gcccgtccct cttgtccctt tcagtggtca ccggtggtgg gtgtggagcc gtggcctttt
    47941 gcaacgcctt tttcctagct tattttttgg ttgtgcggtc tgttttcccc gcgttttccg
    48001 atagaatagc tgcctggatc tgcgaccggt cccctttctg cgaaaacacc cgggccgtgg
    48061 ccaggggtta ccgaggcctc gtgaagaggt tcttggcatt cgtgtttgag cgtagtagct
    48121 atgacccccc cttgttgagg caaaactcta ggcctgtgga gcgctgcttt gccatcaaga
    48181 attatgtccc gggcctggac tcacaaagct gtgtgacggt cccgagcttc tcccgctggg
    48241 cccagtctca cgccagcgag ctcgatcccc gggagattcg cgacagagtt acaccagcga
    48301 ctgcaccttc gttcgtggct gatcatgcct cggctctatt ggcctccctc cagaagaagg
    48361 cctccgacac cccctgtggg aatcccattc agtggatgtg gtaccgcctg ttggtaaact
    48421 cgtgcctgag gagtgcccac tgtcttctgc ctatacctgc cgtctctgag ggggggagaa
    48481 agacgggcgg gggcgtaggg gaggagctcg tgggggccgg ggggccctgc ctgagccggg
    48541 atgttttcgt ggcgatcgta agccgcaatg ttctctcgtg tctgctgaac gtgcctgccg
    48601 cgggtccccg ggcctacaag tgtttcagat cccacgcctc cagaccggtg tctggcccgg
    48661 attaccctcc cttggccgtg ttttgcatgg actgcggtta ctgcttgaac tttggaaagc
    48721 agacaggtgt aggaggcagg ctcaattcct ttagacccac tctccagttt tatccccgtg
    48781 accagaagga gaagcatgtg ctgacctgcc atgccagcgg ccgtgtgtac tgctccaact
    48841 gcggctctgc ggcggtgggc tgccagaggc tggctgagcc accgagcgcc cgctcgggct
    48901 ggcggccccg aatccgggca gtgctgccgc acaacgcggc ctacgagctc gaccgtggct
    48961 cccgcctctt ggatgccatc atcccctgct tgggacccga ccgcacttgc atgcggccgg
    49021 tggtcctgcg gggggtgacg gtcaggcagc tcctgtattt aactttgcgg acagaggcca
    49081 gagccgtttg ctccatctgt cagcaacgcc aagctccaga ggacgcccgc gacgagcctc
    49141 acctgttctc ctcctgttta gaggtagaat tgccacctgg tgagcggtgt gcgggctgcc
    49201 gtctctatca gacgcgttat ggcacgccgg ctgcccaagc ccaccctcca ggggaggctg
    49261 gaggcggatt ttccagacag tcccctgctt cctaaatttc aagagctgaa ccagaataat
    49321 ctccccaatg atgtttttcg ggaggctcaa agaagttacc tggtatttct gacatcccag
    49381 ttctgctacg aagagtacgt gcagaggact tttggggtgc ctcggcgcca acgcgccata
    49441 gacaagaggc agagagccag tgtggctggg gctggtgctc atgcacacct tggcgggtca
    49501 tccgccaccc ccgtccagca ggctcaggcc gccgcatccg ctgggaccgg ggccttggca
    49561 tcatcagcgc cgtccacggc cgtagcccag tccgcgaccc cctctgtttc ttcatctatt
    49621 agcagcctcc gggccgcgac ttcgggggcg actgccgccg cctccgccgc cgcagccgtc
    49681 gataccgggt caggtggcgg gggacaaccc cacgacaccg ccccacgcgg ggcacgtaag
    49741 aaacagtaga gggcacgaaa catggtgtat gcactttatt aataaacaat tacagataca
    49801 aaaacttgag tctctcgagg tctgcgatga ggcggtgggt ggaacgctcc agcttgcggc
    49861 gaagctggct cacgaagcga gacagtactc ggctagcctg actaagggtg aggctataac
    49921 gcaggtcctg ttccggggcg gcggtggata gagaggaggg ggatccggag gggaccacta
    49981 ggtcgccgga ggtcgaccct cctgtcacca cctccctgat aatgtcttca atagacagaa
    50041 attgggtgac cactgaggga gtgttccaca gtaatgttgt ctggtcgcta gatggcgcgg
    50101 gtgaggccac gctttgcgaa aacgaaagtg cttgaaaagg cgcgggatag cgtgcgctac
    50161 cggatggcgg gtaatacatg ctatccttac attttggcat tttgggcagc tgggaggcgg
    50221 cggatggggg tgcttctttt cgcacggtgt atgtttgggg acccgcatgc cggtactggg
    50281 ataggcgcac ctcgggccgc gcgccaggct ccgagccgga atgcattggg ggcaatggga
    50341 ttgcggggga ttgttgctgt ctgctcctga cagggagaga cacgcgcggc ggagatgcag
    50401 ccgacggcgg ggccgcggtg ggctgccccc gaggacgggc gccggccgcc agcgcccccg
    50461 tggcctttgg cacgggcctg gcacccaccg ctttaattgt gggggtgggc agggcagctg
    50521 catcttgggg cctttgtgct tgcgtttttt gggggcgcgg tgccaatgca ccaactgggg
    50581 tgtgcgccgg ggcggccaag ccggacccca gggcgggtgc ctgggggatg ggaaagccgg
    50641 acggcgcttc tcccgggtcg aacgctggag tagcggaggc tgctgcgccg gcggccacca
    50701 cgggcgcacg gggtcgcagc ccgacggccg tggggaggcg ggtggcggag ggccgaatct
    50761 ccgcggcttc ttcccggccc ccctgctgtt tcttctcccg ttgcatgata gaatggccat
    50821 agggtgggtc ctgagaggag gcttgtgtgt cctggggctg gagcccaaaa gtcgttaaag
    50881 atgccgctga tggtgtggga gctatgcctc ccgtcgactg gccgggcttg tagggggctg
    50941 agggtggata actgggcttc tgtgaaggca ccaaccctgg aatctggatg gtatgtttct
    51001 tctgtgaccc cgaggcagtc gatggtgtag agtgtggaga caatgtgtag acgatgggcc
    51061 cttgttcaga agcccaggga cttgaggggg gctgttgtgg tgctggttgg ggaaggagct
    51121 ccagggaatc tttgggccat ggccttgggg agcttcccgg agaccggtct gggctctcgg
    51181 aagccctcgt ttcggccccg aaatagggcc ttgccatcaa tcgggggcct gggagagtga
    51241 tgggggcggc caatcccggg gtaactgtca cgtcccgggg ggaggaggta ggagacagcc
    51301 agtccctggg cctgccaggg gccaccttct ctaagagggg gctctgtggg ctgggagggc
    51361 cagaggcctc agattcagca gtagtgctcc ccttttcccc ctggtccgtc tcccctcctc
    51421 ccaactgctg gagccggtcg gaggaggccg gggtgttatc tgctgactga aacccgtccc
    51481 cgctgaccag tccgtgcccc acccttgggg ggaaaccgga gaacagctcc tggacgttgc
    51541 gtggattcgg gggaagctgg tatccaaccg gcagtggagg atcttcgtgc tcgtagaagg
    51601 aggggttgag tacatcggtc ggccatcgtg aggccccggc cgcgttaaag tagaactgca
    51661 cgtccggcag attgtgccga taggtgaaac acttccagat gatgtttttt ctgttggcca
    51721 ggatggccac ggtggggggc ctggcctcct taggtttggc ggccctggcc tcggtgagaa
    51781 gctcgcgtag ccacacggcc tggcgtgcaa agatggacat ctctggctcg aaagactcgg
    51841 agtagccgtc caggtcctgc agaaaattca gcgagatggt ctccaccagg gaccggaagg
    51901 gctcagagtg cccgtcgcag tagaggaggg gagcaacgac cctgacctgt cccagggtct
    51961 tcaggttaaa cagatattga gaggagacaa agagagttag gggccgaccg aggaaggccg
    52021 ccgccacggc cgcctcaaaa acggagacgg ggatggtgtc accggagccc ctcttaggac
    52081 cggtaatggg agtgccataa ggcataagat ttctcagggc ccggccggta acggtgccgt
    52141 aggaagacgg ggtttcgcgg gggacctcga gtccctccgc cctggggagc tcttctccgc
    52201 gtgtataggc ctgcttcaca aagtcgcgca ggtagtcctg aaatgcgacc gggccctcca
    52261 gcgggcgcaa tgagtgccag agctgctgaa gggcctcggg ggcgaagcac cggcgtgcga
    52321 ggagcagcat gcaggctcgg gcgcgggccg tactttggtt gtggaccagg cccaagaact
    52381 cggggtgcgg ccagagggcg gctcgggtat ccatctcctc ccaggcgtcc tggaagaaga
    52441 tgaagccggt gggtggaccg gcgatgcggt ggcgggtgag gcggcgcgcg tcttccccgt
    52501 cgttgctgcc gcgggtggtt gagggcatgc cccccctccc ggaggctgga ctcctgacca
    52561 gcctgtaggt gaggaccgag tccgacagga ggtctcccaa acccccatct ctcgctagag
    52621 ccgagaccag gccgagtcct gcgtagaacg atggggcgcc caggaaggcg gcagcgtagg
    52681 ccggatgtgt gccgaccagc agcgccatca tctcccgttg ttccaataga ataacttccc
    52741 ggtctgtggc cggggctgga taaggggggt gattcctaga ggcgatgaga ctggcgtgcg
    52801 ctaaaagtgt catggccaca atggggttgt ctgccaggtc ttccatcagg gctttgggcg
    52861 cagagacgta ttcccgaagc agctccccgg cgttggactc cacgtcgggc caggtgtccc
    52921 agtaggagtc ggcggcggcg gcgctgaggc gggcggaagc tacactggcc agggttcttc
    52981 tcctcctctc ttggtcatcc tgcgggggac caatagcttg ggggcgtccg gctggggtca
    53041 gggaaaaggc ctctgggttc tccagcacgg tgggcatgac atattccaga aagttgtggt
    53101 agacggggat gtagttgagc ggctcctggg tgtctgcgga gacgtaggcc gggttaaggg
    53161 ggtcgcaggg agactctgtt tccagccaga gggtgccggc gtatttcgcc ggccctgccg
    53221 ccgccagaaa ttgtgcccgc cgggtcgggg ctccattgcc ccatccagtt ggtggtgccg
    53281 aaatcgtgat gaggaggggc aggttgttgg tcaagggatg cttaacgaaa acggtaggct
    53341 gggcggtctc gtaaaaagcc aggaaactct gcttggccga ggcatagcgc agcagcttgt
    53401 ccttgaggag ggcatactgg gagccagccg aggccccaag cgccaggccc ctggcagcct
    53461 ccaccacgat cttgagctgg cgcgggtcgg tgtggcccct ggcctgggtg accagatcct
    53521 gcagcgttcc ctgcagctgg gactcttcct gggcctcctg gatgatggcc tccagtcggg
    53581 agaggcgcct tttccagtct gcgacggtct ccttgccccc cgcgacccgc ttggggtcca
    53641 acgtggccag agccaacctc agctcctcca tgccatccat ggagttctgg gccatgccct
    53701 cgacttccag gagccgtgtt agctcatgaa tttcaccgtc agccgcagcg gctaggttca
    53761 gccaggcacc cgcgccccca gctaaggcca gggctccttc ggaaagaccc cgcacggcct
    53821 cgcagatgcc ccggatccac ttggcggctg ccagggattt ccggtagggc catgagccgt
    53881 tcccggccgc tgcccgggcc agggcggcct cgaggggagc ctggacaggg gctttgggcg
    53941 gggagggaag caggctccgg agttcatcgt cgggggcttc gtcgcgtgac ctggagagga
    54001 cggcctccag agccgtgtga aagccccgcc gagtgcttgc cgccatctcg tgggccttcg
    54061 ccatcagggt ctggctctcc cggacctgct cttccagcgc ccggacctcg gccgcctcgg
    54121 cctcggtcag cagctccgag aagaagtccc ccgtggcctg gaggagatcg tcccgctctc
    54181 gccttgtcag cagctggggc ttcttaggcc agagcgccga gtccgaggcc agcctgggcg
    54241 gggcggttgc ctgggggata gttggaggag gaggcaggtt agcctggcct gggtcattag
    54301 tggcttcggg tagcgtccga tccacgtact cgctcacgat ggccgtcagg gcagcctcgg
    54361 ctgctcgtct tttttccaga agcccggcca gcccccgctc gtactccgcg tagggggcct
    54421 ccagatccgt gttgaccacc gctgatttca tgtccgggga ctgcagggcc tggcgcgtct
    54481 gcgcgagggc cgaacggatg gcatcggccg ccgtcctggc gcgaaagagg gccccggccg
    54541 cttcctccgc tcctcgccct cctcctcctt ctttggcggt agccgcgggg gtggcgggcc
    54601 aagcgtccag tctggccaga gggccggtct cgatatccgt gaaccagccg ggttccgcgg
    54661 cctccattct ctccgccgca ccaccatcgt ccacgagcag ggatcgcagt ctctccctcc
    54721 tcaccctcgt tattcccaat agcatagcgg caaggatctg tgtgagggag tccaagatgt
    54781 ccgtgtttct ggctactgcc gccgctgctg ccgcggctga gtccgtattg tctggcagca
    54841 gggaggccag cagggtgttc cagtcatcgg gcgaagtggg agcgggctct gggcgtgccc
    54901 ccagcgcctt cctaattctg gcccaggcct cattcgcctc tcgcgctcgc cgctcctgcc
    54961 tctccttgtc ttcctgttct cggagcttct ccttttcctt gcgcccggtc tccataagct
    55021 gccgcagctt cttctcatac tgtcgcttga gctctttgtt gggggcagtg tccagaaagg
    55081 cctcgagctg ttcctcggtg gcgggcttaa agccttcggc ctccaggcgc caggcctgca
    55141 cctccttctg tctgagctga tcgttgttgt tattcttcaa tttctgcagg taacttagga
    55201 agcgtttctt gagcttccct gggatgagcg tttgggagag ctgattctgc agcccagaga
    55261 gtagtctcag ggcatcctct ggagcctgac ctgtgatcgt cgcatcatag accgccagta
    55321 gacctgggag cagattcacc gccgcggccg tctcctttaa ggtgctgtga gtagcaaaat
    55381 tctgcaaggc cactaggcgc gctggctcca gcgtcagccg gttgcccatc tcgaatgtgt
    55441 gcagggcctc tgagaccatg gggtccagga tgcggtcaat gccatcctgc acctcagggt
    55501 caaggaccgg caagtcacga tagaggtggt ctatgctctc ctcgaaggag gcaatgtagt
    55561 tatcgatggt gtagaaggtg atggatttca ggatgttcat caggtacttt ttggagcgaa
    55621 caatctgctg tatagtgtca cgtaggcgga tgtacgtggg gttctttgcg gccccgacta
    55681 tcgaccctgc atttgcgatg tacttttcta tgacggggat ggtgagggcc gcggtgtcgg
    55741 ccagcggtgg cgtggcttcg gggttgtcgt ggttggcggg tgtcgcagag ggagaggcgg
    55801 gagagatggg ggcgcctggg gccgaggcca caccggccag gcccaacatt gcctcgatgt
    55861 cgtccaggat ggtgcggagg cgcttttcgt tttctctggt ggtctcgagc tccttctgtt
    55921 ttttcgcgac tgtctcaaac tctggaaggg gggcaatgct ggggtcgtcc tcctcaactc
    55981 gctccagggg ccaggggata ccgctcatat cactaagggc ggtgcccagg tagaggagct
    56041 cgcgatagtc ccattcaatg gacgtgtacc ggatgtttag gagaggcagg gaggcgatga
    56101 tctggcatgt gtgccgcagg tgtgtcagga ggtcgtcaaa atccatcact gttgggaggc
    56161 ttgggtcctc aaggtaggag agataatcgg aggccgccga ggccaccttg tccctgatgt
    56221 ccgccgtaca cctgcgcacg tgcagggccg cattcttgga ccggacggcc acgttgtgga
    56281 caaagggggg cactgaggcg gcgggagggg ccccatactc tatcgctgtc aacagcgcca
    56341 aaaagcggac gtcctcctca tctaccccag cctgttgtct ggccacggcc gttcgggcgg
    56401 cctccgccag ggataggagg cgcttccagc tttcgtcgtc caggaccaag gggacgtcca
    56461 cgtgcgggcc cctgtagatg gaattatcct cgggttctcc tcctccttcc cccgcctcct
    56521 gatctccgcc cgagagcagg tcggtcaggc gtctgcgggc cgcctccagg tcaaattttc
    56581 catcgtcgct ctcggccagc tggggaattt cagccagcat cttagcaccg gcatctacac
    56641 ggaccgcgtc cttcgtggcc agggacggca ggcaggcctc cagctttgcg gccaggtgct
    56701 tatggaactc tcccgctctt cccttgtttt ctgatagcat gtttgcgagg ttttggatgt
    56761 taagttcgga agtgagcagt tgctccaggt ccagcgtggg gacctgcaga tgtcccgacc
    56821 agtcctttaa gaattccagc agatttagca cagacgatcg gtccctactc cttattagcc
    56881 cctgctcgag gaccactgtc acaagaagat agtctatcat gctcaaggca tctgcctctg
    56941 gcacttcccg gttagaggcc gggtcgtaga cgatggcctg ttcctggtag gtatgtccgg
    57001 ctattctcgc aatgttgctc tcgaggggca caaagtccat ctcaggagtc tctatgtcaa
    57061 aggtggtctg atagtattgg ctcctggcgg tgtccagtgt gatgggggac gtgggggcac
    57121 tggatcccga ttccaggctg ttggagaaca cttcatcttc gaacatgtct tcatcctctg
    57181 tggtggggat atcggaggct aagtcgctct ccgcttcttc agagtcggac atggatagga
    57241 aaggctcctc taggtcagac aggtagcgga cgaggccaga acccccagat gcatcatccc
    57301 caaaggaggg ctgctgcccg aagggaggtg atggggatat ctccgttcca gccctgtcag
    57361 cggccggggg atggtttttt tctggttcga gtgtcgtggc tgatggtggg agctgctgag
    57421 caggaggagg agccggggta gctgatggca ggggctgctg ctgaggagga agaggagaag
    57481 gagcccgggc ggctgatggc gggggctgct gctgaggaag aagtggagaa ggagccgggg
    57541 cggctgatgg cgtgggctgc tgctgaggaa gaagtggaga aggagccggg gcggctgatt
    57601 gcgggggctg ctgctgagtt ggaggaggag aaagagtcgt ggtggtgggg gctgctgctg
    57661 cagtcgggga aggggatggg gtggtcagag ggatttttgg gttcgaggga gctgcctgtg
    57721 gcagagggat gggtatttgc aaagggaggc gaggagatgg agtgactgaa ggagcgatag
    57781 ttgagactgg cgcggggtgg ggtgtcgggg aggcgggtgg tgattggtga gggatgggga
    57841 ttactggagg gggaaggcga gctgctgaag gggggcgatg gggcggaacg tgggtgcgtg
    57901 gcagctgatc atcctctgtg tcagtggtgg aggacagagg gaggcggcgg ccggaggtgg
    57961 gcttcttgtg ggggctatct ttgcccaatc cctttttcct cttgggagtc tgaggcgctg
    58021 cgccgctcga cgcccttggt ggcgtggagg gagcggggac cccgggggtg tgacctaggc
    58081 cggggatggg gatgaagagg ggagggctgg aggccggggc cgcggaggcc ggggccgcgg
    58141 aggccggggc cgcggaggcc ggggccgcgg aggccggggc cgcggaggcc ggggccgcag
    58201 aggccggggc cgcagaggcc ggggccgcag aggccggaga cgacggcggg gagttggtct
    58261 ttgcaggact atacctggcg gcagggaatg agtcggatgt gaaagatcga gagggcagtg
    58321 gcctgaggtt atacggtatt attcgccgtt caaacggtag catgacggga gggctgctat
    58381 cagcaccggg cgtccccgcc gcctccccat cactggacac aagctcgggc cccaccaggt
    58441 caaagccgct gccgttggcc tcataaaagt catacacgcc atagtgttcc agcataaaga
    58501 tgcgggggtc ctctgtctca aaggcctcgg gtagaaaata gagatgcacg caagtgtact
    58561 gggcccctgg tgcccccacg tactgcagga tgtcgtgcgc ataggtgctg actctgacat
    58621 gggcgggggt gcccggggcc gcatccttct ggcagtgggg gtcaaacaag tagaaggagc
    58681 catctgtctc gatgatgatg gcccccgcgt agatgtcgca gatgtagagg atgaactggg
    58741 ccaccccgtt gtaactgccg tgcaggacct cggccaggga ctgaacaact gccgagtttg
    58801 cgatctgggc agggaatagg acgaggccaa agatctccgc cgagcggtat atgtgcacgc
    58861 gcccaccgcc cctcaggacc acggagctgg gcacgtccgt caactgggcc atctcgtgcc
    58921 ccttgaggat gccgctctgg cgcatgaggg catccagccg cgccccctcg tccaggacct
    58981 cgtccagctc agggcgggag gtcagggggc ggccggccag gaagctcttg accaggtaga
    59041 ggacgcagtt gctgacgcac tggatgccgg caaagcggcc aaacttgcag tgggcctggt
    59101 tgcacgaggc cgtgcctagg atgcggaggg ccgagcctcc actcccgccc ccgggggcat
    59161 tcacatccat ggtcctgatt ccgcgcacgg ggccggttcc ccgggtgcgc tggctttgcc
    59221 cccagtcgcc gttactcatc ttcggcggtg gggcggggag gacgccttgt cgcccccctt
    59281 ctggtccggg gtcttacgcg gctggcggcg gcagccgccg agagataagg ggggtacgtg
    59341 tgtgcctccg cctctcctct gtctgggccg ccgccgccgc ttgcccgcct tgaaggagag
    59401 ggggtagtcc gcggactgcg tctgcggggg caggaggtct caaccttctg ggctcgggcc
    59461 gcggtgtcga tatccgatgg cctttccctg tcttcctcgt atgctccttc tcctcctcct
    59521 cccggcacgc ccctgagatc tgcctcccct ccctctccct cgtcctggtc ggaaaagtct
    59581 gaggaggaga aggagaatgg ggaggagtcc aaaacggcac gccacctgcc gtggggcggt
    59641 ggtgacaggt cccggctggc ccggcgcttg ctcgcgttcc tgccgttacc caggagaatg
    59701 gccgcgagtt ttttggcggg gaggatgcgg aatggcgggg gcgtttgtcc cacgggtgag
    59761 ggggaatcgt cggttagggc cggcacgagg tggtgggtct ggacccgggc cgtgcgagca
    59821 aaggcggcga gaaccgaggg gcttctgggg gtgactgtga tctgttccgg atttaggtcc
    59881 atggcgggtg tgtatgtttt aataggggtg gtctctggcg cggcaggatg atggtcgagg
    59941 acgtccacca gggccttgca gatgctcttg cctagataca ggatgtcgtc catgctgagg
    60001 ggaggtgggg tgtctgctcc cccctgcgga agccgcctgg gtgcggggat gaagacaggt
    60061 ggtgggcggg cgtctcgccg gactatggcc tcggcacgct cggcgtcgat ggcgggtggc
    60121 tggaacaggc gggcgaatgt gtaatcccgg aaccggtagg cgacgctgcg cctgagggcg
    60181 cccgtcaggc tgtatcccag ctccagggcg tgctccaccc gctcgttgag ctcctcgaga
    60241 tccggacgca ggggctcgct ggtgtgggcc cagagggggt gatccgcgat gccccggctc
    60301 tccctgaggg ccggcaccag gaggcgcctt ctgagggtgg ccgtgtcggc cgtggccagg
    60361 gcccacctgg cggcggcgtc ccggcacaca tcctggatgc cctccacgac gctctttagc
    60421 gtctggaggt ccgtggagta gtggcggggg gaggatgaaa cgctcttttc cttcaccgct
    60481 accaccgcct cctcctcctc ttccgtcgcc agagggatct gcaccctccc ggtctctgcg
    60541 tcgtacagga gcgggcggga gcacagcctc caagctgccc ccgtcaagcg cgagatgtcc
    60601 tccgagaggg tctcacccga gaccagaaag cggcgggtgg ccaggcccaa cgactccgcc
    60661 gtcgtgctgt atctcagggt gaagaggagt gaaaagaggg aggtgggcca ggcaagcggt
    60721 ggtgcttccg ccgcccgctc tgaagctgag atagtctcgg agatgatgcc tgagacctct
    60781 cggacggcgt ccatgatcct aaggactgcg tcgtgggacg acagccccca ggggcccccg
    60841 ccctcttcgt cttctgcacc ctcggctcct gcgtccccgg ccttgccttc cccctctaag
    60901 ttgagggggc gcagtccgac cgcctggggg gactccccag gcatcggagg ggccccgtca
    60961 tagatctccc agacggtggc gtatatgagc tcgagaggac ggcgggcccg ggtcagctcg
    61021 ggggaaggga gggccaggtc gctgccgaag gagaccagcc agcgcagggc ggccagagag
    61081 cgggttttgg gcagctcgtt ggagaggacc cggcgaaggg cgggccagat ttggaactcg
    61141 atgaaggcgg ccgggaagaa ggggctgtgg acataggccg gatccgcgcg cgccgtttgg
    61201 ccggccctca gggaccggca gtatgcctcg acgtctgtcc gcggggccgc cgccaccgct
    61261 gccgtccact gccttcttcc ctgctcgccg gggagtaggg ggggcttaca ggggagggcc
    61321 ggagccgggg ccggggcctg ccacaggcgg ctgtagcgga cccatagcag agacctgagg
    61381 agttcggatg aaaggtcccc cgccacctgc tcatactcgg ccgcgggagg ggggacgatg
    61441 aagatgcgca gaggggttac ggcgtcccaa gggtccgccg ccgcccccac acccacagcc
    61501 gtcgcggcgg gggcggcggc gggcgtagag gggccgctgg tgcgccgggc tcgtctgtcc
    61561 acggcctcgg cctccgcccg caggtaggcc gcccgggcca cacgggcgaa gcggctcgtg
    61621 gggctcgcgg tgggcagcag tcggaaaaag tgcagggcaa agcccgatag actctctagg
    61681 agggcggcgg tggcctcgag ccacctccac cgcgagcggg acacccgggg cacagaggcc
    61741 agcatcatgg cgtagtcccc cgccacggtc tcgttgagcc cggccgagag cagaaccgtg
    61801 gccacctgct cgatggcggc tggagagaag gatgcccggc tccccgccgc ctcctgcaca
    61861 cgagcggcca gggcctccat ctctgccgcc atcccggcca ggaaggcctc gatgaccgag
    61921 tctgggacgc cgtaagtctg gtcccagagc agggcctcgt acacatagtc gtaaaagagg
    61981 gcccctgagg gctccaaaag ccggagccgg gcggcgtcaa aggccaggac gggcacagcc
    62041 gcgacggggg gcgtttgtcc cccgctggcc tccgcgtaca cgcccaggat ctctaccgcc
    62101 cgccgccggg ccaggggcag cgaggccacc acgctggaaa gtgactcggg gcggtgaaag
    62161 agaccaccac cgctttcttc accctctccc ccgccggccc cgcccccact gtgctccacc
    62221 agctccacgg ccatggcctt gatgtccgcg gccgtgggct gaccctgccc tgcagccgcc
    62281 caggggtagc ggttggtctc cgcgtatacg gtgaccagcc atctccccag cgtcgttttc
    62341 gccgcgttaa aagcgtagaa tgacagcccc tcccgcggga aggcgtccca ccgggccaga
    62401 taagtgtcgg ccaccagctc ttccacgaag gcaaaggtgg ccgttgggcc agagaccgcg
    62461 agcacctccc cgctgccctc ttcgatgatg cgccggtacg cggccgccag ggcccgggtc
    62521 tctgcgatga gccgagagcc gtccagcgga tcgtcggtgg ccggagaggc tgtcgtgggg
    62581 ggcagtgagg atgccagcac gtccagggcc gcctccagat ggccgaggcc gaagctgcgc
    62641 ctggaaaagg aggccgcccg gagtaggtag taggcgtggt ggcggaggac cgccgccggg
    62701 taagcgtggc cgctcatgag ggtgagagta tttaaaaaat cgcgcaccag caccggctgg
    62761 gccaaatccc ccagtccaaa gatccccagc tccagaggca tcagcgcgcg caggcgggca
    62821 gcggggtcgt ccccagacag cagcaactga cgcgtcacgc gggcgagccc cccgtccacc
    62881 tctgccaggg gtggctgggc gtctgcccct ccgctaccgc cgctgctgtc actctccata
    62941 gcggacgcca tgaaggtcca ggggtccgtc gatcgccgcc gtctgcaacg ccgaatcgcg
    63001 gggctgctgc cccctccggc ccggcgtcta aatatttccc gggggtccga attcacgcgg
    63061 gacgttcgtg ggctggttga ggaacacgcg caggcctcct cgctgagtgc ggcggccgtc
    63121 tggcgcgcag ggctgctggc cccgggggag gtggcggtcg ccgggggtgg cagtggaggg
    63181 gggagcttca gctggtctgg gtggcggccg ccagtctttg gggactttct gatacacgcc
    63241 agctccttca acaacgccga ggccactgga acgccccttt tccaattcaa gcagagtgac
    63301 ccgttctcgg gcgtcgacgc ggtattcact cctctctccc tgtttatcct aatgaatcac
    63361 ggccggggtg tagccgcccg ggtcgaggca ggtgggggcc tgacgcggat ggccaacctg
    63421 ctgtacgaca gccccgcaac cctggctgac ctggtcccgg actttgggcg gctggtggcc
    63481 gaccgccgct tccacaactt catcacccct gtgggccccc tggtggagaa tataaagagc
    63541 acctatctga ataaaatcac cacggtggtc cacgggcctg tggtcagcaa ggccatccct
    63601 cgcagcaccg tcaaggtgac ggtgccccag gaggcctttg tggatctgga cgcgtggctc
    63661 tccggcggcg ccgggggtgg cggtggagta tgcttcgtcg gggggctggg cctgcagccg
    63721 tgccccgccg atgcgcgcct ctatgtcgct ctgacctatg aggaagccgg gccgcggttt
    63781 acgtttttcc agtcgtcccg cggccactgt cagatcatga atatcttaag aatttattac
    63841 tcaccatcca tcatgcaccg ctatgctgtg gtccagcccc tacatataga ggagctaacc
    63901 ttcggggcgg ttgcctgtct ggggacattt agtgctactg acggttggag gaggtctgcc
    63961 ttcaattacc gtggctctag cctccccgtg gtggagattg acagctttta ttccaacgtc
    64021 tctgactggg aggtgattct ctagacttaa cgggaggaaa caggaggagg agggggacaa
    64081 gagcacaaaa gtggttcagt ggacacccac cacacagcat ggcaacgacc agtcatgtcg
    64141 agcatgagct cctctccaaa ttgattgatg agttaaaggt caaggccaac tcagaccccg
    64201 aggctgatgt cctggccggg cgcctgctcc accgccttaa ggccgagtca gttacacaca
    64261 cagtagccga atatctggag gtcttctctg acaaattcta cgatgaggaa ttcttccaga
    64321 tgcaccggga tgagctggag acccgagtct ctgctttcgc gcagagcccg gcctacgagc
    64381 gcatcgtctc cagcggctac ctgtcggccc tgcgctacta tgacacctat ctgtatgtgg
    64441 ggcgcagcgg gaagcaggag agtgtgcagc acttttacat gcggttagcc ggcttctgtg
    64501 cctcaaccac ctgcctctac gcgggtctca gggcagccct gcagcgggcc aggccggaga
    64561 ttgagagtga catggaggtg tttgattact actttgagca cctaacctcc cagacggtgt
    64621 gctgctccac gccctttatg cgctttgccg gggtggaaaa ctccactctg gccagctgca
    64681 tcctcaccac ccccgacctc agctccgagt gggacgtgac ccaggccctc tataggcacc
    64741 tggggcgcta cctctttcag cgagccgggg tgggtgtagg ggtgacgggg gctggccagg
    64801 atgggaaaca catcagcctc ctgatgagga tgatcaacag ccacgtggag taccacaact
    64861 atggctgcaa gaggccggtc agtgtggcgg cctacatgga gccctggcac agccagattt
    64921 tcaagttttt ggaaacgaag ctgccggaga accacgagag gtgcccgggc atctttacgg
    64981 ggctctttgt ccccgagctc ttcttcaagc tttttaggga cacgccctgg tcggactggt
    65041 acctgtttga ccccaaggac gccggggacc tggagaggct ctacggggag gagtttgagc
    65101 gcgagtacta tcggctggtg acagcgggca agttttgtgg gcgggtctcc atcaagtccc
    65161 tgatgttctc tatcgtcaac tgcgccgtca aggccggcag ccccttcatc cttttgaagg
    65221 aggcctgcaa cgcccacttt tggcgcgacc tgcagggcga ggccatgaac gccgccaacc
    65281 tgtgcgccga ggtgctgcag ccctcgagga agtctgtggc cacctgcaat ctggccaaca
    65341 tctgcctccc gcgctgcctg gtgaatgcgc ctctggcggt gcgggcacag cgggccgaca
    65401 cgcaggggga tgaactcctg ctggccctcc ctcgactctc agtcacccta cctggagagg
    65461 gggcagtcgg tgatggattc tcgctagccc gcctcagaga tgccacccag tgtgccacct
    65521 ttgtggtggc ctgctccatt cttcagggat cccccactta tgattccagg gatatggcct
    65581 ccatgggcct cggggtgcag ggcctggccg atgtctttgc ggacctgggc tggcagtaca
    65641 ctgaccctcc ctctcgctcg ttaaacaagg aaatattcga acatatgtac tttacggccc
    65701 tctgcaccag tagtctgatt ggacttcaca ccaggaagat ttttccgggt ttcaaacaga
    65761 gcaagtatgc cggggggtgg tttcactggc acgattgggc aggaacagac ctttctattc
    65821 ccagggaaat ttggtctcgc ctctctgaac gcattgtgag ggatgggctt ttcaattcac
    65881 agtttatcgc cctgatgccc acctcaggct gtgcccaggt gacgggctgt tcggacgcct
    65941 tctacccctt ctatgccaat gcgtccacca aggtcaccaa caaggaggag gcccttaggc
    66001 caaaccggtc tttttggcgt catgtgcgtc tggatgacag ggaagctttg aatcttgtcg
    66061 ggggccgtgt ctcctgcctc ccggaggctc tgcggcagcg ctacctgcgt ttccaaacgg
    66121 cctttgatta caaccaggag gacctgattc agatgtcccg ggacagggcc ccctttgtgg
    66181 accagagcca atctcacagc ctgtttttgc gtgaggaaga tgccgcgcgg gccagcacgc
    66241 tagccaacct actggtgcgc agctacgagc tgggcctgaa gactatcatg tactattgtc
    66301 gcattgagaa ggccgccgat ctgggggtga tggagtgtaa ggccagcgcg gctctgtcgg
    66361 tgccgcggga ggaacagaat gagcggagtc ccgctgagca gatgccgcct cgtcccatgg
    66421 aaccggcgca ggttgcgggg ccggttgaca tcatgagcaa gggcccaggg gagggaccag
    66481 gtgggtggtg tgtgcccggg ggattggaag tgtgctataa gtaccgtcag ctcttctcag
    66541 aggatgatct gttggagact gacggtttta ctgaacgagc ctgtgaatct tgccaataaa
    66601 cgtttattgc catgtccaag ttgttgtacg tgcgtgatca tgagggcttt gcctgcctaa
    66661 cggtcgaaac ccaccgcaac cgctggttcg cggctcacat tgtcctcacc aaggactgcg
    66721 ggtgtctcaa gctactcaat gagagggact tggagtttta caagttcctc tttacgttcc
    66781 tggccatggc cgagaagctt gtgaacttta acattgatga actggtcacc agcttcgaga
    66841 gccacgacat tgatcactac tacaccgagc agaaggccat ggagaacgtc cacggggaga
    66901 cttatgctaa cattttaaac atgctctttg atggggacag ggcggcgatg aacgcctacg
    66961 cagaggccat catggccgac gaggccctgc aagccaagat ttcctggctc cgtgacaagg
    67021 tggcggccgc cgtcaccctg ccggagaaga ttcttgtgtt cctgctgatt gaaggcatct
    67081 tcttcattag ctccttctac agcatagccc tgctgcgggt ccggggccta atgcctggca
    67141 tctgcctggc caataactac ataagtaggg atgagctgct ccacacccgc gctgcctccc
    67201 tgttatacaa tagcatgaca gccaaggctg accgaccaag ggccacctgg atccaggagc
    67261 tgtttcgcac tgcggtggag gtagagactg ccttcatcga ggctcgtgga gagggggtta
    67321 ccttggtgga tgtgcgagcc ataaagcagt ttctggaggc cacggccgat cgcatcctgg
    67381 gtgacattgg tcaggctccc ttgtatggca caccaccccc caaggactgc ccgctcacct
    67441 acatgactag catcaagcaa actaatttct ttgagcaaga gagttccgat tacaccatgc
    67501 tggtggtaga tgacctttga gtcagggtgg ctacttgctc aggtttctgg gcataaattc
    67561 tcctgcctgc ctctgctctg gtacgttggc ttctgctgct gcttgtgatc atggaaacca
    67621 ctcagactct ccgctttaag accaaggccc tagccgtcct gtccaagtgc tatgaccatg
    67681 cccagactca tctcaaggga ggagtgctgc aggtaaacct tctgtctgta aactatggag
    67741 gcccccggct ggccgccgtg gccaacgcag gcacggccgg gctaatcagc ttcgaggtct
    67801 cccctgacgc tgtggccgag tggcagaatc accagagccc agaggaggcc ccggccgccg
    67861 tgtcatttag aaaccttgcc tacgggcgca cctgtgtcct gggcaaggag ctgtttggct
    67921 cggctgtgga gcaggcttcc ctgcaatttt acaagcggcc acaagggggt tcccggcctg
    67981 aatttgttaa gctcactatg gaatatgatg ataaggtgtc caagagccac cacacctgcg
    68041 ccctgatgcc ctatatgccc ccggccagcg acaggctgag gaacgagcag atgattgggc
    68101 aggtgctgtt gatgcccaag acggcttcct cgttgcagaa gtgggcacgc cagcaaggct
    68161 caggcggcgt taaggtgaca ctcaatccgg atctctacgt caccacgtat acttctgggg
    68221 aggcctgcct caccctagac tacaagcctc tgagtgtggg gccatacgag gccttcactg
    68281 gccctgtggc caaggctcag gacgtggggg ccgttgaggc ccacgttgtc tgctcggtag
    68341 cagcggactc gctggcggcg gcgcttagcc tctgccgcat tccggccgtt agcgtgccaa
    68401 tcttgaggtt ttacaggtct ggcatcatag ctgtggtggc cggcctgctg acgtcagcgg
    68461 gggacctgcc gttggatctt agtgttattt tatttaacca cgcctccgaa gaggcggccg
    68521 ccagtacggc ctctgagcca gaagataaaa gtccccgggt gcaaccactg ggcacaggac
    68581 tccaacaacg ccccagacat acggtcagtc catctccttc acctccgcca cctcctagga
    68641 cccctacttg ggagagtccg gcaaggccag agacaccctc gcctgccatt cccagccact
    68701 ccagcaacac cgcactggag aggcctctgg ctgttcagct cgcgaggaaa aggacatcgt
    68761 cggaggccag gcagaagcag aagcacccca agaaagtgaa gcaggccttt aaccccctca
    68821 tttaacacca tgttctcgtg caagcagcac ctgtccctgg gggcctgtgt cttctgtctc
    68881 ggcctcctgg ccagcacccc cttcatttgg tgctttgtct ttgccaacct gctctctctg
    68941 gagatcttct caccgtggca gacacacgtg tacaggcttg gattcccgac ggcatgccta
    69001 atggccgtcc tctggacgct ggtacccgcc aagcacgcgg tgagggccgt cactccagcc
    69061 atcatgctga atattgccag cgccttgatc ttcttctccc tcagagtcta ctcgaccagc
    69121 acgtgggttt ctgccccctg tctctttctg gccaacctgc ctctcttatg cctgtggccc
    69181 cggctggcca tcgagattgt ttacatctgc ccggctatac accaaaggtt ctttgaactt
    69241 gggttgctct tggcctgcac catctttgcc ctgtccgtgg tctccagggc cctggaggtg
    69301 tcggctgtct tcatgtctcc atttttcatc tttctggctt tgggctctgg aagcctggcc
    69361 ggtgctcggc gtaaccagat ttacacctcg ggtctcgagc ggagacgcag cattttctgc
    69421 gcccggggag atcattcggt ggcatccctg aaggagaccc tccataaatg cccgtgggat
    69481 ctgctggcca tctctgcctt gaccgttctt gtcgtctgtg tgatgattgt gttgcatgtg
    69541 cacgcagagg tgttctttgg actctctaga tacctgcccc tctttctctg tggggcgatg
    69601 gcctccgggg ggctgtacct gggccattcc agcatcattg catgtgtcat ggccaccctc
    69661 tgcaccctga catctgttgt ggtatatttc ctccatgaaa cccttggacc cctgggcaag
    69721 accgtgctgt ttatctcaat ctttgtctat tactttagcg gggtagcggc cctgagcgca
    69781 gctatgcgct acaagcttaa gaagtttgtg aacggacccc tggtccatct ccgtgtggta
    69841 tacatgtgct gttttgtctt tactttttgt gaatatctgt tggtgacatt cattaaatcc
    69901 taacgaccgg agtcctgtct ctttgtgttc ttgggggact tgagttagct gtctttcctc
    69961 ttattacatt gggctaacgg gaggaaatga acccaggggt ggcagtggat ggggtcattt
    70021 atgggcaaaa ctcacaggac atgtttgggg agttagcatt ggcgtcggga aacacagctc
    70081 tggcagttat aaccgcacca gctaacagga catgtttggg ggagttggca ttggcgtcag
    70141 gagacacggc tctgtcagtt atcaccgtac catgagtgcc atgtgtgtcc agtgcctaat
    70201 caccgttcct cattttgtgt gcctcctcaa atgttccaga agtcggccac aggggaggtg
    70261 gctgaattag ggccttttcc ctcattcccc catgagaccc acgtggcagg cctaggggct
    70321 acattcgcct cccacgtttc ccttcgcgtg aggcatccga tatgactgaa ttttcgcagt
    70381 ctcttttccc tcttcccttg ttattcccat agaattacag tgaggttaca caggtggaga
    70441 ttcagtttaa ccatttattg atttaatcca ggaacaaaaa acagtcctag tgacccagtg
    70501 cccggagaga gaatggccct gacaagtcgg ctgcatgatg cacttcggca gtcacgtgtg
    70561 tgagtctcca cggcctctgt caaaagggag cttagcgtgc cagggttgta attcttgatg
    70621 tagtggccca ggaattcaac ttcatcgtgt ctccgtctgc agttggcgtt aatgtaggct
    70681 ggggctactg ccgcatatgc tgccaagaga cagaggggct gcttcacata tgagctgctc
    70741 agggtctcca ccaccttgtt ttgacgggcc gtggcacagg tgatgtagaa gagttgcttc
    70801 acaaagttgt agtctcgcgt gttaggaagg aagcagggtg ccagctcttt gagcttggtc
    70861 aggatcacct tgctaagact catggcgcag gccaggagga tgtcttccgc gggagctagg
    70921 ggcaggtcgc cgtggtaggt gatctcctgg agccaaaaga tggtctcttc tagcatggcc
    70981 accagggtgc agagccccgc gttctggatc gcctgcatgc gtgcatccag ccatgtgtcc
    71041 ttgttggttg acttggtgaa aaactcacgt agtgtcttgt agctcctgcg cagctcgtgt
    71101 ctgggttgca ctttctgcca ggctccaatc tctggatggg cggccaccgc cagcatcgac
    71161 tgtaggaacg ggtcttggat gggctctagg gtcagagagg ccagggggct gggcaaggtg
    71221 acaaatgtaa tcttggagac aggcttaacc agactcatgt caaaccacgg tttgttcggc
    71281 aggggcctct ggctgcgttc ttgcctcgcc tgcttccttg tgctcctgcc ggcccctcga
    71341 gattctgacc ggggacctct ggttgctctg ttgcttcggg gagctcttgg agacctcggt
    71401 gctctaggca ccctgggggc ccttggggct ctgggcgctc ttgctcccgg gggcaggtgt
    71461 cggcgcttgc cataactttc atcggtgcag ccatggacct ctccgcgtcg ccttttgtgg
    71521 cctctggtgt aagaggagtt gccagtctcc tccttctcgt cctcgtccct gcacaggggt
    71581 gagcgatgca atgtgactgt cttgtcctgt aggtcccact tctttctggg aatcacaaac
    71641 gatgccgagg taggggttat gaccacgctg gagggccgtg caggtatggc gtgggccgga
    71701 gttggatctt catcctcctc ctctgaggat gaaatctctc catctgtgga gtgttcttcg
    71761 ctgccctcca tagggtccag atcgcagtct gtgttggtgt ctgagaccgc ttcgagttcc
    71821 agaatgtggc tctctgcaga ggggagacaa aaggtggaga ctgccttgag cacctctgtc
    71881 tcaggcaccg gatgcccccg gctccacggc cccggccact ggccggtgta gcttcttacc
    71941 tgcgggatcc tcgttggagg aaatgctgct agttcgggag agtctctgag aaggaaccat
    72001 cttgtctgtc tctacgacgg gctagctggg atgtagtgct gtcttgactg gcctcagccc
    72061 tatttatgat tctggaggcg ggcacgctga tggagaaatg ggcggtcggt tgattggccc
    72121 cacagcgacc ggcgaagcac tgactcatga aggtgaccgt gatggcctgt gatgtgtagt
    72181 agagtaccag aaacaccctc acattcttgg agctggccct gtgggtatgc ctcaggcacg
    72241 caaagttcct gccccgggca tggcacacct gaactaagtt tggcccggtt tgctcaaacg
    72301 tgacatggag aaactggggg aatttgtctt ctggcacagc tgttgccagg gtgctcatga
    72361 gcgagggcca gatgcaggag ctgacccagg cgacgagatc caggcccaga tgtccctcta
    72421 tcatggcgca gacattctcc acggtggggg gcagggtctc gcgggtcctc tggattagat
    72481 agtcacgccc atcatccgcg atgtggtagc agaaggtttt gggggccggc cagcccacgt
    72541 gcagtgagtg atgtaagagg ttttgaatgt tgagggcatt cttaacatag ctgtgcttgt
    72601 cttcctcttc cggatgacag acaaagaggc gcagctgccg gctaagacca ccgcccctgt
    72661 ccaccttgta ggtatgcggc agccggatgc accgcccggc gtgatacacg ccgctgtcaa
    72721 aaagcggggc cccaatctct ttgatcttgt gacgcatgcg gcgcaggcag gccgttaggc
    72781 ccatgagctt ctgcagcaca gacacaaacc cttgtactgc gcttgttccc acaatagcat
    72841 ggcctctagg taggggggtg atgacgcgaa agcccagttt tcccgtgcat atgcaaaagg
    72901 ggagcacatc ttccatatta tccgggtcgg cgggtggaca agctgatttg aaaaaataga
    72961 ctgggtgggc cctggacact ggacccaggc ggcgcatgag gcgcagtacc tcacgccgca
    73021 cggtccggca caggtcatag atttcctcca gcgaccaggg ggcccccttg atctttagat
    73081 ccaggtccaa gaccaggttg cagaccggaa gccggggatt aaagtattca tgccgggaga
    73141 caaagagctg ctcgctcagg ctgttctgtg aatagtacac tggggtgtag gagagggccc
    73201 tggtgagaca cgtgtctggg aggcggcagt tggtcggggt ggagacgacc tccgccaggt
    73261 gggatgagaa ggggtcagcg gctgtcatta caaagtagtg cctgtctgca aaatggcaga
    73321 ggaagaccgg tagccgctgc acccttcgaa ggacggtggg tgggaggaat tgttccttgg
    73381 gattccactg gccccggcag gtggcctggc cggccaagca tagaaaccct tgaagcgtgg
    73441 gggggtatgt gggaccctca tccgcgtgcc agcgcgcgag ctccaccagc tcccgggcca
    73501 cgtccacact gagcccggcc caggcccgca tgagtccgtc atcggggtcg gggtcccacg
    73561 tgtatggggc cgggggctcc atgcggattt tcagctgctg gacacgcaca tgctcagcca
    73621 ggtaagtctc ccgggtgaag taggtgcgca tgtgctccgc aaagcccctg tccaggagcg
    73681 aggggagcac gacgcccccc gaaggcagac acccaatttc tcccatgctc gttaactgag
    73741 agtatcgctt aaaggttccc tcgttgaagc actgtgcgtg ggccaaatag acgtagcgca
    73801 cgagatcggc cgaggccagg ggaaggcgcc ccctgtaggc gtctatcgtc cttgccacag
    73861 cgcggatctc tcgcgagtcc cgccgcagtt tctcgtgtgc aaagtgggca aaagcctcgg
    73921 tctgctccgc ccatgccgag gagccaaaga cctcccccag ctcggccagg gacgtgacgg
    73981 cggccaggct ctgaccagac tcggaagtaa atagctccgt gaggtgcgcc agggtctcaa
    74041 tcgtacaagg aatgccccaa aaatagtaag cagccgtgac tagcacgaac tgggcctcgt
    74101 gggagccaaa ggtgctaatg aaccacctgg ccgagatgtt aacgcggtag atgcggcgca
    74161 gacagcccac gatcttggga cgcagccacg ccacgcggcc tctggcatcc ccctgtggct
    74221 gtttcttagc gctcagtgtg agcagttcca cgaggggcgt gagcgagcgc agggcccccg
    74281 cgcgatctag gtaggtggat agacggtccg cggtgagcgg cgtgaggccg cgcaggaagg
    74341 ggaaggcctc ctccgccggc aggtgcagcg tcagaaccag gccgcagcgg ctctgtgagg
    74401 tcagccgctt cttgggcagg tgaagctgca gttccacgag agaacccgcc acgtggtgga
    74461 ggggcgaggc gttgtggcac aaacaaaaca ggcggaagcc ctcgtcaggc cgcgagagga
    74521 tggcatcgag gatggcctcc gcaatgtcag tgtttgaggc cacaagggcc ttgatgacga
    74581 cgggggcgga cattatttaa gaccgggagg ccccaacggc gggctaaaca gaacgatggc
    74641 cttctatctc ccagactggt cgtgctgcgg gctctggctc tttggccggc ccaggaatag
    74701 atacagccag ctccctgagg agccggagac ctttgagtgc ccggaccgct ggcgagccga
    74761 gatagatctg ggcctgcccc ctggtgtgca ggtgggagat ttgctaagaa atgagcagac
    74821 gatgggctca ctgagacagg tttatttgct cgctgttcaa gccaatagca tcacggatca
    74881 cctgaagcgc tttgacgccg tccgcgtccc tgagagctgt cgtggggtgg tggaggccca
    74941 ggtggccaag cttgaggccg tgcgctcagt catctggaat accatgatct ctctggctgt
    75001 aagcggcatc gagatggacg agaatgggct caaggccctg ctggacaaac aggctggcga
    75061 cagcctggcc ctgatggaga tggagaaggt ggccacggcg ctcaagatgg acgagaccgg
    75121 tgcctgggcg caagagatct cggccgttgt ctcatcggtg accgccccct cagcctcggc
    75181 ccctttcatc aactccgcct ttgagcccga ggtgcccacc cccgtccttg caccgcctcc
    75241 cgtggtgcgg cagccggagc actctgggcc cacggagctc gcgttaacgt agcaaccaga
    75301 ctccacacca aataaacatt ttattggtaa aacaagggat atgaaggtgt cattgacccg
    75361 aggatccaaa ccccctcccc tgtctcccct cgagcgcctc gctcagccca ctatcaccca
    75421 tggccaggct cggcacctcc tcgaaggtgc agctggccca cctaaagaga gatctggggc
    75481 caaggacccc cgcgtcactg tgggggctgt agaaggaggt gaggtggtgc ttgtgaaggt
    75541 aaacaagctg acagaagcgc cggtacttgt taaggaacac ggtctggtca ctaaagttgg
    75601 tcaggctgac gtccacccca ccccggcgcc acctgcaggg cttcactaga ataccctgca
    75661 tggccaggcc cgacctgcca aagattgtcg gcctgtggtg agggatagaa ggggggggca
    75721 cggtgagtgt cactgagacg gtctgatggg ggaagagggc caggtccttt ggcaaagaga
    75781 cgtccaggcc cacgtccccg gggtactggg ggtggttgat gggacccttg tcctcctcca
    75841 tctggggggt ggcatatctg aaggcagcca ggtggatttt gagctccgat ggacgcagcg
    75901 tggagttgta gcgccgctga ttctggagga ttagccggag ttcccccgtg tagccgggat
    75961 cgatgatgcc aacatgagac gtgaccggac gggaggtgct gccccacagc atgagcccat
    76021 gaccctcggg tgggcgggca tagaggccta ggtccacagt tgtggtcttc atcgggcgca
    76081 gcaggatggt ggtcttgttg accaaggtga gccgccctac actagcctgc tggagcaaca
    76141 gcttgtcatt ctggaaggcg tagcgtatgt gtggacaggc ctccatggtg atgatctaac
    76201 agacagggac ggcggcgcta tatataagag cccaagaccc ggctctcttt actgcgaaat
    76261 ggggaaggtc ctaagaaagc cgtttgcaaa ggctgtgcca ctgctcttcc tcgccgccac
    76321 ctggcttctg accggggtgc tgccggccgg cgcttccagt cccacaaacg cggcggcggc
    76381 ttccctgact gaagcccagg accagttcta ctcctacaca tgtaatgcgg acacattctc
    76441 gccttctttg accagctttg cctccatctg ggcacttctg acgcttgtct tagtcattat
    76501 agcctcagcc atctacctga tgtacgtctg ctttaacaag tttgtgaaca cgctgctgac
    76561 ggattagatg gggatattta aaaggggcag caatctcggc tgtttgtact tcttctctgc
    76621 tcgttaaacc aatagcatgt cagctccacg caaagtcaga ttgccttctg ttaaggctgt
    76681 tgacatgagc atggaagaca tggccgcccg cctggctcgc ctggagtctg agaataaggc
    76741 tctgaagcaa caggtcctca gagggggtgc ctgtgcctcg tctacctctg ttccttctgc
    76801 tccagtgcct ccgcctgagc cgcttacagc tcgacagcga gaggtaatga ttacgcaggc
    76861 cacgggccgt ttggcgtctc aggctatgaa gaagattgaa gacaaggttc ggaaatctgt
    76921 tgacggtgta actacccgca atgaaatgga aaatatattg caaaatctga ccctccgcat
    76981 tcaagtatct atgttgggtg caaaaggcca acccagccct ggtgagggaa cacgaccacg
    77041 agaatcaaac gaccccaacg ccacccgacg tgcccgctcc cgctcccggg gacgtgaagc
    77101 aaagaaagtg caaatttctg attaataaat ttttattgac tttatacata ggtctcggcg
    77161 tcatcatatg gtggggtggt gtaggtatgg gatgtagaca agttacgcct aaaggcgcag
    77221 tccgccatga ccagcagcag cagaagggtc agcacagcca gagaggccca ctgcagtact
    77281 agcatggaga ggtttgagaa tctgggctgg gacgttggcg ggactggcac ggtggcttgg
    77341 gctgtggtaa ccggtgggct cgtaaaagtc cagcggggcc gcagtttgct agaagtgctg
    77401 ggaggtagat aggtggtcgc attgtatctc ggtcttggcg tagttgaatc accgccgtaa
    77461 tctgtggtgg gctctgtact tgtccgggct ccatgtcctg tggtgtgctt tccaccggtg
    77521 gtagaattgg cctttccacc tgttgaggtg accgtgggaa ccgccgtctt ttggccactg
    77581 ggggcctggg gcgacgttgc attttggggg ggcgtgcctt tggtgacatt aacctccccc
    77641 ggttttgtgg atgtggaact gtttccaggg cctgacgctt ggctggtggt gcctgggcgg
    77701 ggtgctggcg aactggtgga cacatgatgt gtgctgatag aggctggtgt cacctgtgtt
    77761 atattttcac cacctgttgg gtgagcggag gttagtaaag gcatatgtga cgttgaattg
    77821 tcactggtgg aggggctgag tgtctctggg tttgaactgg gtctcagtga catggaagag
    77881 gttgaacttg aagttatgtt atgttggcct gtggtaacag cactggttgc attttttggt
    77941 tggctggtaa ctactggggt gggacttgtt cctcctaagg tgtggttggt ggcatttgcc
    78001 tgtggacttg tttctcccac agtagggccg gtggcatttg gggttggggt agtcactgct
    78061 gaggtggggc ttgtttttcc caaggtgggg ctggtggcat ttggggttgg ggtagtcact
    78121 gctgaggtgg ggcttgtttt tcccaaggtg gggctggtgg catttggggt tggggtagtc
    78181 actgctgagg taggacttgt ttttcccaag gtggggctgg tggcatttgg ggttggggta
    78241 gtcactgctg gggtggggct ggtggcattt ggggttgggg tagtcactgc tggggtgggg
    78301 ctggtggcat ttggggttgg ggtagtcact ggtgaggtgg agctggtcat gtcgggggcc
    78361 ttactttctg tgccgttgtc ccatggagat ggacttggtg tcaccggtga tgcgcctgac
    78421 gttgtgccgg ctggtgttgg gctggtgaca tccgcggtgg atacagtggg gcctgtgctt
    78481 gcaggtgcgg tgaggttggt aggcacgtga gtagagctgg gtagacctgt cgttgtattg
    78541 ggatcagcaa atccagttgt attcaaggta ggggaggtgg tggtgctctc gggtgccttg
    78601 gagaatataa ccttgtgggt tgttgtggtg gcattggtag ccgttcgtgt gataatgagt
    78661 gtcttggggg ccgtgccaag acccgagaca gtaatgtcaa atgtccgatt gctcgcaaat
    78721 gcaccagaaa tattttcaca acccgaaggt gtccccgagg tgagagtcca tttgcactta
    78781 aagtcagttt cagtgttgtt tggccaggcc caaaaggcag tcactgtaac atttggcgag
    78841 tttgcgtcct cagaagtgac cattggcact gaataggtag cattgtcacc cacatatgtg
    78901 atgtctgtgg tgtttgtcgg catgtcctgt gaagctggaa tctcatcaga gaacacaatg
    78961 ttggactgaa tgcagtaatc tcccccgctc gccttcggtc cattcccaga gtaaaacacg
    79021 tacaggatac tgttattgcc aagaaatcgt gacactggac gtggtgtcag acgcaggctg
    79081 tatgcatacc ctgtaccagg tattggggtg gccacgggac tcgttgatgt gagaattccg
    79141 ccgctgggaa catggctctc gtatccactg caggtgatgt taaatttgtt gtctccgggc
    79201 agaacttgtg aaatttcgcc atcctccata atacactcaa tatctatctc attaccgagc
    79261 atttctgttt ttacgctgaa attcgagtct tgagctgacg ttggcaaact taagggtagc
    79321 gtgacatcca gcccctgtgc cctcactact gccgttatat tggtagaatt acagttatcc
    79381 cactttatgt atggcactgt ttctggtatc aggtacacgg ggttttgcat ttctgcatgg
    79441 tggcaccaca tggttccaaa cacatcttga aagtagacat ctacagattc caggcttact
    79501 tgttgctcct ctccggtggt gacgttaatt ggaagcttct tagaccgcat agttagagcc
    79561 aattctcctg caccaaggag ctccagtaga aagagattgg tggcattttc tgagccacca
    79621 aatgcacctc gaggttggta gacagccttc gtatggggtg tcagctggcc aaagtcaaga
    79681 tcaagttgat gctttttgcc cccgacatcg aaattgatag ttacattgac atctgccgtg
    79741 caaacattgc atgtggggta aaatgggaat tccggaatct caacattgaa aaaaccagga
    79801 tcttcacccg tgagatggat caggctctgg atggtgtact gacacacaag caaggctgcc
    79861 tccattgtct cggcaccgat ttctaggcag catcctcttt aataggtaca aggggggtgc
    79921 ggtgttggtg agtcacactt ttgttgcaga caaaatggac aaggacaggc cgggtccccc
    79981 ggccctggat gacaacatgg aagaagaagt cccatctacc tcggttgtgc aggaacaggt
    80041 atcggcggga gattgggaaa atgtcctcat agagttatca gatagcagct cagaaaagga
    80101 agcagaagat gcccacctgg agccggccca gaagggtacg aagagaaagc gggtcgatca
    80161 tgatgccggt gggtcagctc cagcacgacc catgctccca ccccagccgg atctccctgg
    80221 gcgagaagcc attctccgca ggtttccact agatctaaga acacttcttc aagcgattgg
    80281 agccgcggct acggtgagca tccctatggc ctaagtgtgt gatgtgtgtt tttacccatc
    80341 acacaacaac aaggtaagta atttgttgcc gttggtttca gcgcatcgac acacgagcca
    80401 tagaccagtt tttcggatcc cagatttcaa ataccgagat gtacataatg tatgccatgg
    80461 ccattcgaca ggccattaga gatcgtcgga gaaatccagc ttctcgtaga gatcaggcca
    80521 aatggagact gcaaaccctg gccgccggat ggcctatggg ttaccaggca tacagcagct
    80581 ggatgtacag ctacaccgat caccagacga ctcccacatt cgtacatctc caggcgacac
    80641 ttgggtgcac aggtggccgt aggtgtcacg tgaccttttc cgccggcacc tttaagctgc
    80701 cgcgatgtac ccccggggat cgccagtggt tgtatgttca gagctccgtg ggtaacattg
    80761 tacagagctg taatccccgc tacagtattt tctttgacta tatggctata cacaggagcc
    80821 tcacgaaaat ctgggaggaa gttttaacac ctgaccagcg tgtttcattt atggaattcc
    80881 taggattttt gcagagaacg gatttgtcct atatcaagag ctttgtcagc gatgccctgg
    80941 gcaccactag tatccaaaca ccgtggatcg atgacaatcc tagcacggag acggcacagg
    81001 cttggaatgc cggctttctc cggggtcgtg cgtatgggat agacttgctt agaactgaag
    81061 gggaacatgt cgaaggtgct accggtgaaa cgcgagaaga aagtgaggac acggagagcg
    81121 atggagatga tgaagatctt ccttgtatag tgtccagagg tggacctaag gtcaaacgac
    81181 cccctatatt tataagacgt ctgcacaggt tgctgctgat gagagcgggc aaacgaacag
    81241 aacagggcaa ggaggtactg gaaaaggccc gtgggagcac ttatggcaca cctaggccgc
    81301 ctgttccgaa accaagacca gaggtcccac aaagcgacga gacagctacc agtcacgggt
    81361 cggcgcaagt cccagaaccc ccaaccattc acctagcagc tcagggaatg gcatacccat
    81421 tacatgaaca acacggcatg gccccgtgtc cggtagcaca ggccccacct acgcccttgc
    81481 cccctgtatc tccaggggat caactcccag gtgtttttag cgacgggcga gtggcgtgtg
    81541 caccagtacc cgccccggct gggcctattg tccggccctg ggagccatcc ctgacacagg
    81601 ctgcggggca ggcctttgca cccgttagac cacaacacat gccagtagaa cccgtccctg
    81661 tcccgacagt ggcacttgag cgaccagttt accccaagcc agttcgtccg gcacctccta
    81721 agattgctat gcagggcccc ggggaaactt ctggcattag acgcgcgcgg gagcgttgga
    81781 ggcccgcacc ttggacgcca aatccacccc gttctcccag tcagatgtcc gtgcgtgacc
    81841 gtctggctcg tttgcgtgct gaggcacagg tcaaacaggc tagtgttgag gtgcagcccc
    81901 cccagttgac ccaagtatcc cctcagcaac caatggaggg gccgttggta ccagagcagc
    81961 agatgttccc tggtgccccc tttagccagg ttgctgatgt ggtccgggca cctggggtac
    82021 cggcgatgca gccacagtac tttgacctcc ccttaattca acccattagc cagggggcac
    82081 ccgtggcccc gttgagggct agtatgggcc cggtacctcc ggtaccggca acacagccac
    82141 agtattttga catcccctta actgaaccca ttaaccaggg ggcatccgcg gcccattttc
    82201 tccctcagca accgatggag gggccgttgg tacctgagca gtggatgttc ccaggtgccg
    82261 ccctgagcca gagtgttagg ccaggggtag cgcagtcaca atattttgac ctccccttaa
    82321 ctcaacccat taaccatggg gcacccgcag cccatttcct ccatcagcca ccaatggagg
    82381 ggccgtgggt acccgagcag tggatgttcc aaggtgcccc ccctagccaa ggcactgacg
    82441 tggtccaaca tcagctggat gctttggggt atacactcca tggtcttaac catcccgggg
    82501 ttcccgtgtc tcctgccgtt aaccaatatc atctcagcca ggctgccttt gggttaccta
    82561 ttgatgagga tgagagtggc gaggggtccg atacctccga gccgtgtgaa gctcttgatt
    82621 tgtcaatcca tggcaggccc tgccctcagg cccccgagtg gcctgttcaa gaggagggtg
    82681 gccaggatgc caccgaggtt cttgatttgt caatccatgg caggccccgc cctcggaccc
    82741 ccgagtggcc tgttcaaggg gaaggtggcc aaaatgtcac aggccctgaa actagaaggg
    82801 tggtggtgtc agctgttgtt cacatgtgtc aggatgacga gtttccggat ctacaagatc
    82861 ctccagatga ggcctaagca aaggtgtaga agtgtgtccc cctccattcc acccactgat
    82921 aatacgcccg acaataaagt tgatgatatt gaattccaca cctgcttgtg tttgtgattt
    82981 tatttcatat tccatgagag agacctcgca tatttgcaga agggtcactg aaacatctta
    83041 tcttaaaaca gttacacctg aataatgaag aaagcgtggc tcagcagagc acagcaagcc
    83101 gatgccgggg gggcatctgg ctccgaggac ccaccagatt atggagatca aggtaatgtg
    83161 acacaggtgg gatctgagcc tatttcacct gagattggcc cctttgaact ctctgcggcc
    83221 agtgaggatg atcctcaatc tgggccagtg gaagagaatt tagatgccgc tgcaagagag
    83281 gaagaggaac ctcatgagca ggagcacaat ggtggtgacg atcccttgga tgtccatact
    83341 cgccagccta gatttgtgga tgtgaaccca acgcaggctc cagtgatcca actagtccac
    83401 gctgtctatg attccatgtt ggtaagaggc acctagaaca tttccagatg tttcgcttgg
    83461 attttttggc cagtcttaat tgattgtcat tggtttcagc aatcggacct ccggccccta
    83521 ggcagtttat tccttgagca aaacctgaac atcgaagaat ttatatggat gtgcatgacc
    83581 gtgcgtcaca gatgtcaggc catcagaaaa aaaccattac caattgttaa gcagaggcgt
    83641 tggaagctcc tgtcatcttg cagatcctgg cgtatgggtt accgcacgca taacctcaaa
    83701 gtaaacagtt ttgagtcagg gggggacaat gtccacccgg tccttgtgac tgctacgcta
    83761 ggatgtgatg agggcacgcg gcatgcaaca acgtacagtg ctggcattgt acagatacca
    83821 cgaatatcag accaaaacca aaagatcgaa acagccttcc tgatggcacg tcgtgctagg
    83881 tcactttcgg cagaaagata tactttgttc tttgatttag tatcctccgg aaacaccctg
    83941 tatgctatat ggattgggct gggcacgaaa aaccgagttt catttattga gtttgtagga
    84001 tggttatgca agaaggacca cactcatata cgcgaatggt tccgccagtg caccgggaga
    84061 cccaaagcag ccaagccatg gttaagagcg catcctgtcg ccattcctta tgatgatccg
    84121 ttaacaaacg aggagattga tctggcctat gcccgcgggc aggccatgaa tattgaggct
    84181 cctagactgc cagatgatcc tataattgtt gaggatgacg acgaaagtga ggaaattgaa
    84241 gctgaaagcg acgaggagga agacaagagt ggaatggaat ctcttaaaaa tataccgcaa
    84301 acactgccgt acaatccaac agtatacggc aggcccgcgg tgtttgaccg aaagtcagat
    84361 gcaaaatcaa ccaaaaaatg cagggccata gtaactgact ttagtgtaat caaggccatt
    84421 gaagaggaac acagaaagaa gaaggcagcc agaacagagc agccaagagc cacgcctgaa
    84481 tcccaggccc ccacagtggt cctccagcga ccacccacgc agcaagagcc tggccccgtc
    84541 ggcccactga gtgtccaggc tcggctggag ccatggcaac ctttgcctgg gccccaagtg
    84601 acagcagttc tacttcacga agaatccatg cagggtgtcc aagtacatgg ttcgatgcta
    84661 gaccttcttg aaaaagacga tgaagtcatg gagcagaggg ttatggcaac cctactgcca
    84721 ccagtaccac aacagccccg ggctggcaga agaggccctt gtgtcttcac cggtgaccta
    84781 ggcatagaga gtgatgagcc cgcttcgaca gagccggttc atgatcagct actgcctgcc
    84841 ccaggacctg accctcttga aatccaacca ctaacgtccc ccaccacgtc tcaacttagc
    84901 agttcggcac caagctgcgc acaaactcca tggccggtgg ttcagccaag tcagactcca
    84961 gatgacccaa cgaaacagtc ccggccaccg gaaacagctg ccccacgcca gtggccaatg
    85021 cccctgcgac ctatccctat gcgccccttg cggatgcagc caatcccatt taatcatcca
    85081 gtgggaccca ctccccatca gacacctcaa gtggaaataa caccatataa gcccacttgg
    85141 gctcagatag ggcacattcc atatcagcct acaccaacgg gtcctgctac catgctgttg
    85201 cgccagtggg cacccgccac catgcagaca ccaccgagag cgcccactcc catgtcacca
    85261 cctgaggtgc cacccgttcc ccggcagagg cctcgggggg cgcccactcc cacgccacct
    85321 cctcaggtgc cgcccgttcc ccggcagagg cctcgggggg cgcccactcc cacgccacct
    85381 cctcaggtgc tgcccactcc catgcagctg gcactaaggg ctcctgctgg tcagcagggg
    85441 ccgacaaagc aaattttgcg ccaattgtta acggggggcg tcaagaaagg gagaccatca
    85501 cttaagttac aggccgccct tgagcgtcaa gccgctgcgg gctggcagcc ttcaccaggg
    85561 tccggcacca gtgacaagat tgtgcaggcg cctattttct acccacccgt tttgcagccc
    85621 atacaggtta tggggcaagg gggttcccca acggccatgg ccgcctcagc ggtgacacag
    85681 gcacccacgg aatataccag ggaaaggagg ggagtggggc ctatgcctcc caccgatatt
    85741 ccgccgtcta aacgagcgaa gatcgaggcc tatacagagc ccgagatgcc gcacgggggg
    85801 gcctcgcact ctcccgtcgt tatcttggag aatgtcggcc aggggcaaca gcagactctg
    85861 gagtgcggag gaactgctaa acaggaaagg gacatgttgg ggctggggga cattgcagtt
    85921 tcttcccctt cctcttctga aacatcgaac gatgagtgat ttcgcccatg taacaagaac
    85981 tgggatgaac cctggggcaa cagactgcgg ggaggagggg ggcagtgata agtcatgaca
    86041 attttagatg aggtagaaat tttgcatatt ttcagaccca ccatggaatc atttgaagga
    86101 cagggggact ctagacagtc acccgacaat gagcggggag ataatgtaca gactaccggc
    86161 gagcatgatc aggaccctgg gccggggcct ccatccagtg gggcttctga gagattggta
    86221 ccagaagagt catactcaag agatcagcaa ccttgggggc aaagcagggg tgatgaaaac
    86281 agaggctgga tgcagcgcat caggcgaagg cggagaagac gggctgcctt gtccggccat
    86341 cttttagaca cggaagacaa tgtgccgcca tggttgcctc cacacgacat cacaccatat
    86401 accgcaagga atatcaggga tgctgcctgc cgggctgtca aggtgagtat gcctctaact
    86461 gggttcatgg gggccatcta aggcccacgt gtgacccatg tttccattaa ttttagcaat
    86521 cgcacctgca agcgctatca aacctgatac tcgatagtgg gttagacaca caacacatct
    86581 tgtgcttcgt gatggcagcc aggcagcgtc ttcaggacat tcgacgtgga cccttggttg
    86641 cggagggcgg tgtgggttgg cgacattggc ttctaacatc tcccagccaa tcctggccca
    86701 tgggatatcg tacagcaaca ctacgcacat taactcccgt gcctaacagg gttggggctg
    86761 acagcatcat gttaactgcc acatttggat gccaaaatgc ggcacgaact ctaaacacct
    86821 tctctgccac cgtgtggaca ccaccccatg ctggaccaag agagcaagaa agatacgctc
    86881 gggaagccga ggtacgcttc cttcgtggta aatggcagag gcggtaccga agaatctatg
    86941 atttgataga actgtgtggc tctctgcacc acatctggca aaacttgctc cagaccgagg
    87001 agaacctttt agatttcgtg cgtttcatgg gtgtcatgtc cagctgcaat aatccagctg
    87061 tgaattactg gtttcacaag acaatcggaa actttaagcc atattacccg tggaatgcac
    87121 cacctaatga aaatccatat cacgcgcgga gaggcataaa agaacacgta atccagaacg
    87181 catttcgaaa ggcacaaata cagggtttat caatgttagc aacgggaggt gaacccagag
    87241 gtgatgctac tagtgaaacg agcagtgatg aggacaccgg tagacagggt tcggacgtgg
    87301 agctagagtc ctcggacgat gagctgccat atatcgatcc caatatggag ccggttcagc
    87361 agaggcccgt catgtttgtg agccgtgtgc ctgcaaagaa accgaggaaa ctgccttggc
    87421 ccacgcccaa gacgcaccca gtgaagcgca caaatgttaa gacctctgat agatctgata
    87481 aggcagaagc acaaagcacc cctgaaaggc cgggcccttc cgaacaatca tcagtgaccg
    87541 tggagcccgc ccacccgacc ccggtggaga tgccaatggt gattctccat caaccacctc
    87601 cagtgcccaa accggttcca gtcaagccta cgccaccgcc ttcccgtagg agaaggggag
    87661 cgtgtgttgt gtacgacgat gatgtcatag aggtgattga tgttgaaacc accgaagatt
    87721 catcgtcagt gtcacagcca aataagccac atcggaaaca tcaagacggc tttcaacgtt
    87781 caggccgacg tcaaaaacga gccgcgcctc ccaccgtgag tccttcggat actgggcctc
    87841 ctgccgtggg gcctcctgcc gcggggcctc ctgccgcggg gcctcctgcc gcggggcctc
    87901 ctgccgcggg gcctcctgcc gcggggcctc ctgccgcggg gcctcgcata ctggcgcctc
    87961 tttccgctgg gcctcctgcc gcggggcctc acatagtgac gcctccttcc gcccggcctc
    88021 gtataatggc gcctcccgtc gtacgtatgt ttatgaggga gcgacagctc ccccagtcca
    88081 ccggccgtaa acctcagtgc ttctgggaaa tgcgggctgg tcgtgaaatt acacaaatgc
    88141 aacaagaacc aagttcacac ctgcagtccg ccactcagcc tacaacgcct cgcccatcat
    88201 gggccccatc agtctgcgcc ctctcggtga tggatgctgg taaggcccag cccatagaaa
    88261 gttcacactt gagttccatg tcgcccacac agccgatatc gcacgaagaa caaccccggt
    88321 atgaggatcc tgacgctcct ctggatttaa gtttacatcc agacgttgct gctcaaccag
    88381 ctccccaggc tccataccag ggataccagg agccgccggc cccccaggct ccataccagg
    88441 gataccagga gccgccgccc ccccaggctc cataccaggg ataccaggag ccgccggccc
    88501 acgggctcca atcatcttca tatccaggat atgcgggtcc ctggacccca aggtctcaac
    88561 atccatgtta taggcacccc tgggcaccat ggtctcaaga tcctgtgcat gggcacaccc
    88621 agggtccatg ggatcccagg gcaccacatc tcccacctca gtgggatgga tctgcaggac
    88681 atggccagga tcaggtctcc cagttcccac atctgcaatc ggagacaggc ccaccacgtc
    88741 ttcaactttc attggtgcca ctggtctcat cctctgcacc atcatggtca tctccccagc
    88801 cccgagcccc catacgcccc attccaacaa gattcccccc tccccctatg ccgttacaag
    88861 atagcatggc cgtggggtgt gactcatcag gtacagcatg cccaagcatg ccctttgcca
    88921 gtgattacag tcaaggtgca tttaccccac tggacattaa tgccaccacg ccaaaaaggc
    88981 ctcgagtaga agaaagttct cacggacctg cccggtgttc ccaagctact gctgaagcac
    89041 aggagattct cagtgacaat tctgagatct ccgtgttccc aaaggacgcg aagcagactg
    89101 actacgatgc atccactgaa agtgagctag attaagggga tccaaggtga cccctgttag
    89161 ctatttgatc tttgactgac acataaacat ggtttaagga atgaacactc atggtgtgag
    89221 actggaactg tactaaattt gctgacatat gtacaatgag agccaaaaat ttgataaacc
    89281 ttaaaagtcc ccccatctaa tgatgtccag ttcccttctc ccaccctgta caccccgacc
    89341 caaagggact caatggcatt cagatttcta gttaccacag gtagaatatc gggcgttggc
    89401 ccataaaaat aagtgcatgg atatagctct gcacaggctt ggaaacaccc attccaggtg
    89461 tgcttctttt tggtgaaata aaaacagcat cctttatatg aaaatgtgta ttctctggtg
    89521 ttgcagtatg tacagttagc tttggtatag ttttggggta cctgaaatgt gtgcagggtg
    89581 ggtgtccaat gtggcagttt tacctctttg tccccatact cctgctcggc cgtcttgtta
    89641 aagttaaccg gcggtggagg atccaccggc cagacctcta catttggttt gggtacccag
    89701 gtgatggccg cggctgccac ccgccctcct cctcttaccc tgggtggcaa aaagtatgcc
    89761 aggagtagaa caataacaag tgcgatggcg gtaaacaatg gcaccctcac ctgcttaaat
    89821 gaaaccatgg caaccacttc aaagagagcc gacaggaaga tatttattaa tattccatta
    89881 gtaaacgagg cgtgaagcag gcgtggtttc aataacggga gttagaaatt taagagatcc
    89941 tcgtgtaaaa catctggtgt ccgggggata atggagtcaa catccaggct tgggcacatc
    90001 tgcttcaaca ggaggcgcag cctgtcattt tcagatgatt tggcagcagc cacctgcgga
    90061 caaaaatcag gcgtttagat ggggcattta tgtttgggac gctagccgcc tgggcattcg
    90121 tgttagtata tactgacctc acggtagtgc tgcagcagtt gcttaaactt ggcccggcat
    90181 tttctggaag ccacccgatt cttgtatcgc tttatttcta gttcagaatc gcattcctcc
    90241 agctgcgagc aagggaatgc gttactacaa gtggtgccta gtcagttgaa acaagcccca
    90301 ccatccgctg ccgcccctcc atgagcccca ccgtccgctg ccgcccctcc ttgagcccct
    90361 ccttaccgat tctggctgtt gtggtttccg tgtgcgtcgt gccggggcag ccactggtgc
    90421 aggctgtgga acaccaatgt ctgctagctg ttgtccttgg ttagccccgg ggcaagcaaa
    90481 caccactgct gctgctgttt gaacagtaga attgtctcca ggttgaggtg cttctccccc
    90541 ggcttggtta gtctgttgat tctgggttat gtcggagact gggaacagct gaggtgctgc
    90601 ataagcttga taagcattct caggagcagg ctgaggggca gaaaaccacg acccagtcgg
    90661 agcggttgaa acatgatagg cagttagctg gccttgtggc agaggctctg gcagcaccgg
    90721 ccacagcaca caaggcaaag gagcttgcga tggccctccc aggtcctgat agactctggt
    90781 agcttggtca aaagcttgta caaaaggcac ctggtatggg tcaggtgtaa attttacatc
    90841 ttcagaagtc gagtttgggt ccatcatctt cagcaaagat agcaaaggtg gccggcaagg
    90901 tgcaatgttt agtgagttac ctgtctaaca tctccccttt aaagccaagg caccagcctc
    90961 ctctgtgatg tcatggtttg ggacgtgcta aatttaggtg tgtctatgag gtacattagc
    91021 aatgcctgtg gctcatgcat agtttctaaa agaggaggag gcagttttca gaagtgtcta
    91081 aaataagctg gtgtcaaaaa tagacagccc agttgaaata tgcatggcat gcagcagaca
    91141 ttcatcattt agaaatgtat ccaagatttc attaagttcg ggggtcaggg gggagtccag
    91201 attcaaatcc tctgtcatgg actctagtgt tgtggtcagt tcgtccaaat ggccacgagg
    91261 gggcgggtgg ctcaggtcca tctgtccaca tatggctgct tcctccttct ggggaataac
    91321 agtgtcagcc atctccctta gggccttcac ggcctgactg gtttcttcat cagggtcctc
    91381 caacagatga cttgcctcgg gggttactgc gggggccggg tcaagtggct ggggcaccgg
    91441 ggctggcgtt agggatccga ccggttcatg gacaggtcct gtgggggtgg gagccaaaga
    91501 ggcaggcagg ggccggttgg cccacgggga tccgggtgga tggaagggcc tgatcctctt
    91561 tggctgacac acctctcgcc cctcgaacac gtcagatatg gcactgcccg cttccggctt
    91621 tggcaggaac ataccttccc ggctatccct gaggcccttc ttccttttaa cgggaggaag
    91681 aaaggtgggc tttgaggggt gggggaatat gggtctctca tcgctctctt ggtggaccgc
    91741 tgctatccaa ggctgttcag gttccgccgc gttggaagga catggagttt gaccacggtt
    91801 gggcctggat gtccggcgcg actttggggc ccgcaggcgc ggggcctcgg ccctggcctc
    91861 ttcccgctcg ctctgctcgg tgtcactgtt gcccgagtca ctgctgctgg aactgctgtc
    91921 accgcagtcg gcgctttggg caccgggctt caggggcatg gtcgggctcg ggagactttc
    91981 gagttcatct gtaaaagcat gaaactgtcc ggactccgag tagcgggcct cggtgtgaga
    92041 ggcaccccca tcattcccca tgagctcctc gtccatcctg tcggctccgg acacgaggat
    92101 aggagtttcc actgccttgg acttggttga cagcaggcac gcgggaagca cgccgctcac
    92161 gtagctcctc tgtccggcgt ggctggagta ggaggcccgg ggcagtgtct taatcagagc
    92221 cctgacatcc ttaacatcgt ccgtcagatg gcctgtcttg gacgagacca tagtctggaa
    92281 catctcctcg aggacgggat aggtgaacac ccacttgcaa aaggccttga acttggagct
    92341 taggaggcct tccttctcca tcctgttcag gtgttccact acctgcttgc cggaggccat
    92401 gatggccgcg cggtccacgc ccagcacctt gctgtaggtg taggcccgca cccgactgtg
    92461 ttttaggagc ttgtacatag cggtgcctat ggtggcagga atcatcaccc ggttgctggg
    92521 ggcctggatg aagaatctgt cagtgaccac tatcaggtgg tctaacacgt agcgcatcac
    92581 tatagggcac gcgatggaac atgcgtcgtt gccggcattc tcagcccgtc ttcttaccct
    92641 gttgtttcgg agaatggccc aaaaattgca gatgttgagc gtggccatta gcccgcccca
    92701 ttctcgcccg tgggccttgg cctcatttat aaatgccttg catattttgt aggatctcag
    92761 agtaatctcc acactcccgg ctgtaaattc cttgttgagg acgttgcagt agtcagagac
    92821 cagagagccc agctgctttt tgatttcagg agttagcctc agaaagtctt ccaagccatc
    92881 ctttttaggc ctcatggcta gtagtaacag aggaaatgcc cgaccattaa aatctttcct
    92941 ccatgagctt tacctgaaac actatcccga agtgggggat gtggtgcatc tactgaacac
    93001 catcggggtc gactgcgacc tcccacctag ccacccactc ctgacagccc agagggggct
    93061 gttcctggca agagtcttgc aggctgtaca gcagcacaag ctgctggaag acaccatcgt
    93121 ccccaagatc ttaaagaagc tggcttattt cttagagctg ctaagctact actcccccaa
    93181 ggatgaacag cgtgacatcg ccgaggttct tgaccacctc aagacgaatc gggacctggg
    93241 gctggacgac agactctggg ccctgattag gaaactgcgc caagacagac accatgcctc
    93301 tgtaaatgtc ctcatgccag gaagcgacta cacagccgtg tcgctgcagt actacgacgg
    93361 catctccata ggtatgagga aggtaatcgc ggatgtctgc cgcagtggct atgcctccat
    93421 gccctccatg acggccacgc acaacctctc ccaccagctc ttgatggcgt ccgggcccag
    93481 tgaggaaccg tgcgcctggc gcgggttctt taaccaggtc ctcctctgga ctgtggccct
    93541 ctgcaagttt cgcagatgca tttactataa ctacattcag ggatctatag ccaccatctc
    93601 ccagcttctg cacctcgaga tcaaggccct ctgcagctgg ataatatccc aggatggcat
    93661 gcgcctcttt caacacagca ggcctctcct caccctctgg gagagcgtgg ccgcaaatca
    93721 ggaggtcacg gatgccatta ccctgcctga ctgcgctgaa tacatagacc tactaaagca
    93781 cacaaaacat gtcttagaaa actgttctgc catgcaatac aaataaattt ctcttacctg
    93841 cgtctgtttg tgtagtgagg tgttgtgtcc tgtatggtat tctactttaa aaaggccggc
    93901 tgacatggat tactggtctt ttatgagcca ttggcatggg cgggacaatc gcaatataaa
    93961 accctgacca tcacatgggg cattaggcga ctctgcatca gcatcgctta agtatgagtg
    94021 ggcagcagag aggctcggtt attttggttc ctgaacatct ggctggggca ttaactaagc
    94081 ttatgagcga ttttatcaca ggacaagatg tcactctttc tggaggaaat attgcagtca
    94141 aaattcgcga tgctataaac cagacccccg ggggtggtga tgtagctata ctttcttccc
    94201 tgtttgcttt atggaatgcc ctcccaacat ctggtagaca atcctccagg gacgatttaa
    94261 tcccagccgc cgtgcaggcc ttaaccacgg cccacaactt atgtctgggt gttattccag
    94321 gtgagacctc acacaaggac acacccgagt cattgctccg ggctatcgtg acgggtctcc
    94381 aaaaattgtg ggtggattcg tgcggatgtc cagagtgcct acaatgtctt aagggattga
    94441 aggcaattaa gcccggcctt tatgaaatcc ctaggataat accacacact aagcagtgta
    94501 gtcctgtcaa tctcctgaac atgttggtcc acaagcttgt ggctttacgt ggtcatgtgc
    94561 agcttgcata cgacgcccgt gtcctgacgc ctgactttca cgaaatccct gacctcgatg
    94621 actccgatgc tgttttcgca cgcaccttat tggcagcctt atttcacctc aatatgttct
    94681 ttattctcaa agattacata acacaagact ccatgagctt gaagcaggcc ctcagtggtc
    94741 attggatgtc tgccacgggc aaccccctgc ctgcagcacc ggaaaccctg cgagactact
    94801 tggaagcttt ccgaaattcg gataatcact tttatctccc gacgacaggg cctttaaaca
    94861 ccttccaatt tcccgaagag cttctggggc gcgttgttgt tattgattcc tctttgtgtg
    94921 ccgccagtca cgttcaggac gttatcaccc atggtgttgg ggcgggtgtt cctcgtcctc
    94981 ggttttcggc cctgcctccg gccccatccc gcgagcccca gcagacatgc tctcagttaa
    95041 cgagcagagg gaatgaaagc tcacggcgaa acttgggcca gcccgggggg acctcccctg
    95101 ctgttccccc agtttgcccc atcgtttccc tgacggcctc aggggccaag caaaaccgcg
    95161 ggggcatggg atccttgcac ttagccaagc ctgaggaaac ctcccccgcc gtctccccag
    95221 tatgccccat cgcttcccca gcggcctcca ggtccaagca gcactgcggg gtcactggat
    95281 cctcacaggc cgcacccagc ttttcttccg ttgccccagt agcatctctg tctggtgacc
    95341 ttgaagagga agaggagggg tcccgagaat ccccatccct accgtccagc aaaaaggggg
    95401 acgaggaatt tgaggcctgg cttgaggctc aggacgcaaa tcttgaggat gttcagcggg
    95461 agttttccgg gctgcgagta attggtgatg aggacgagga tggttcggag gatggggaat
    95521 tttcagacct ggatctgtct gacagcgacc atgaagggga tgagggtggg ggggctgttg
    95581 gagggggcag gagtctgcac tccctgtatt cactgagcgt cgtctaataa agatgtctat
    95641 tgatctcttt tagtgtgaat catgtctgac gaggggccag gtacaggacc tggaaatggc
    95701 ctaggagaga agggagacac atctggacca gaaggctccg gcggcagtgg acctcaaaga
    95761 agagggggtg ataaccatgg acgaggacgg ggaagaggac gaggacgagg aggcggaaga
    95821 ccaggagccc cgggcggctc aggatcaggg ccaagacata gagatggtgt ccggagaccc
    95881 caaaaacgtc caagttgcat tggctgcaaa gggacccacg gtggaacagg agcaggagca
    95941 ggagcgggag gggcaggagc aggaggggca ggagcaggag gaggggcagg agcaggagga
    96001 ggggcaggag gggcaggagg ggcaggaggg gcaggagcag gaggaggggc aggagcagga
    96061 ggaggggcag gaggggcagg aggggcagga gcaggaggag gggcaggagc aggaggaggg
    96121 gcaggagggg caggagcagg aggaggggca ggaggggcag gaggggcagg agcaggagga
    96181 ggggcaggag caggaggagg ggcaggaggg gcaggagcag gaggaggggc aggaggggca
    96241 ggaggggcag gagcaggagg aggggcagga gcaggagggg caggaggggc aggaggggca
    96301 ggagcaggag gggcaggagc aggaggaggg gcaggagggg caggaggggc aggagcagga
    96361 ggggcaggag caggaggggc aggagcagga ggggcaggag caggaggggc aggaggggca
    96421 ggagcaggag gggcaggagg ggcaggagca ggaggggcag gaggggcagg agcaggagga
    96481 ggggcaggag gggcaggagc aggaggaggg gcaggagggg caggagcagg aggggcagga
    96541 ggggcaggag caggaggggc aggaggggca ggagcaggag gggcaggagg ggcaggagca
    96601 ggaggagggg caggagcagg aggggcagga gcaggaggtg gaggccgggg tcgaggaggc
    96661 agtggaggcc ggggtcgagg aggtagtgga ggccggggtc gaggaggtag tggaggccgc
    96721 cggggtagag gacgtgaaag agccaggggg ggaagtcgtg aaagagccag ggggagaggt
    96781 cgtggacgtg gagaaaagag gcccaggagt cccagtagtc agtcatcatc atccgggtct
    96841 ccaccgcgca ggccccctcc aggtagaagg ccatttttcc accctgtagg ggaagccgat
    96901 tattttgaat accaccaaga aggtggccca gatggtgagc ctgacgtgcc cccgggagcg
    96961 atagagcagg gccccgcaga tgacccagga gaaggcccaa gcactggacc ccggggtcag
    97021 ggtgatggag gcaggcgcaa aaaaggaggg tggtttggaa agcatcgtgg tcaaggaggt
    97081 tccaacccga aatttgagaa cattgcagaa ggtttaagag ctctcctggc taggagtcac
    97141 gtagaaagga ctaccgacga aggaacttgg gtcgccggtg tgttcgtata tggaggtagt
    97201 aagacctccc tttacaacct aaggcgagga actgcccttg ctattccaca atgtcgtctt
    97261 acaccattga gtcgtctccc ctttggaatg gcccctggac ccggcccaca acctggcccg
    97321 ctaagggagt ccattgtctg ttatttcatg gtctttttac aaactcatat atttgctgag
    97381 gttttgaagg atgcgattaa ggaccttgtt atgacaaagc ccgctcctac ctgcaatatc
    97441 agggtgactg tgtgcagctt tgacgatgga gtagatttgc ctccctggtt tccacctatg
    97501 gtggaagggg ctgccgcgga gggtgatgac ggagatgacg gagatgaagg aggtgatgga
    97561 gatgagggtg aggaagggca ggagtgatgt aacttgttag gagacgccct caatcgtatt
    97621 aaaagccgtg tattcccccg cactaaagaa taaatcccca gtagacatca tgcgtgctgt
    97681 tggtgtattt ctggccatct gtcttgtcac cattttcgtc ctcccaacat ggggcaattg
    97741 ggcataccca tgttgtcacg tcactcagct ccgcgctcaa caccttctcg cgttggaaaa
    97801 cattagcgac atttacctgg tgagcaatca gacatgcgac ggctttagcc tggcctcctt
    97861 aaattcacct aagaatggga gcaaccagct ggtcatcagc cgctgcgcaa acggactcaa
    97921 cgtggtctcc ttctttatct ccatcctgaa gcgaagcagc tccgccctca cgggccatct
    97981 ccgtgagttg ttaaccaccc tggagactct ttacggttca ttctcagtgg aagacctgtt
    98041 tggtgccaac ttaaacagat acgcatggca tcgcgggggc tagacctctg gctggatgag
    98101 cacgtgtgga agaggaaaca ggagattggt gtgaaaggag aaaatctgct tctccccgac
    98161 ttatggctag atttcctaca actcagcccc atcttccagc gcaagcttgc tgccgttatt
    98221 gcctgtgtcc gacgcctgcg gactcaggcc accgtctacc cagaggagga catgtgcatg
    98281 gcctgggccc gcttttgcga cccctctgat attaaggtgg ttattttggg ccaggacccc
    98341 tatcacgggg gtcaagcaaa cggcctggca ttcagcgtcg catacggctt tccagttccc
    98401 cccagcctga ggaacatcta cgcggagctg caccggagcc tgccggagtt ttctccccca
    98461 gatcacggct gtctagacgc gtgggcctcc cagggggtgt tgctactcaa caccatcctg
    98521 accgtgcaaa agggcaagcc cggctcgcac gcagacattg gctgggcgtg gtttactgac
    98581 cacgtaattt cattgctctc tgagcggtta aaagcgtgcg tgtttatgct gtggggtgcg
    98641 aaggcgggag acaaagcttc actaatcaac tccaagaagc atctggttct gacctctcag
    98701 catccctctc ccctggccca gaacagcacc cgaaagagtg cccagcagaa gttcctgggc
    98761 aacaaccact ttgtcctcgc taacaacttt ttgcgtgaga aggggctcgg tgagatagat
    98821 tggaggctgt agaggggtca tcactatggc catgtttctg aagtcgcgtg gggtccggtc
    98881 ttgcagggac cggcgcctct tgtcggacga ggaggaagag acttcacaga gcagcagcta
    98941 cactctgggg tctcaggcct cccagtctat ccaggaggag gacgtgagtg acactgatga
    99001 gtctgactac tcagatgaag acgaggagat tgatttggag gaagagtacc ccagtgacga
    99061 agacccatct gagggcagtg atagcgaccc ctcgtggcat ccttcagatt cagacgagtc
    99121 tgactacagc gagagcgacg aggatgaagc aacccccggc tctcaggcct cacgatcttc
    99181 aagagtctcg ccatctaccc aacagtcttc aggtctgaca cccacgcctt cgttctcccg
    99241 accacgcacc cgggcacctc cgaggccgcc ggctcccgcg ccggtcaggg gacgggcctc
    99301 agcacctccc aggccaccag ccccagttca gcaatccacc aaagacaagg gtccccatag
    99361 acctacgcga cctgtactta gaggcccagc tccacgccgc ccccctccac cttcaagtcc
    99421 caatacatac aataaacaca tgatggaaac cacccccccc attaagggca ataacaacta
    99481 caattggcca tggctgtaaa taaaatgtca taacctggag tctgcatgtc tgttgtttta
    99541 ttcagtaaac cagtagtgcg cgtgagttct ttagggcatc cacgatgtag ccgctcgcgg
    99601 ggttcccctc cccagtgatc atctcggata ggggattcct gtccatgacc acgcaattag
    99661 agtgccgggc ccgggacagc gccacataca catggccggg tttgatgttt ctgtggctgc
    99721 cgaagcagat ggcgactttg tttagggaca gaccctgggc cttggctatg gtcatggcca
    99781 gctttgagct aatgccatag tcacggatgc tgcagaggtt cagggacttg tcctctatcg
    99841 tctcatacag tttgttagta ttgtgttcca ggcagcacac gaagcctgcc tcatccttga
    99901 ccattagcct gggcatgcgt gaactgccag cgtcctgagg ctgctgcttt cctcggatgc
    99961 caaagaagac gttgagatgc gtgtagccca gaagcgtgta gttctcggtg gtggaggcgt
   100021 agtccaggag gccgtgaagg agaggctcgt ctgaggtgaa ctctatgttg tcgcgaatca
   100081 gcatgttgtt ggtaaatgtg cagaagggga ggtccctgaa ctcccttccg ccatagcgga
   100141 cggccacatc caggcattgc ctgaaatagg ccctgaggtc attatatatg tttaacaggg
   100201 agcagagggg ggcagaattt gcggccgggg gagccagtac tcgggcatag aagacagcgg
   100261 cggggctccg ctccccatcc caggcaacct ccagcggcag ttcgcccagc tccatcccag
   100321 cagtcacctc cggatcccac gtacgcccgg gcaggggcac agcaccaagc tccgccacgt
   100381 attccccgtt ttcacagaga gaatgtcctc cgtggctaaa agcgtagatg cctccgtaga
   100441 tgagtcgggc caggaagctg tagacatact cgggctgctc atgcccgtgg gcctccacga
   100501 agctgtccgc ctcgagcgtg tccataaagt ccccgaaggt gccggtatag ccacagatgg
   100561 actttttggt cttgcagttg accgacaccg agctgtgctt gacgtaggtg acattgtagg
   100621 tgaccttgac ccgttcttcg tcctgctcgg tgcccaccgg gaccatgtct tggtcggcga
   100681 actgcgagta gttaccgagg cgtgcataat tcttttggag ccaggtgtgg gccgtgaggc
   100741 ccggaagccc gaccagggtc ttgtactggg ccaggggatc gaggaagacc tcgcactcca
   100801 ccgggcaggt aaacatggtc accccgcccc catctccccc ggttccccgc gcggcacgcc
   100861 cctgcccggc agtcttgagc gtggcatgga gggtggtgag gaaggtcttg acctcggcgt
   100921 gggagaggaa gagccgggtc cagcccacgt actgcgcggg gtccattatg gccgccctgg
   100981 ggacgacgaa gcggtcgacg taggccagga tgtccggcga gagctcgagg ccgtactcga
   101041 gggtcttcat gaggtgtcca aactggacgt cggtgcagcg cttgttgttg atgaagaggg
   101101 cccagttgcg ggccacgtcc acgtaggtcg cggccctggg gttgcccacc aggaaggtga
   101161 ggatgttgtc gcactcgcga atcttgttta cctgggtctc gtggctaaag gaggactgaa
   101221 aggcgtctgt ctgggtggga gagcccacgc agacgatgca gggaatgcgg ccccggcggt
   101281 agagtggggt acgcagccag gcgttgaaga accagtagca aaagaccacg gctgttagaa
   101341 tgtgcacgga aagcgttcca gcttcgtcca ccacgatcac attggtggtc catagctgcc
   101401 cctggtgcat gtctctcagg acctcaaagg cggggccaga gactcccgag tagagccccc
   101461 tgggcttggt tcgcctgaac tcggcggcaa tgtcggagag taccggccag tatttggcca
   101521 ggtcccgccg ctggagttcc tctagggcgg cgtccgtaga gcgaccatga ctgctgaccc
   101581 gctgcgtcat atttatgtgg cggctcttga acccaaaggc gctatagacg gttgggcagt
   101641 aggctcggag tgtctgggag aggttctgtg cggccacggt tgtggctccc gtgaccaggc
   101701 agtccatcgt gtggtggagg cagctaacgc tggtgctctt gccagccccc gccgttcccg
   101761 taattacata ggctgaaaag ggcaggaagg ggggctccga gagctccggg tcaaactcgg
   101821 gggagaacgt ctccatatcc gggagttgtt ggacgcggcg cctagccagg gtccctatcc
   101881 tcctgactat acgcctcacg gaggcgtctg aggtcatgtt caacatgaac gtggacgaga
   101941 gcgcctctgg cgccctcggc tcctcggcca ttcctgttca ccccacgccg gcctcggtcc
   102001 gactttttga gatcctgcag ggaaagtacg cctacgtcca gggacagacc atctacgcca
   102061 acctccgcaa ccccggagtc ttctcgaggc aggtgtttac ccatttgttt aaacgagcca
   102121 tctctcattg cacgtacgat gacgtgctac atgactggaa caagttcgag gcctgcatcc
   102181 agaagcgatg gccgagcgat gactcgtgtg cgagccggtt tcgtgagtcc accttcgagt
   102241 cgtggtccac gaccatgaag ctgaccgtgc gtgacctgct gaccaccaac atctaccgag
   102301 tgctacacag ccgctccgtg ctctcctatg agcgttatgt ggactggatc tgcgccaccg
   102361 gcatggtgcc cgccgttaag aagcccataa cccaagagct ccactccaag ataaagagcc
   102421 tgagggacag gtgcgtctgt cgggaattgg ggcacgagag gaccatcagg agtatcggga
   102481 cggaattata tgaggcaacg aaggaaataa tagagtcgct caactccacg ttcatccccc
   102541 agtttacgga ggtgaccatc gagtaccttc cgaggagcga cgagtatgtg gcctactact
   102601 gtggccgccg catcaggctg catgtgctct tccccccggc catctttgcc ggaacggtga
   102661 ccttcgacag cccggtgcag cgcctctacc agaacatttt catgtgctac cgcacgctgg
   102721 agcatgccaa gatctgccag ctcctgaaca cggcccctct caaggccatc gtgggccacg
   102781 gggggcgaga catgtacaag gacatcctgg cccatctgga gcagaactca cagcgcaagg
   102841 accccaagaa ggagctgctg aacctgctgg tcaagctctc ggagaacaag accatcagcg
   102901 gggtcacgga cgtggtggag gagttcataa cggatgcctc caacaacctg gtggaccgca
   102961 accgtctatt tggccagccc ggggagacag ctgcacaggg cctaaagaaa aaggtctcca
   103021 acacggtggt caagtgtctg actgatcaga taaacgagca atttgaccag attaatggcc
   103081 tagagaagga gagggagctc tatctaaaga agatccgctc catggagtct cagctgcagg
   103141 cctccctggg tcccggcggc aacaacccag cggcgtcagc ccccgccgca gttgcggcag
   103201 aagccgcgtc tgtagatata ctgacgggca gcaccgcctc cgcaatcgaa aagctgttca
   103261 actccccgtc cgccagcctg ggtgccaggg tgtctggtca caatgaaagc atcctaaaca
   103321 gtttcgtttc tcaatacatc cccccttcgc gggaaatgac taaggatctg actgaacttt
   103381 gggaaagcga gctgtttaac accttcaagt taacacccgt ggttgataat caggggcagc
   103441 gtctctacgt cagatactcg tcagacacga tctctatatt attgggcccc ttcacctatc
   103501 tggtggcaga gctttcaccg gtggaactcg tgacagatgt ctacgccacc ctaggcatcg
   103561 tggagatcat cgacgagctc taccggagca gtcgcctggc catctacatc gaggacctcg
   103621 gtcgaaaata ctgccccgcg agcgcgaccg ggggagatca tggcatccgg caagcaccat
   103681 cagcccgggg ggacacggag cctgaccatg caaaaagtaa gcctgcgcgt gaccccccgc
   103741 ctggtgctgg aagttaaccg ccataacgcc atctgcgtgg ccaccaacgt ccctgagttc
   103801 tacaatgcca ggggggacct taacatccga gacctccggg cccacgtcaa ggcccggatg
   103861 atctcgtccc agttttgcgg ctacgtcctc gtgagtctgc tggactccga ggaccaggtc
   103921 gaccacctca acatattccc ccacgtgttc tccgagagga tgatcctgta caaacccaac
   103981 aatgtgaacc ttatggagat gtgcgccctg ctctcgatga ttgagaatgc caagagcccc
   104041 tccataggcc tctgccggga ggtgctgggt cgcctgaccc tcttgcactc caagtgcaac
   104101 aatctggact ctctgtttct gtacaatggg gccaggacgc tgctgtccac cctggtcaag
   104161 taccacgacc tggaggaggg ggctgccacc cccgggccgt ggaatgaggg cctgagtctc
   104221 tttaagctgc acaaggagct gaagcgcgcc ccatccgaag cccgggacct catgcagagc
   104281 ctctttctga cctcggggaa gatggggtgc ctggccaggt cacccaagga ttactgcgcg
   104341 gatctaaaca aggaggaaga tgccaactcg ggcttcacat ttaacctgtt ttatcaagat
   104401 tctttattga ccaagcattt ccagtgccag accgtcctcc agaccttgag acgcaagtgc
   104461 ctcgggagtg acacggtctc aaaaataatt ccctagaata aactgagaac agtcatcagt
   104521 aaatctgtct ctcgcgtgat ttccatagga atggtgtagc cggggtggag ggccgatatc
   104581 acatcaagca gaaaggccat aatctctcga aagtaggcgg tggggctgag accatgctca
   104641 gtggccgtct ggcagggggc cgggcgcgct ccgtccttgt ccaggagaca cacgtggctt
   104701 ccagagaggc gcagcccagc cctccgcagc cgctgaagcc aggctcgcgg aagagcccaa
   104761 aacctgtttc ggcgccgccc gggggccagt ctccgggtca ggtcgcggac cagggtcaac
   104821 aggtggtcgt gggatggcgg ggccttgtct gcctcgggtc tcgccgctag ttggtccagg
   104881 gtccaggaga aggcttcgtg ccaaaccaaa aagggccccg agtgctccct acatccaccc
   104941 acgtaaagat ccccctgaaa gatggccatc agtaggcacc cgggcccgcg tcgagccttc
   105001 acccgaatgt gtctgcgggc cacggtggcc tctccaccca tcacatcccg gtcgagccgg
   105061 ctggcatcct ccgagtcttt cacgccttgc aggaaagcct aggagataca gcaacagaaa
   105121 gctattagcc ggtggttccc ccaccatcat tcttcctgtt aacgggaaga ataagagttg
   105181 ggcaaacccc gggggccgcg ctctcccacc cagccccgct tctcacctgt gctagtggct
   105241 cctctgaagg atgggcggag gttggtgcca caaagcccag gatgaactcg tctgcataag
   105301 cccaggtcag tcctaggtca gcggccgcgt gtaggagaac ccgggtgacg gcggtgtaga
   105361 ggcccccgag tgcccgtcgc gtgtctgagg tgccatagcg gtgaagggcc cgcagccagg
   105421 tttgcgcgtc ccgcgcctgc cctccgccat caggcgttcc cacgggggcg cccctggcag
   105481 agaggtggca gcgggccaat tcgtagagcc accaagtggc atcagcctca aggatggctg
   105541 tggcctccgc gcgcccgacc accgtcgtct cgtcctcccc ccctccctcg ccgccttccc
   105601 gcgtgcaaac gtggcgaggg ttaatctcct ttcgggtcgg gggccagatt tgttgtagga
   105661 gcagcgagcc gcgtcgttgc cctgaccgcg cgtcgaggcc caggagggcg tctgccaggg
   105721 gcgtcccaga gactcccagg ttcaggtcca gtagcaggag accctcgctg tgtggcgccc
   105781 ggtgccagaa ggccggcctc gcccgtccca cataatggat gggcaggaag ggaaagcccg
   105841 ggacataggg ctggaaatct gagccccctg ggcagagttc ggggtccagg aggtagaaga
   105901 tgggcttggt gcctctgtgg ttggcgtagc aggaggcata gatactgcgg aggaaggcgt
   105961 agagcccgcc cccggccata ctccaagagt tgacaagcca ggactcgaat cccccagccg
   106021 gctcaagaat tttcaggctg acgcggtgcc gtcgggcgtc cccaccacgg ccggtggccc
   106081 cgtcggacga caccagatct acttcataag tgaccggtcg caggatgtcc ctaaagggga
   106141 cgggagaggg gtcgtcggga gtctcggtgg aataggtgaa aacatcccca cgcggtgtcc
   106201 tgatgtatac gtccaactgt ccgggagact cagagtgcct ctgagcatgg gggcatgtct
   106261 gttccccctc catctcggac ccgaagccat caacaggtgg gggttgttgg tcccgcccat
   106321 catcccccga gcagctttgg cagaccacct gtgctggaaa gagaggctgg aagatgaggc
   106381 cctgctcatc ctccaccctg gcggcggaca agagtctgcg gtctcgggtt ctaaatgaaa
   106441 ggtcaaatag gtccttctcg gcggcatcgg cgagcatagc aatgagcccc ccgctgcgcc
   106501 tgagctcccg ctcccatcgc aaaaagttga gttcggtagt cgagggcgcg ttgaccacgg
   106561 ggggctccag ggagcctcca agcggcggct ggcaggcctg caccacgatc agagtctcaa
   106621 cgtcctccct tttgatgggc acgatgccca cgacccaaat cgcccaccac cgccctgcgg
   106681 tctgggtaac attataaaag gtaaccgagc tgacgcgggc cctgacgctc tccgcgggtg
   106741 tttccatcat tgtttgagat ctgaggagga ctggaccctt taaaacatcc ggtcacgccc
   106801 tttgcaaatt atttaaaagg tgaatgctca actgagacca tcgcaatcat gaagtcctcc
   106861 aagaatgaca cgttcgtcta tagaacgtgg gtcaaaacgc ttgttgtgta ctttgtgatg
   106921 tttgtcatgt cggcggtggt ccccatcacc gccatgttcc ccaacctggg gtacccctgc
   106981 tactttaacg cactggttga ttacggggca cttaacctga ccaattacaa cctggcccac
   107041 cacctgaccc ccacgctcta tctggagccg ccggagatgt ttgtctacat cacactggtc
   107101 tttatcgcgg actgcgtggc tttcatctac tacgcctgcg gcgaggtggc gctaatcaag
   107161 gcccgaaaaa aggtctcggg tcttacagac ctctcggcct gggtctcggc agtgggctcc
   107221 ccaaccgtgc tgtttttggc catcctcaag ctctggtcca tacaggtctt catccaggtc
   107281 ctttcctaca agcacgtctt tctctcggcc tttgtgtact ttttgcactt tctggcctca
   107341 gttctacacg cctgcgcatg tgtgacccgc ttctccccgg tctgggtggt caaggcccag
   107401 gacaactcta ttccccagga caccttcttg tggtgggtgg tcttctacct gaagcccgta
   107461 gttacaaacc tgtacctggg gtgccttgcc ctggagacgc tggtcttctc gctcagcgtg
   107521 ttcctggccc tgggcaacag cttttacttt atggtggggg acatggtgct gggagccgtg
   107581 aacctcttcc tcatcctgcc catcttctgg tacattctga cggaggtgtg gctggcctcc
   107641 ttcctgcggc acaactttgg cttctactgc ggcatgttca tcgcctccat catcctgatc
   107701 ctgcccttgg tcaggtacga ggccgtcttt gtctccgcca agctgcacac cactgtggcc
   107761 atcaatgtgg ccatcatacc tatcctgtgc tcggtggcca tgctcatcag gatatgccgg
   107821 attttcaaaa gcatgcgcca gggcactgac tatgtccctg tctcggagac ggtggaactg
   107881 gagctagagt cagagccgag gcctaggccc tcgcgcacgc catcacccgg gcgcaaccgc
   107941 cgccgctctt ctacgtcctc atcttcctcc aggtcaacca ggagacagag gcccgtctct
   108001 acccaagccc tcgtctcctc cgttttaccg atgacgacgg acagcgagga ggagatcttc
   108061 ccctaatgca ataaaaactt aaaacactga ggttactttc ccgtcattct ttcgggggaa
   108121 cgaggggagg cgggaattgg gttaagatag gggcgaaggg tgggggtggg tgcaagaatt
   108181 ggggctggga atggagaggg gagtgggcta ggtgccgaca ccggggtgcc aagataatgg
   108241 attgagtaag catggggctc tgatcgggtc cgccgggttc tcaggggtgt agtgggtggg
   108301 cattgcatat ttttgccgcg gtgctgttgg gccttggact cggggtgatc atccgtacca
   108361 tcacccgcac ccgcacccca gtccacagcc accggccaag gtcctgggcc tcccaccacc
   108421 gttatgcctc cccctttacc cattaattac aagagatgtt agtttggttt tttatttggc
   108481 aaaaacagca attcatcatt ttcagagtcc tcatcatatt cgagcccctc gttggtttcc
   108541 ccgcaggccc tcccttcttc ggccgctatt agcttagtag tctccaggtt aaactcctca
   108601 tagtcattat acaggttgat tattcccccg tccacgtcgc ctatggagtt gactcgtcgt
   108661 cggcaaagag accagagggc acccatggcg cggtgtcaaa agtattgtct gcgtacgctt
   108721 tccaggagcc agccgcggtg ctcaaggtct tacggatgac agagtccggc aggaccacgg
   108781 gtgtcaccag caccgccacg ggaatctcca ccgaggcgtc cagaagcagg tctgagccga
   108841 gcgtgcaggt cgccgggtct agaggcgacc gttttcgaaa gaaggccgtc acaatgttca
   108901 cccggggtga gcagtctctc ccgggcttgc cacccccact gtggcggacg tagtctccaa
   108961 caattttgta ttggaggagc acctggtaga agtagttgtg ccgtggattg atgaagatgt
   109021 tgactgggac ccggtcttta ataccaatgc gccccgcatt ttcgcttggg tccgtcatta
   109081 cgtagagcat agactccacc cccctgttgg cagctaggct gtctgccacc aggtcatgac
   109141 cggggcccag tttgcgctta cggacatctt taagattcca ggcctcatcc tgcgtcaaca
   109201 gatagtcacc ctccgagggc aaccgcccat ccgggacgta ctccacggta ggacgagcta
   109261 tagaattgat aaatctgata aatgacctct tgcatggcct cttgtaaagc gcagtgtagg
   109321 atgggtagat ggggtcaaat tctgacttgg aaaagaggta cttgaagcgg cacttaatct
   109381 cataaatgca gctccggtcg gtgaacagta taaagtctcc ctgtgactcc acattgacgc
   109441 aaagatccag agacacccca aaaatgccat ccgtgggact aatcataaag ccaaattgac
   109501 ggttggcgga tgcgtccccg cagatgagct tacagacaat gtccttgacc gtgtcctcac
   109561 accgcaggcc aaaggccaca ggtcccccaa agtagtgatt tgtggagatg ggagctggct
   109621 caaacacctt ggtgggtcca ttcttaatgg tggagagcag cttggaagag gaaattatgc
   109681 catttcgcaa tatgtcccac atcaggttct cagactgccc cctggtcatg gactccacgt
   109741 acgagcagag aacagtcctc tgctcgtcgg tggcctcctg tagcccccag taaatggatt
   109801 tcagggaggg accgtccttg ctgtcattct cttggactaa cgaggagaca aagtcacaga
   109861 agccagtttc accagagaac tcttgtattt gtttacagag gcaatagaga tagacaaagc
   109921 gcatggccgg catctgaggt ggacggtcaa ggttacggac aaaggcctca gtctccggac
   109981 tgcggaggaa gcgggcaaac gtgtaggagg tcatctcctc catgggatcc tcgagctcat
   110041 ccacgtcggc catctggacc aaagaagtcg tctgccaaga gttcagctac cagacctgga
   110101 agatgagggt gctcaaaccg tgggcgacag ttgaagaagt agctctcctt gaacctcttt
   110161 ttaaggctcc ggcaccactg caagaattga ctcatatgct ccgccgtgac atccacgcac
   110221 ggactctcgc cacacgaggt caggcccatg tctaagttca ggttccacat ctgcgacagc
   110281 acctccaaca gcaccacctt tggggctgca aattgcaaaa agtagagcgg gtcggatcgg
   110341 tcaaatccca tgtcagggtt ggggtagggg attttgtggg tggagtcagc gaggtgcatg
   110401 ataccataga gcagcgagta gccgagcgac tgcagatcca ggcgaagggc cgtctgcgcc
   110461 cccacggggc cacacgccga ggggtcaggg atgtgcccag cccccctcaa gatgtagcac
   110521 ttgctcaaaa ggcagagggg cttataggtg tccttggcta tagaaaatgg ttccctctgg
   110581 caatagaggc gatagagctg ccggccctta gaagacttta gccgcacatc cagcatcttg
   110641 ttgcggtcgt ggagggaagc agtcccataa tcagtcagga ccagcctacc catgccccac
   110701 atggtgtctg tgaaatccac caggatgttg ctggggctaa tgtccgaatg gaagaggccg
   110761 cagtgccgat tcagaaagta aacggcatct ttgaggccct gaaagccccg caccaggggc
   110821 tcaatactac catcatgcca gtggccataa tcctggagac tgcatctgaa ctggggcata
   110881 aacagggcgt ggcaggacgt gcaggccgac aggtagtcca ccagggcctt gtcctgccca
   110941 tcctcggccg tggccttccc aatctgaatc atgtcacaca ccatgagctc gtgatacagc
   111001 tccgtcacag agtcatagag tttgaccgtg gcattatctg catgtgcata cacggccccg
   111061 tagctccccc gccccagcag atactcgcag gtaatgggga ggtgatcaca gcgcgtcatg
   111121 ttctccggca gctttacata gagggtctcc gtcatgtcat caatgttggt caccttcagg
   111181 tgtttgtgct gaaaggtgaa gtaatcaatg acagtcacct tccccaaaaa ggcctgggtc
   111241 tctcgagggg gttctgggga gacactcaac tcgccactgc tggaggagtt cgtcgggctc
   111301 aactccgcag ccatattcac atccatgttc ctcaaatggc tcgagggcct gtcgcagctc
   111361 gtctctggcc tcaagctcct gctcacggag ctcctccacc cgctctagct gcttgtagtt
   111421 gatttttgga aattgagtct tggtcgcggt gaccaccctc tgataggtag aaattagctg
   111481 tttggactca aacgtctccc ttgcgtggcg cagggactct aaggcacccc gagcagatgt
   111541 aaactgtgtt tcaaacagag cgtggtccct cccaaatctg tcacgtgcgc tcacagccgc
   111601 tctcttttct accgaggctc ttagttgctg ggccaccaga tctcgcttag aactactcat
   111661 cttcataagt caccatgtcc gcaactatgg agcccagatc atacgtgggg tagagtacgg
   111721 tagttccagt ggaggcttcc cggtaatttc ccacagcgtc caccatatat ctttctgcct
   111781 ctcccgttag aattaggcaa ggatcatacg tgtccaccgg ccttttatac tgagcgttta
   111841 ggttttgttt atgtagcaag cacaaaaggc acacacgagt gatgcaaaag ggttcctgag
   111901 gcagcaggca gagctgtttt gccattttat tcaggcggct aacgtcaaag ggaggagcta
   111961 tatcctcacc cttccagtca cgcacgtcca agtacagggc atacacacac ctggtgaggt
   112021 gtgccaggaa tgcctctatg ttggcacatg gtgtataaac cgcagtgggt agcagaatag
   112081 ggcccctttt gccccgtgcc gcagcgtaaa cgcagtgacg ctcttcgcag tgggacctgg
   112141 ggccgtagaa gagggcccac atccaaggga gtgggtcttc aggcaccagg gaggtccagg
   112201 tttgggagtg ggccaatatt tgcaaggcct gacctataac ctcatctttg ttccaggcca
   112261 gcgcaattcg cataaggtcc ccatcaaaca cctcaaaaca cagacccatg cccatttcag
   112321 gctgagaggg ctccatccgg ctcgaccaac cttgtccacc aaactgccat tcttctggta
   112381 aacgggggtt gaggggcaag agctccaaag ccaggctcga gaagtcatag tcatcctcgg
   112441 ccacacggcc ggagctccgg gcctcgtgcc agggcctgtt gtcctggggg aggatattgg
   112501 acacgagcag gaagctcttg agtggcgtct ccaccagctt aaattgctcg ggcgtgtcct
   112561 ggcaggcctc cagtgccagt tccagacact gcccatacct gcgggcgagc atcgggtcat
   112621 cgggcatatc ggccttgacc gcgttgaaca tgctgtatgc ctcgcagcgc ggccgtctga
   112681 ccgagaacct aagaaacgcc cttcagcagg acagcaccac gcaaggctgc ctgggtgccg
   112741 agaccccgag tattatgtac acaggggcca agtcagacag gtgggctcac cctctggtgg
   112801 gcacaattca cgccagtaat ttatattgcc caatgcttcg agcatactgc cgccactatg
   112861 gccccaggcc cgtgtttgta gcttctgatg aatcattacc catgttcggt gcgagccctg
   112921 cccttcacac cccagtccag gtccagatgt gcctactacc agagctacgc gacacgttac
   112981 agcgcctgct gccaccaccc aatcttgaag actccgaggc cttgacggaa ttcaagacca
   113041 gcgtgtcctc tgcccgtgcc atccttgagg accccaactt tttggagatg agagagtttg
   113101 tcaccagcct ggccagcttc ctgagtggtc agtacaagca caagcccgcc cgcctagaag
   113161 cattccagaa acaagtagtg ttacattctt tttattttct gatctcaatc aaatctttag
   113221 agattacaga caccatgttt gacatctttc aaagtgcttt cggattggaa gaaatgacgc
   113281 tggagaagct gcacattttt aagcaaaaag ccagcgtgtt tcttatcccc aggcgccacg
   113341 gcaagacctg gatagtcgtg gccatcatca gcctcatcct ctcgaatctc tccaacgtgc
   113401 aaataggcta cgtggctcac cagaaacatg tcgcgtccgc cgttttcact gaaattattg
   113461 acaccttgac caagagcttc gactccaagc gtgtagaggt caacaaggag accagcacca
   113521 tcacgtttag gcacagtggg aaaatctcca gcaccgtaat gtgtgccacc tgcttcaata
   113581 agaatgtaag acctgacgtt tcagtacttg gcaattgtag agcatagccc ggctgtaaag
   113641 gtcagaaaat cgcagcaggg tccaaggttg tgctgtacat gggacctctt tcccattagc
   113701 aagaaccccc tgcaggacac gtgacatgtc cgggtgcatt ttgggtgggt taaatctcag
   113761 tcccaccaca aagggggcat cctccggttt gaacatcaga cccaacaaag cccgatgccc
   113821 agttatgggt acgtagtcgt tgttcagggc cgtgcatggc agcagacaag gacaggtgcc
   113881 agatgtgcct gggctatcgt cctccgtcca gccacgcagg atgttcacgt gggccccggc
   113941 accatagcat gtcacacatt ccccgttatc acatctggtt agcaggttga taaaatgggt
   114001 cagtgatgga aaggttggca tattggggca gcacatcagc atgtccatgt taacgaaaaa
   114061 catgtacagg gccccttctg cataccaggc accaccccgt cccagtggga tgatctccga
   114121 gggtgtgata tcttgcagtt cttctactgt tttaacggcg gttgaggtgg taaagacgtg
   114181 ggccgtggtc agatctgtgc aggtgactac agggttaccc ctaatctcca caggcaccgc
   114241 ctcacccact gcatctgaga ataccccaaa gtacatgaga gtcaggctgt gtggcccctg
   114301 gactgcctta gtgaagagaa cctcgggcct ggccacggtg gctagggttc cattgatgta
   114361 gacggtcaca taggtgggct tcttcttggg cttcagcaca atgagggtaa cattcatgta
   114421 ggttttagga ggtccggcta tctgaggcac gtacacagct gacacggcgg ttgtggccgt
   114481 atagactttc atctggggcg tagaggcatc gctcagcacc cagaggcact ccttgttgag
   114541 gaacttgcga agctgttccc ggctactgtt cgcggcggat gccatgacgt gccagaatat
   114601 atcccctctc ctcgggggtg agtgccaatt ggcctttaat aacaaagccc ccaggcagca
   114661 ccaaaaatgc ctgcccgtcc gatgtggtgg ccaggtggac gcagtgcccg tcagttccaa
   114721 gggctactag ctgggaagca gccccaacca gcccacccgg gggcctggag tcgatcacct
   114781 taccccaggc cgaggcccct tcctcataca gcgggtggct atctatccat aggcaggcat
   114841 ccggcgtctt tggtgcattg gagatagtag ctttcaccca acaactttcc caactaaccc
   114901 gtgtctggac agtgaagaac gcttccctga tcaggtctga atttttatag atacgggagt
   114961 aggaggtggg aataacaact gggatttctt gttgtgctgt ccaggcctgc atggccagtt
   115021 tttccctgaa gctagcagaa attctgaggg ccactgaaat gaggaagcga aactccctct
   115081 ctggagctcc caaaattgaa acctcagcaa gatctgttgc tggggaggca tgggtgacag
   115141 ctgtcatcct gtgcagtctg ccctgggcac tcagctctgg atatgtgaca acatagagag
   115201 cgtgggggct aaaaatatga gcaattcccc tgaccagggc cctggactca cgaatggccc
   115261 gacgggtctt agagaaagaa acaggcaccc tcgagagtgc ccccgacccg acccccacag
   115321 tgccgccagt ccctgctcgg cctccgccgc cttccccacc ggcgctgccc cggatgttgc
   115381 tggggttctc gagggctggg tggtgcttgg acacagaggt ctcagcagcc gccttggtct
   115441 cggccccggc cctaagtctg agccccaggc aaagggccgg actcccagcg tggcccaacc
   115501 tctgctcccc tctattctcc tcttgcgtta tctccaatag aatttgcttg aggtcatacg
   115561 ttttagggtg ctcgacctgg gccgcggcca ccggcatatg ctctataccc gcccctccgg
   115621 ggggcccagg atctataggt atgggctgca tagccgcagc agactcctgg accccagagg
   115681 cctctctgat aagatgcccg tcggtcagag cccttttggc cccctcaaag agagacaggt
   115741 aataaatctg tagctcccca accagccctc cttcatcgta aaatcgaagg gcggccacgt
   115801 ggaaggggtt gtagagctct ggaaggccct catcgcagta cactggcaca ctggtaaacg
   115861 tgccccgatg gctaggccgt ccgggcagca tgccccgagc agcaaacacg cggcagaccc
   115921 tcgtgagacc cgtccggtca ctgaagagag tctggcacca ggccccctcg cagtttggca
   115981 cgcgattggg gcaaagctct gccataaccg tgtcgggaac aaataggtgc acgaggaggg
   116041 gggtcccgag gccactcaac acttggttgt caatgtggac atccatagct ctctcatgcg
   116101 tttggctaca gcatcatagc gcttgtttct ggtggattta aataacaggg ccccgtagac
   116161 agtcttttgt gagtaaatag agatgatgac atggatgtag agactgagga ccacatccac
   116221 caccttctcg gaggaggccc ccctaaacag catcaggcag caagggaaca caaaggaaac
   116281 cagggccggg atgtgaggcc tcagcgcccc ctcctgatca aagagggcct cgctgacccc
   116341 ggagatgaca ttctcattca gaaagtagtg atagaggtga ttgaccacag tcttaaccag
   116401 gccctggact tgttcaggct cccacttgtc ccgctggtcc tgtgtgtctt gtcggatctc
   116461 ggtccagggc ctcagcgccg gctggaaatg cggccccatg tagttgcctg taagggcgca
   116521 caccactccc tcatgggtct caatcagggt gcactcgctg gatccatcac atacgtggta
   116581 ctcgccacag ccccagcagg caaacacgga ggccatgctc tcaggtaacg ggagatggaa
   116641 ctccagctta ctatacgagc acaggtggcg aggattgggc tcatccgtgc ccccctcccc
   116701 ccgcgggagg ctcaatcggc cttggtctga cattccaccc cggccaggtc caggagggtg
   116761 caaatattct ccaggcgctg cacctcagag acctcctgct caaagagacc tcccaccgcc
   116821 acgtagacgc gggccaccgt ccggggaagg tcagtggggt cccagctcag caattctcca
   116881 aattctctct ccccaatagt gcctcgcttc ttatcctgtc tttcagagca tccgggggca
   116941 gacatttcac ctcttgtttg tggacgaggc taactttatc aagaaggagg ccctgccggc
   117001 gatcctgggc tttatgcttc agaaggatgc caagattatc ttcatctcgt ctgtgaactc
   117061 ggctgaccag gccaccagct ttctttataa gctgaaggat gctcaggagc ggctgctgaa
   117121 cgtggtaagt tatgtgtgtc aggagcatcg gcaagatttt gacatgcagg acagcatggt
   117181 ctcatgcccc tgctttcgcc tgcacatccc gtcctacatc accatggaca gcaacatccg
   117241 agcaaccacc aacctctttc tggacggggc ctttagcacc gagctgatgg gtgacacctc
   117301 ctcgctgagc cagggtagcc tgagccgcac tgtgcgtgac gatgccatca accagctgga
   117361 gctctgccgg gttgacaccc tcaacccccg agtagccgga cgcctagcct cctccctcta
   117421 cgtgtacgtt gatccggcct ataccaacaa cacatccgca tcaggcaccg gaatcgccgc
   117481 cgtgactcac gacagggcgg accctaacag ggtcatcgtc ctgggcctgg aacacttctt
   117541 cctcaaggac ctaacagggg acgctgccct ccagatcgcc acctgcgtcg tggccctcgt
   117601 ctcctcgatc gtcaccctgc acccccactt ggaggaggtg aaggtagccg tggagggcaa
   117661 cagcagtcag gactctgcgg tggccattgc ctcaatcatt ggggaatcct gccccctccc
   117721 ctgcgccttc gtgcacacca aggacaagac gtccagcctg cagtggccca tgtacctcct
   117781 gactaatgag aagtccaagg cctttgagag gctcatctac gcagtgaaca cggccagcct
   117841 ttctgccagt caggtcaccg tctccaacac catccagctc tccttcgatc cggtcctcta
   117901 tctcatctcc cagatcaggg ccatcaagcc catccctctc cgcgacggta cctacaccta
   117961 caccggcaag cagcgcaacc tctctgacga cgtgctggtt gcgctagtca tggctcattt
   118021 tctcgcaaca acacagaagc acacgttcaa gaaagttcat taaactttat tgactacacc
   118081 agtcccttgt aaagcgacgg gtctcgcgtg acggcattcg tgagcagggc ttcgtccagg
   118141 ggcttgttct tggcggacat cattagccca gccgcaaata tcagaattag catcagaaaa
   118201 gtgagcccca caaacaccag tgtccagaga ggaagaccgt aagataaaga tggctgcctc
   118261 tcatctggaa cggtgggaag ctcagcagtt gtttttgtgg cattggacgt ccctttggag
   118321 gacagcgtgg gggccaaggt ggtagcgttg gtaatacggg tagtagcact ggtggtggag
   118381 gaggacctgg tggtgacatt gctagtcaca cccgtggagg ttcctgttcc ggcctcggtg
   118441 gcagtgatgt tctgtgcagt aaccttagtg gtgacattga tggtggatgc gttggaagtt
   118501 gttgggactg gtgtgacagt tgtcccagtg aatgtcaccg tggttgtgtt ggtgctcaga
   118561 atagcagttg tggttatagg ggcgctagtc gtggtcaagg tcgtagactg gtttgtgcta
   118621 ggacccgatg ccgacggtga tggtgtagtc acagccgttg tgcctgtcac gttccccgcc
   118681 gaggccgtcg aactgccact agatgtccaa ataaggcttg tctcacagat gagtatcatg
   118741 gccataacag cgcctgcctt gtctctggcg tgtgccatcg cgtctggacg cagaaggcct
   118801 cccggcctct tttatagcta gtctccacac ccaatactct actgaaccat cacatacatg
   118861 acctcctcga ggtatgcagg gaatgagcgg tccgtgagcc ggtcaacacg acattgcttc
   118921 cgtttcatgc ctccagctgc ccctgaccag ttaggaccct tgacggatgt ctttaacggc
   118981 gcggtgcagt tggtcaccaa tgacggccta aaggccaaca catccttgaa gcagggcgta
   119041 ggaatggtac caaactcggg gcccacccca tcaaagacat aatatgtctc atagtggcag
   119101 tgatgatgca tcaccaccac agcactcgcc aggaccctct gcatatcttg tacaaggcgc
   119161 ctttcaactc ggccactggc tctggtgacg ttaaatgtcc tgttcctatt agtcacagcc
   119221 tgtagatttg ggcacccaga ctcaaaaagt gcagctacat gaagggcagc cgcctcaaat
   119281 ccaccatgac ccccatggct gtccgtgttg ttggggtaat aagtcacatt gttaatgacc
   119341 acggccggga taagggtgta aaccttgcag aatggattgg tcggacaccc ataagacagg
   119401 ggcaccccaa aatcacgccc cttaccccga agcaccttgg cccccaccgg cataaagctg
   119461 ggcaaaaaga gtgggttaaa accaaaggcg agtagggcca ggaacgccaa atagcagcag
   119521 taatagatga aaacaaagct cagcatgaaa cagcgtggag gctcagctag ggtctctgcc
   119581 tctccatcat agacatcttc cttgaatctc attctctcac cgcatacctc gctcttcatc
   119641 caggaggggg ccatggctgc cattctacca gttaacgagg agagagagag taggtccgcg
   119701 gaaattggtg cccctctctg ccctcctgac gaggccatgg tgtcatccat ctccgcagtc
   119761 cgttcttcag ctttggcatt ggtccgggtc cgggtggtct gattttgatt ctgatcctgg
   119821 gtattggtct tggtctctcc tcccccattg gcatggattg gcataggtgg gtgtggctca
   119881 ggctcaggtt ccggccctgg gacggcagca gccgccggga cggtgaagtc gtggaaggta
   119941 gaggcccgtc cctcccgagg tcgtggggcc ggagccttat aaaagacttc caccctctcc
   120001 ccgctggcca agacacgccg ctcgtggacc acgccatctt cctcccggct gattgtgtgg
   120061 ctgacggtgc cgtgttccac cgccacttgt tcatcgacca tggtaccccc tttatcttaa
   120121 ccagcaagtg gccgtcaggg tctcttgaga gtatgccgct gtggccaagc gaggccccaa
   120181 attaaatagt gatgccaaag actgtaggta ggtcatcatc acacgcatgc gtgataaatc
   120241 atccgccact gacaggtcat ccaggtctat ccgggctatc tcatccggca ccatttcctg
   120301 gaagagattc aagaggtcgt gatgctcatg ccggataagg cctcggacca ggcgcatact
   120361 ggccctgggc agcagggtca ccatgatgca aaagtagaga ctcagattgt ccagcagggc
   120421 caagccaagg ggccctggca cctccgggag ggccaactcg tagtggtgcc ccaggtatga
   120481 aacagagcca agatgcatgt gtacatcgag catgtctgcg ttcccgggag cctgcatgac
   120541 aacccgggag tacacgttaa acaggagaat cttctgcagc acctcctctg ctatgggcgt
   120601 aggcagcacc atggggaaaa caatgtccac atcattggac tctaacttca cggtggcatg
   120661 ctctcgtcca aataccgggg gcataacact gaggctcccg gtcccatgcc actggaaaaa
   120721 gggctggtac ttgttcttaa tggcgtaggt ctgacctgga acaatcttgg tgagtatcaa
   120781 actgtccacg ctaacctcat ccagcacggc cagggtgcaa tcagacaggt agttgtacat
   120841 ggacacgtag tccgggaccg tctctagaga gtacacctga cccaagccca atccctgcac
   120901 attctgcgtc ccgtgagtgg aagccagggg taagatgcag ccaatcctct gttgcatctt
   120961 ggcaatctca tcggtataca gacgagagga gagagacact accactttca aatccatctt
   121021 tattgacaat tatcaaaaaa ccaccttatt tccaaacttt aatattcttc gtaccggcgc
   121081 cacctcttca attatatagt gtccgtaatg gatgggggcg tgggtctgtt tgacagacat
   121141 aaactcatcg atgagtgccc gggaggaggc tgagagtgcg gggaatgcct cctgcagaaa
   121201 gctgcagggc tgctccagaa acacgtcagt gccagcaatc actacaaact gcacctctgt
   121261 gttgctggtg gctgggtgcc ctccaagtcg ctggctgtac tcgttgacca tgttgtagag
   121321 tcccctgttg ttgcgcagaa gctcctcctt gttgaaaaat gcccggcagg ggctgtagag
   121381 gcccgggacg gccgtctggc gataggagga gttgtacatg atgtcaccca gagaacccag
   121441 ctgagatgcc cagggattca cagtgctccg gtattcatag gcggcatccg ggcgagaatg
   121501 gtcatagatg agcccctcgg caacctcctg attgtagttt tcacaggaga ccacacaggc
   121561 ggcccgtccc cttggagagt tggacttttg aaaataagcc acgtctgccg tgaccggtgt
   121621 tacgataatc tcacaggtgg cctgctggcc gtggcagagt cctggagctc cattaacatt
   121681 agtcatacct gccaggtatg tcctggggtc ccgaagcagc gtcccattgc gctgagcgcc
   121741 caccttggcc ttgatgtagt cattgacttg ctggttgcca aaggcctcgg ccggaaagac
   121801 gctaaagaag tcttgggtgt ggatacccat gtcagtagtg atggccgcca ccctggccgg
   121861 agtcatggtc gagctataac taagcccggt gtcgatggag gccatctcgt gatgcacctc
   121921 aaaggttacc gcgtccaccc tggcctcccg gcggctaaca tttggggtcc caatgaacat
   121981 ggatgttgag gccctggagc taaacaatat gttttcagag aggatctcat cggtcctgac
   122041 cacggtcatg gccacccctg ggtggatctt gagcttggcc tgggcaatat aggccatggg
   122101 ggacatcttg atgtgcatgg cggtcattcc actgattgaa acgagggaag gaagacattc
   122161 ggccgcgtat ttgcccatgg gcgagcggtg ccactcccgg tactctgcaa agagctgctc
   122221 tggccggttg aaggcttcca cggcccgctg ctgaggattg cgcataacaa aggtggcaac
   122281 atcctggtgc atggtggcag ccactcgcgg gtccccgtaa aacatatgga aaggaatggc
   122341 gtgaaagaga cactgggtga cggcccgggt cctctcggag aaggcaaagg ccaccagccc
   122401 gttcaccaaa acagtctgct ctgtccgctt gtcggcggga ttcggggcca gctgctgcgt
   122461 aacgtcattg tccaccgaca cacgcacggc acgggtgaaa gtggggcagg tcatgaatga
   122521 ggcgctgagg tccctgatca tgcccacggt ggggcggagg tcggagatct ccagcagatc
   122581 cctgagcgtc ccattctcca aattgtcgag gatgtcctcg tccctggtaa aatggtggct
   122641 gaaggctggc ccgttgtagg ccagggtctg ggccacgtgc tgaaagtcca ccccgaggcc
   122701 gcacatgtgg gcattggtgc aggttgggag gaaaacgtag taaaagatct tttccagcac
   122761 atccgcatgc ccctcatcta cataagggcc taggtgcaga cggaaatcgt ggtcgtggtc
   122821 tccgttaacc cggtagccgt acaaggccac aaattgggca gccatctcat ccatgtttcc
   122881 aaccctctca ataaactggg gcgcggccag ggtgtcagcg taaacctcat ttccgataat
   122941 aatctggggg gcccggtcac taacggtgag aagatgggtg aaaatgtctg tgtaggccac
   123001 cggggggagc aggttagggt ccaggagagc gcagacatac tgacccacgc tctcatcccc
   123061 cacaacatct gacccggcca ggcgcatcag ggcctgctct agggctataa gttccccata
   123121 gatttttcta tacatggaat aggcctcctt ggagatggcg ttatttccca ggtggcggca
   123181 gatgaacttg atcatggaaa agctgttcac aaaggcaagc ctccctgacc gttcccagta
   123241 ggtgttgatg cacagggaca ccaaaggcac gttcatgaca aacttttcct caaacccgtg
   123301 gatcatagcc tcgactacgt agaagaaggc tggataggca gtgtcatagg cagtatcctg
   123361 cacagtctca ataacggcct gatccaccac gtgggccaga gatgtggcgg tctcaaactg
   123421 ctgcccccgg gcctcttgga atgcagctgg ggccagggga gtcggcaggt tacccaccat
   123481 tagccggtgc acagccctgt gcctggccct ctccccggca tccctgccaa tgtaaatatc
   123541 ataaaggggg tgcagctcca gccgcagcag gtcataattg gacgggtgga ggaagtcttc
   123601 ggtgggcagc ccgcacttga gagctatatc tgtcacgggg gctgcatact tgttatcata
   123661 gaactcgtcc acaataacaa gcacattcat gtgattgggc ctcctgtgtt gcagggagta
   123721 ggtctcgcgc ctgtctcgcg gggccggggc cgcgttgagg ctgtttaggg tatgggcggg
   123781 tgtgtggagt cgggggtgac agagaacctt gagagcattc tgtaggttaa acgcgaggag
   123841 aaggttattc ttgtttacga tccatgcctc caccggtagc tgctgtgtgg ggttgtccag
   123901 cattttgatg gcggcggagg tcgtgtactt gggattgggc ataaacaggc ccactgggaa
   123961 atagtagctg tactgcattc ttctgttgag ggggtatggg gactgagtgt cattgtacat
   124021 cttttgcagg ctttccacgg ccaccgcgtg gttgcccagc ttgatgacgg cggctgagat
   124081 cggcacccgg ggctgatcct cgacccctgc ggccacagcc ggcaggtcag acttggtgct
   124141 tccggctttt tccggtgagt ccacgatcct agccatgaaa tgctcaaacg tacgcatcac
   124201 gcgcccgtag ctcacggcag tgaccaggtt ctccccccgt accacaaaag aagcatagct
   124261 cgagggcccc ataatctggt tgtcggcctc ctcacccagg aaggtcaaga gctggcgcag
   124321 aacgttgtcg gtgacaataa acaccccccc cactggctct ccccccttgg cggtcgtgta
   124381 ggtactgacc cccttgagca cgctctcccc ggacacggcc gctaccatct cagagagacg
   124441 gcttcgcacg tactgagaaa acccggagcc catgttctcg gcccggtcca ggaagaagga
   124501 gtgctccagc agatgcctct tgaacatggc aatgaggtca gacttgacag tcttggagaa
   124561 ccccctctca gtgaaggtgg gatccgccag ggtctgcagg ataaacatgg gaggggcatg
   124621 gcgaagcttc acactcagga cggtgttaat gaggcccctc tccagggcat cgaccccaaa
   124681 ctgtagggcc gaggccacgg tcttgacagc ccccacgtac tctgcgtact cgaccggggt
   124741 ctcggggata ctatgcagga tctccagatc cagcatggac agttccattt ccgtactaat
   124801 gtggtgtttg tggcaatttt tgaccacaat gaatgtccgc tgcttgctgg gtctccttcc
   124861 gtccccgtga gcaatggtgg ggacggagat tcgaaattga atcttgccat ccgtcatacg
   124921 actcaggtct ttgaattccg tgttcacaca ggacacggcc agtgccgtct ccaggaagcg
   124981 aacatattgg atggcgttcg tgtagacccc gagtagcacc tcaaacttga tgcccgcctc
   125041 tctggcatcc ttgcccacca gcaggtcaaa gctatgaaac aacccctcag ccgctgactg
   125101 ccgcaggttc gagagcaggt cggcatccac cgtcagatag gggaagggtc tgttttccac
   125161 accctcattt gaggccatga cacaaggtaa gagggagatg gggggaggtc tcgagggctt
   125221 ctcttcacag ctgggtctct tttacgccct ggcctgcaac cgcagcccac ccacacttcc
   125281 cgaggatgct acccttctaa tcaaatggtt ggacacggcc ctgggcaggg aggccacctt
   125341 ttacgcgtgt cgggctatgc gtcggcttct actcggcgtt atccgaatga atgactgcca
   125401 ggagctgcca cccggtttaa taattctgag tccgggcacc gtccctggcc cccttggagt
   125461 ccagagtctg gagcatacag actgcgaaat atggtcctct gcccaccctg accacgctgc
   125521 ccacctcccg gtgcccaggg tcatcacata caccgactgc ccgggttcca taaacacgag
   125581 ctcaatgttt cgccttatca tccgctactt gtctcatcac caatttgagc gctgcttcga
   125641 gcagttctgc cgcgtggtcc cgcgtcgctt cctagggacc tgtaagcgaa actctgcaaa
   125701 gatgctggct catctgaatc aggttaccag gatccccccc tgtccgccct tcagcgggcg
   125761 ggaggccaga ctcaagttcc acttcttctc ctggagcaca ttcatgctgt catggccaaa
   125821 caatgccaca ctccgggaga tcaggacgag ggccgccacc aacctcaccc accacccaca
   125881 tctagtggat actctgtacc acgcctctcc gcagacccca tttctgacac gcagcggtgc
   125941 tctataccgc ttcgtcacct gttgcaactg caccctgccc aatatctcca tccagcagtg
   126001 caaggccggg gacagaccgg gggacctgga gatcattcta cagagtaacg gcggagggag
   126061 gcccgcgagc ttccagttcc cctcctcccc aactggctcc ctattgcgat gcatagttgc
   126121 tgcgtccctg ctgccggagg tgtccgtggg gcaccaggag ctgtctccgc tgcggtccag
   126181 aagccaggga gggcagacgg atgtcaggtc gggcccggac ccggcccgga gactggtggc
   126241 cctcctgcga agggaagatg gggcacctaa agacccccct ctgggaccgt ttggacaccc
   126301 ccgggggccc ggcccggcca agagcgaaga cgaggagtct gagcgtcgag acgcccctcc
   126361 acccccgctc gattccagct tccaagcttc ccggttggtg cccgtggggc ctgggtttcg
   126421 cctgctcgtg ttcaacacca atcgggtgat caacactaaa ttggtgtgct cagagcccct
   126481 ggtgaagatg cgagtttgca atgtcccccg cctcatcaac aactttgtag cccgcaagta
   126541 cgtggtgaaa gagacggcgt tcaccgtcag tctattcttt acggacgggg tgggggccaa
   126601 cctagccatc aatgtcaata tcagtggcac ctatctgagc ttcctattgg ccatgacgtc
   126661 actgcggtgc ttcctgcctg tggaggctat ttatcccgcg gccgtgtcaa actggaactc
   126721 gactctagat ctccatgggc tggaaaatca gagcctagtc agagagaacc gaagcggggt
   126781 cttttggact accaactttc cctcggtggt gtcctgccgg gacggtctca acgtgtcctg
   126841 gtttaaggcc gcaactgcca ccatatctcg agtgcacggg cagacattgg agcagcacct
   126901 gatccgtgaa atcaccccca tcgtgacgca tcgagaggca aaaatctccc ggattaaaaa
   126961 ccggctcttt accctgctag agctacgcaa tcggagtcag attcaagtgc tgcacaagcg
   127021 tttcctggaa ggcctgctag actgcgcctc cctcctgcgc ctggatccca gctgtatcaa
   127081 ccgaatcgcc tccgagggcc tgtttgattt ctccaagaga agcatcgccc actccaaaaa
   127141 ccgacacgag tgcgcgcttc tgggtcacag acattcggcg aacgtgacaa agctggtggt
   127201 aaacgagcgc aagacccgcc tggacatact gggccgtaac gctaactttt taacgaggtg
   127261 taagcatcag gttaatctaa gacagtcacc tattttcctg accctcctga ggcacatccg
   127321 ccgacgtctg ggcctgggcc gtgcttccgt aaaacgagag attacccttc tcctggccca
   127381 cctgcgcaaa aagacagccc ccatccactg ccgtgatgct caagtgtaag cagcccgggg
   127441 cccgcttcat tcacggggcc gtgcacctgc catcgggaca gattgtcttc cacaccatcc
   127501 acagccccac tcttgcctcg gcgctgggac tgcctgggga aaatgtaccc atcccggccc
   127561 tcttccgtgc ctcgggcctc aacgtccgtg agagcctacc catgaccaac atgagggcac
   127621 cgatcatctc gctggctcgc ctcatcctgg cccccaaccc ctatatccta gagggacagc
   127681 tgacggtggg catgacacag gacaacggca ttcccgtgct ttttgccagg cctgtcattg
   127741 aggtaaaaag cgggcctgag tccaacatta aagcctcctc gcaacttatg atagcagaag
   127801 actcctgcct gaatcagatc gccccctttt ccgcatcaga gcaccccgcc ttctccatgg
   127861 ttgagtccgt aaaacgagtc cgggtcgatg agggagcaaa cacccggcgc accatccggg
   127921 atattctgga gatccccgtg actgtgctct catccctgca actgtctccc accaagtcca
   127981 tcctgaaaaa ggcaccggag cccccacctc cggagcccca agccaccttc gatgccaccc
   128041 cctatgcccg catcttttac gacatcgggc gacaggtgcc caagctgggc aatgcccccg
   128101 ccgcgcaggt cagcaacgtg ctcatcgcca accgctccca caactctcta aggctggtgc
   128161 ccaatccgga cttgctgcct ctccagcatt tgtacctcaa gcacgtagtg ctaaagagtc
   128221 tgaatctgga gaatatagtg caggactttg aggccatctt cacctccccg tctgatacca
   128281 tcagtgaggc tgaaaccaag gcctttgaga agctggtgga gcaagccaaa aacaccgtag
   128341 agaacatagt cttttgcctc aacagcatct gttccacctc tacactccca gatgtcgtcc
   128401 ccgatgtcaa taacccaaac attagcctgg ctctagagaa gtattttctc atgttccctc
   128461 cctcaggcac cattatgaga aatgtcagat tcgccacccc catcgtccgg ctcttgtgcc
   128521 aaggggctga gcttggcacc atggcacagt ttctaggaaa gtacatcaag gtcaagaagg
   128581 aaactggaat gtacacactg gtcaagcttt attacctgct gcgcatctaa aggaaaaaca
   128641 taacaatctt gtgaaccaga aagataccca gagcaaaagc aataaagtac aggattattg
   128701 ccaaaacaac gtgtgctctt tcttcataca ggcccgcaat ttccatgaca gtcccgttgg
   128761 tggtcagcag cagatagtga acgtggaggt tgtcaaaatc aaagtagttg gagctcaaga
   128821 tggagttttg gacttcctgg gaggtgatgt aggttgtagt ttccaggcct tccttttcat
   128881 cataactgag cagggcaaag ccacaaaaaa tgcaggattt ctgcgtcctg gtaaaattct
   128941 ggatctttgg aatctggcgg ggctccccag ccacagcacc ctgcgaacat ttattcatta
   129001 taacggggga gagaaagaga gagctgctga gataggtggt gctggcctcg tatagcgccg
   129061 agcctcggac ctcacggtca ctagagatta tgaatgtcac attgatgagc gggataatca
   129121 tcagaacttt gtcgagcctg tccacgcatt tgtaggcggg gagatgccac gcatccctgt
   129181 cttctcgctc caaagagagc cgcccaagaa acccatccac agcatttgaa acggccgcct
   129241 ggtccagcgt tgcctcctgg ggggccatgc tcagcagctt gtctcgtgtg aggtcaaatc
   129301 gtaggctgag gtagcacggt gagaagagcc cgctctctgt ccccagggct agcccccgca
   129361 aaacctcccc aatctctagg gccgagcaca gggcggtgga cagcagttgg tatagggcaa
   129421 ggttgggccc ctgggtagtc acgttcagcc gcaactcgcg tagcaccacg tggctgccga
   129481 taaacagggt ctctctcatc acggtatgca ggggctggaa aagggggtgg cggttgtagg
   129541 ccgagagaag cacagatgtg gcgcctccaa tgaggccact gtaaaccccg gccttggggt
   129601 agccgacggt ggctaacctc agcgcgtact cctgtttctc agtagtcagg tgacccagct
   129661 cctccatctt gaccgtggcc atcagcatgg cggccaagcg ctccagcccg taggattgca
   129721 tgcccttgac agtggcccca taacatatgc cgatgatgtc tttcaggaca gtcagctcaa
   129781 agaagctctt ggccaaccag cggaggtcca cgcagccatt gccagtctca cccacagcat
   129841 gacccacctt aaagaaggcc acagaaacct caaacatggt agtcagcgtt tccgtgtcca
   129901 gttccggctc ccggcagcct cccttcatct ccagcaggac cagtttctgg agaacgtagc
   129961 gagcgtagct ggcggctgtc atggtgacgg ctcgggaaaa catatccttc aggttgggta
   130021 caaagtagtt gtgaaagttg gcataatgca caaaggttgt aacaatcacc agggaatagt
   130081 ccccgctttg ggcactggtt aaggatgggt aactaaaagg ccccctcaga tccggcaggt
   130141 ccttcgtctt gccaaagacc aggctcaaca catgctcatc tcccttctcg gtcactcgct
   130201 tgtaggtgcc catcagaaat ttagaagtca tggcccccgt gtactgaaac ttgtccccgt
   130261 tgatggacag ggccacataa gacaagtgac agcgcagctg ataaaagaca tagctgtgtg
   130321 gccgcgtgtt gggcagcatg gtgccaatat agtagaagag ctgcttctca aggggggcac
   130381 taagcatgca ggcaggggaa ttcaggccgc taatgactcc gggatggacc ttagatgcat
   130441 ccacttgcat ggatccttca gagacagcag ggatatcgac aggctcggcc agcgcaatac
   130501 caagggtacc agacgtcttg taaattaact tgtagcggtt aagcatagac gccaaatctt
   130561 cggtgacatt tgcctctctc cacagcgcct ctgggctaag gcctgggacc tttgccatca
   130621 gttcggtcca tgggatggtg taatgcgaag catgcccctc tatgtccagg tgcagcttaa
   130681 cctcgctgag gctggcagcc cccacctccc atagcaacac caggcaaaaa acacagagca
   130741 actgcatcct agtcccgatt tcccctctca aaatcagaga tcaccttgct cagaccagcc
   130801 caatcgaaaa actgagatcg tattgccgga ttcttcaatg cctgcatgta aatctccgtc
   130861 cagcatccag gtaaatcgtc ctgaaactct gagaggtcca caagcacaaa ctgaaggtag
   130921 gctagcgttc gggtgaacgc aagacaaact tccaacaaca ccgcgtcggc tcggaaaggc
   130981 tgtatgactt ccttaagtac actaaagatg ctgttcttat acagcttctc ggccacacca
   131041 cttcgaatta tgggggtgtg gctttgatga catactgtcg tgattgttgt tagaccggca
   131101 cataccttca caatgtcctc gggggcaaaa tactgtgtta ggagccaggc acagtaaacg
   131161 gcgtgatatg catcgttgac actcttcagg tagccagcat ccagtcctga ctcatgtttc
   131221 ctccctcgct tcttcaggcg gcgcatgttc tcctccacgt ttaacttcat ccagactatg
   131281 gtgtcccccg ggtctgcggt aaacgtggcc aaaacttgaa taaagtcact ataggagaga
   131341 agctggctcc ggagcagcat tagagggaaa accacggagg ccgacagcaa atggcgatca
   131401 tgcaaaatcc aacaatccag gggcgcgact gacctggcac cagactcggt aaccagcaag
   131461 ctccgcttcc tagaggccaa gactctgaaa ggggtggtaa atttcatctg gcatgctaaa
   131521 acctcagccg acgtgtcttc ccttccatgc ctcgcccgag tcacattctt gtgcatggcc
   131581 ttaatggcat tttcatacac atgagtccag taccgcatcg gttcagggac tacaatggtc
   131641 aggtccccaa agacagcctt caaatgattc agcatagtag tctttcccac accaggggca
   131701 ccttccaaaa atagggaaca ggcaggtttg attactggta catgatttgt taggtgggtc
   131761 acaattggaa cccgcatgct ctccttcctc tgagccttgg cctggcgggt gtcttgggca
   131821 tcatccagat tcagaacatt catcacactc ccacttagcc gcttcagctg ggcagcatgc
   131881 ttggataact tactaaactc gcgcccatgg gcggccaggt gttcgaagag accagaaggc
   131941 ttacccttgc caccattctt ttgttttaac gcggaatgag aagagggcct gcggaaatta
   132001 gactcatcct cagactcaca gtcagatttg tcatcgagcc caaggccggc caggccctcc
   132061 tcaaagcctt tctggtacat gaagctccgg ctcgtggagt ccgcacctcc ttctgtgcac
   132121 gaagttttgc ggaaccagga gaaggggtct ggcgtcttgc tggggccaca ctcccggcta
   132181 cggggcttcg gggtaggggc agtaggcttt tggtgtgcgg gtgctggtgg ctgggctccc
   132241 ctgggcaggg taaaggggca cgatgtgtgc cggctacccg gagagtttcc agtattagat
   132301 gtcacggcag cctgggtccg gcacggcacc ctctccccag acagtccggt cggagccatc
   132361 aaggggggcc agtgggtggg cacctggtag aggccgtcgt catcttcctc acctgcccct
   132421 gagtcactac cggttggggt aagaactgag ggggcaaagt catcaatctc agcgtaaaag
   132481 ttttcgtgtc tttcgttttc aggggactca tcctcctgac attttcgcca gccgccgggc
   132541 gggccggcct cctttcctgg aaatccagcc atggatccca cccggggtct gtgtgccctc
   132601 tccacacacg acctggcaaa atttcacagt cttcccccgg ctagaaaggc ggcaggtaag
   132661 cgagcgcacc ttcggtgtta ctccaagctg ctctctctta agagctggga gcaactggcc
   132721 tcttttttgt ctctgccccc gggacccacg tttacagact ttagactatt tttcgaagtc
   132781 accctgggtc ggagaatcgc agattgcgtt gtggtagctc tgcagcctta tccccggtgt
   132841 tatattgtag aatttaagac ggccatgagc aacacggcca acccgcaaag cgttactcgc
   132901 aaggcacaga ggctagaggg caccgcccag ttgtgtgact gtgccaattt tcttcgcacg
   132961 tcctgccccc ccgtgctggg cagtcagggc ctggaagtct tggcggcgtt ggtatttaaa
   133021 aaccagcgat ccctgagaac gctccaggta gagtttccag ccctgggcca aaagaccctc
   133081 cccacctcca ccaccggcct gctaaacctc ctctcccgct ggcaggatgg cgctctccgg
   133141 gcacgtcttg atagaccccg cccgactgcc cagggacaca ggccccgaac tcatgtgggc
   133201 cccaagcctt cgcaactcac tgcgcgtgtc ccccgaagcg ctcgagctgg cagagcggga
   133261 ggccgaaagg gccaggtcgg agcggtggga caggtgtgcc caggtgctca aaaataggct
   133321 gctccgcgtg gagctggacg gcatcatgcg tgaccacctg gccagggcgg aggagatccg
   133381 ccaggacctg gatgctgtag tggccttctc tgatggcctg gagagcatgc aggtcaggtc
   133441 cccctccacg ggagggcgct ctgcgccagc cccgccctcc ccatccccag cccagccgtt
   133501 cactcggctc accgggaacg cccagtatgc agtctcaatc tctcccacgg acccccctct
   133561 gatggtggcc ggcagcctgg ctcaaacgct gcttggtaat ctgtacggga acatcaacca
   133621 gtgggtaccg tccttcggac cctggtacag gaccatgtcg gctaatgcca tgcagcggcg
   133681 cgtgttccct aagcagctga ggggcaacct gaactttacc aactccgtct ccctaaagct
   133741 gatgacagaa gtggtggcgg tgcttgaggg caccacccag gactttttct cagacgtcag
   133801 gcacctgcca gacctccagg ctgccctgat cctctcggtg gcctacctgc tactccaggg
   133861 gggctcctca caccagcagc gccccctccc tgcctcacgg gaagagctgc tggagctggg
   133921 cccggagagc ctagagaaaa tcatcgccga cctcaaggcc aagtcacccg gcggaaattt
   133981 tatgatttta acaagcggaa acaaggaagc gcgccagtca atagcccctc tcaaccgaca
   134041 ggcggcatat ccacccggca cattcgcgga caataagatt tacaacctgt ttgtgggagc
   134101 gggactactg cccacgacgg ccgcgctgaa cgtgcccggg gcggcgggtc gggaccggga
   134161 cctggtgtac cggatcgcca accagatctt tggggaggat gtgcccccct tctcatctca
   134221 ccagtggaac ctgcgcgtag gtttagccgc actcgaggcc ctgatgctcg tctacacgct
   134281 ctgcgagacc gccaacctgg ccgaggcggc cacccggcgt ctacacctat cgtccctgct
   134341 cccccaggca atgcagcggc gcaagcctgc catggcgtca gctggtatgc cgggcgccta
   134401 tccagtccag acgcttttcc gccacgggga gctcttccgc ttcatctggg cccactacgt
   134461 gaggcccacg gtggcggcag acccccaggc ctccatcagc tctcttttcc ccgggctggt
   134521 tttgctggcc ctggagctga agttgatgga tgggcaggct ccctcccatt atgccataaa
   134581 cctgaccgga caaaagtttg acaccctctt tgagattatc aaccagaagc ttttatttca
   134641 cgacccggct gccatgctgg cggcgcgcac acagctgcgt ctagccttcg aggacggcgt
   134701 cggtgttgcc ctggggcgcc cctcgcccat gcttgcggcg cgggagatcc tggagcgtca
   134761 gttctcagcc tcggatgact acgaccggct gtacttcctg acgctgggct acctggcctc
   134821 cccggtggcc ccaagctgag ccagttcctc gcactggagt gggtcattgg caaaaaggta
   134881 aataaactca tcgcacgggg gttttgcctc cttctcgtct cttgtttcgg gtaggggagt
   134941 aaggccgtgc caggccgcca tgctcagggc cacggcgtgc cagaggccct cgtagtcgtg
   135001 cgcatccgag aggatggcac ggtccagaag cagatagccg gccaggcaga ggaaggccac
   135061 aaagaggggg cgaaggcgtg cccgaacccg ggtttcatgc tcgtctgcac cccagtggac
   135121 aaggcagtag aggacaccca ccaccaggcg gttagggagg acactgccaa ggttgaagag
   135181 cagatttccg tcagccaggg tgacctggct caggtccggc gccctgcgca gtccaagctg
   135241 cgcccacaca catgcacaga cggcccctgt gacatcaggc cggtcatgca aaaacagaca
   135301 aagagaccgt gagcggttac cggggcgcag ggcctctgcc gggaagccca cccgggccag
   135361 ggcccggtaa agcaggtacc agtattcatc cggcaccttg cgtgccaaca cacgattcgt
   135421 gcggtttcca gtatttatca cggcttcccg ccacaggtaa aagttaacac ttagggtcag
   135481 cagcttggtc agggataggt gcaaaaacct gagctcgtcc tcgcgcagag cgcaaagcgg
   135541 ccagttcttt agcatcttca ggaggagccc gtgaatccca ggtgtcattc gcgcgtcatc
   135601 cccgcgcacc cccagtccca ttaacatagc gggcacaatg gtgcaggcac cgtctgtata
   135661 cgtctgcggc ttcgtggagc gcccggacgc cccacccaag gacgcctgcc ttcacctgga
   135721 tcccctcacc gtcaagagcc agctccctct gaagaagccc ttgccactca cggtggaaca
   135781 cctgccggat gctccggtcg gctcagtctt tggcctttac cagagccgag cgggtctctt
   135841 tagcgcagcc tcgattacct ctggggactt cctgtccctg ctggactcaa tttaccacga
   135901 ttgcgatatt gcacagagtc agcgcctgcc cctccctcga gaacccaagg tggaggctct
   135961 gcacgcctgg ctcccctcac tgtcactggc ctccctccac ccagacatac cccaaaccac
   136021 cgcagatgga ggcaagctgt ccttctttga ccacgtgtct atctgtgccc tgggtcgtcg
   136081 gcgcggcacc acggcagtct acggtacaga ccttgcgtgg gtcctgaagc actttagtga
   136141 cctggaaccg tctatcgccg cccagattga gaatgacgcc aatgccgcaa agcgtgaatc
   136201 cggatgcccg gaagaccacc ctctgcccct cacgaagctc atagctaagg caatcgatgc
   136261 tggatttctg agaaaccgcg tggagactct gaggcaggac aggggtgtgg ccaatatccc
   136321 agccgagtcg tatttaaagg ccagcgacgc cccggaccta caaaagccgg acaaggcact
   136381 tcagagccca ccaccggcct ccacagaccc agccaccatg ctatcaggta acgcaggaga
   136441 aggagcaaca gcctgcggag gttcggccgc cgcgggccag gacctcatca gcgtcccccg
   136501 caacaccttt atgacactgc ttcagaccaa cctggacaac aaaccgccga ggcagacccc
   136561 gctaccctac gcggccccgc tgcccccctt ttcccaccag gcaatagcca ccgcgccttc
   136621 ctacggtcct ggggccggag cggtcgcccc ggccggcggc tactttacct ccccaggagg
   136681 ttactacgcc gggcccgcgg gcggggaccc gggtgccttc ttggcgatgg acgctcacac
   136741 ctaccacccc cacccacacc cccctccggc ctactttggc ttgccgggcc tctttggccc
   136801 ccctccaccc gtgcctcctt actacggatc ccacttgcgg gcagactacg tccccgctcc
   136861 ctcgcgatcc aacaagcgga aaagagaccc cgaggaggat gaagaaggcg gggggctatt
   136921 cccgggggag gacgccaccc tctaccgcaa ggacatagcg ggcctctcca agagtgtgaa
   136981 tgagttacag cacacgctac aggccctgcg ccgggagacg ctgtcctacg gccacaccgg
   137041 agtcggatac tgcccccagc agggcccctg ctacacccac tcggggcctt acggatttca
   137101 gcctcatcaa agctacgaag tgcccagata cgtccctcat ccgcccccac caccaacttc
   137161 tcaccaggca gctcaggcgc agcctccacc cccgggcaca caggcccccg aagcccactg
   137221 tgtggccgag tccacgatcc ctgaggcggg agcagccggg aactctggac cccgggagga
   137281 caccaaccct cagcagccca ccaccgaggg ccaccaccgc ggaaagaaac tggtgcaggc
   137341 ctctgcgtcc ggagtggctc agtctaagga gcccaccacc cccaaggcca agtctgtgtc
   137401 agcccacctc aagtccatct tttgcgagga attgctgaat aaacgcgtgg cttgaaagta
   137461 aactttattg cgtgttagta cctgtccatt cacaggggta tccagccctt gcgccgcctc
   137521 ccccagcccg ccagccaccc cagacaggag atgataatga tgaggagcac cggagccacc
   137581 acagcacaag tgattaggag cagggcccag tgcacccagg tggtcttagg gcgccaggga
   137641 tcgattggaa aagggcccag ggtcactggc ttatgcgtgg gacgtttaga aacaggccgc
   137701 ctatggggcc tgtgactggt gcttgtggtg tgggagacta atgtggtggg ggctatggta
   137761 gtggctggga taacagtaag atgcatacgc tgagtgaggg tccggttggc atggtattgg
   137821 tcgtcttctt cccctgcaga gtaattgcag tggaccccgg aggccacact gcaatttctc
   137881 agtgtcacat tgcacgtgta gtaacctgca tgcgcaaggg tcacattggg gattatcaga
   137941 gagacggagg tgttggagtc atttacccat tctagggtaa ggctataatt gtaacccccg
   138001 ttagttatat gagttccgtt gttggaagta gctacggcca agggcagttg tccatccccg
   138061 ggagtgtatc cccggcccaa ctcgatccga gagaccgact cattgctagg aacgctgcag
   138121 gtgagattca ctctagcacc tgcatgggcg gtgacatttt caaatttaac cagatctgag
   138181 aaaaatgcac aaacagaccc cacacagcag cacaatagaa gcactaaatg agtcattcct
   138241 aaactgtcag ttttaaaact ccctgcttct caggcctaaa tatgtggtgg ggtgtgctta
   138301 ggatcacttt catattctgc aacaacagcc atacccggaa gaggagctgc cggttgccat
   138361 ttttcaagct gctaaaccac gagtggcagc aggcctaaga agctcctcag caacatggag
   138421 acctcgaagg gaaactggca ggagcaggga gtcacgtagg cactagcctc ttcatgtgag
   138481 gtaagagatc gctaaaaatg ggatcagggt atgtaaaccg agttttgcgg gggatggtga
   138541 gccagacacg gcgggtgggg gaaggagctg acacgattga gtagaaaggg ccaaaaatac
   138601 accagctata aggaattgct caggccaaag ttgttcctca ggtggcttta ggcctaatgt
   138661 aggcaattgc gtgcctagaa cattgctaat gtgccctggg tttcctgcct tcatgcaaat
   138721 attctacctc ccccggcctg gtgcaaaatg tctgcctcag aatactaaca gctaatccaa
   138781 gctaacattc tatcagtaaa cgggcagaaa actgataagg accgcggagt ttggccctcc
   138841 gcggtgtccg gtggtcctca cacgtgccct ccccccgggc cgatggctga ggcccggaat
   138901 atgcaagtgc atctttctaa ccagtagggg cctccaccta ggtgctttgt taatctttag
   138961 tgggaactag tgggagtgct gtgcctcggg tacccctatc ctataggtcc taccggagct
   139021 ccttgtcttg ataatccctg taaacacaca ccacctaaga acaaggcatt gttaaccttt
   139081 ggtggaacct agtgttagtg ttgtgctgta aataagtgtc cagcgcacca ctagtcacca
   139141 ggtgtcaccg gaggctactt gcctcagtgc cacttttacc ttctcaaatc tatacggggg
   139201 gggggggggc tctgtaacat ttggtgggac ctgatgctgc tggtgtgctg taaataagtg
   139261 cctagcacat cacgtaggca ccaggtgtca ccagggctac ttgcctcggc atctcctcac
   139321 cggagaaggg gttaacaaac ccgtgggggg tcttagtgga agtgacgtgc tgtgaataca
   139381 ggtccatagc accgctatcc actatgtctc gcccgggcta tatgtcgcct tacctcccct
   139441 atatagtcac gaccccaccg aaccaggcat gatgtagaat aaaattttat gcatcatctt
   139501 ctaatctgtg ccgcttggag ggaaacatga ccacctgaag tctgttaacc aggtcagtgg
   139561 ttttgtttcc ttgatagaga cacaaggact gccagcccca ttggggaggg ggggtgggta
   139621 cgggagagtt tgggctcgtt taaacaaagt ctcatctgat gctctgtggc acctcaaggt
   139681 gaatatagct gcccatcgac gtatcgctgg aaaccggtgg gccgctgttc acctaaagtg
   139741 acgcaaggtc tgtcagccgc cagggtccgt ttaccaggct ttcaggtgtg gaatttagat
   139801 agagtgggtg tgtgctcttg tttaattaca ccaagatcac caccctctat ccatatccca
   139861 caattgataa acctccgcat gtccaaccac cacgttgaac aggatgtggc accctaagag
   139921 gacgcaggca tacaaggtta ttacccagtc cttgtatgcc tggtgtcccc ttagtgggac
   139981 gcaggcctag gtagcatcat ttacactaaa agcagtgacc ttgttggtac tttaaggttg
   140041 gtccaatcca taggcttttt ttgtgaaaac ccggggatcg gactagcctt agagtaactc
   140101 aaggccaagc atttcacacc tgcaaatgca ccatgtaacc acagatctaa actgaaagtt
   140161 gcagctttag atggcaagga aacttgggtt tcaggcatag aaagcctggc tcactatagc
   140221 agcccatgtt tgttccaggg tgggggaaag gcacgtgccc ttagaaaact tagctgcaaa
   140281 aattctattg tgttgggaga gcctctatat ctaaaggcct ttcctcacaa tacaaatgtt
   140341 actaacgtct gccctctgga gacctgctat gtggctagac gtatggccta cccaagacgt
   140401 tgggggtctc gggtaggcca tgattcttcc aggcataggt tacaaccagt cactgctatc
   140461 aagcctactc agttcccaac gcagcacata ccccccgcct ctcctgccat gaggacttat
   140521 ggcagtgttt actgttctgc ttttactctt ggaccaggct gtcattctat cagaataaca
   140581 ggggaagcaa ggccccctgc ttcagcggga cacgtgtttc tagaatctcg gagccaataa
   140641 ctacctgccc ctctaatctg tatgctgcat gaaaaaccac atacacgtga tgtaagttta
   140701 gccagtttat tgttacacca atgccccgaa agtctccccc tgtccctttg ggtctcagga
   140761 cccagccctg gagctcgggg gcggccgggt ggcccaccgg gtccgctggg tccgctgccc
   140821 cgctccggcg gggggtggcc ggctgcagcc gggtccgggg ttccggccct ggagctcggg
   140881 gggcggccgg gtggcccacc gggtccgctg ggtccgctgc cccgctccgg cggggggtgg
   140941 ccggctgcag ccgggtccgg ggttccggcc ctggagctcg gggggcggcc gggtggccca
   141001 ccgggtccgc tgggtccgct gccccgctcc ggcggggggt ggccggctgc agccgggtcc
   141061 ggggttccgg ccctggagct cggggggcgg ccgggtggcc caccgggtcc gctgggtccg
   141121 ctgccccgct ccggcggggg gtggccggct gcagccgggt ccggggttcc ggccctggag
   141181 ctcggggggc ggccgggtgg cccaccgggt ccgctgggtc cgctgccccg ctccggcggg
   141241 gggtggccgg ctgcagccgg gtccggggtt ccggccctgg agctcggggg gcggccgggt
   141301 ggcccaccgg gtccgctggg tccgctgccc cgctccggcg gggggtggcc ggctgcagcc
   141361 gggtccgggg ttccggccct ggagctcggg gggcggccgg gtggcccacc gggtccgctg
   141421 ggtccgctgc cccgctccgg cggggggtgg ccggctgcag ccgggtccgg ggttccggcc
   141481 ctggagctcg gggggcggcc gggtggccca ccgggtccgc tgggtccgct gccccgctcc
   141541 ggcggggggt ggccggctgc agccgggtcc ggggttccgg ccctggagct cggggggcgg
   141601 ccgggtggcc caccgggtcc gctgggtccg ctgccccgct ccggcggggg gtggccggct
   141661 gcagccgggt ccggggttcc ggccctggag ctcggggggc ggccgggtgg cccaccgggt
   141721 ccgctgggtc cgctgccccg ctccggcggg gggtggccgg ctgcagccgg gtccggggtt
   141781 ccggccctgg agctcggggg gcggccgggt ggcccaccgg gtccgctggg tccgctgccc
   141841 cgctccggcg gggggtggcc ggctgcagcc gggtccgggg ttccggccct ggagctcggg
   141901 gggcggccgg gtggcccacc gggtccgctg ggtccgctgc cccgctccgg cggggggtgg
   141961 ccggctgcag ccgggtccgg ggttccggcc ctggagctcg gggggcggcc gggtggccca
   142021 ccgggtccgc tgggtccgct gccccgctcc ggcggggggt ggccggctgc agccgggtcc
   142081 ggggttccgg ccctggagct cggggggcgg ccgggtggcc caccgggtcc gctgggtccg
   142141 ctgccccgct ccggcggggg gtggccggct gcagccgggt ccggggttcc ggccctggag
   142201 ctcggggggc ggccgggtgg cccaccgggt ccgctgggtc cgctgccccg ctccggcggg
   142261 gggtggccgg ctgcagccgg gtccggggtt ccggccctgg agctcggggg gcggccgggt
   142321 ggcccaccgg gtccgctggg tccgctgccc cgctccggcg gggggtggcc ggctgcagcc
   142381 gggtccgggg ttccggccct ggagctcggg gggcggccgg gtggcccacc gggtccgctg
   142441 ggtccgctgc cccgctccgg cggggggtgg ccggctgcag ccgggtccgg ggttccggcc
   142501 ctggagctcg gggggcggcc gggtggccca ccgggtccgc tgggtccgct gccccgctcc
   142561 ggcggggggt ggccggctgc agccgggtcc ggggttccgg ccctggagct cggggggcgg
   142621 ccgggtggcc caccgggtcc gctgggtccg ctgccccgct ccggcggggg gtggccggct
   142681 gcagccgggt ccggggttcc ggccctggag ctcggggggc ggccgggtgg cccaccgggt
   142741 ccgctgggtc cgctgccccg ctccggcggg gggtggccgg ctgcagccgg gtccggggtt
   142801 ccggccctgg agctcggggg gcggccgggt ggcccaccgg gtccgctggg tccgctgccc
   142861 cgctccggcg gggggtggcc ggctgcagcc gggtccgggg ttccggccct ggagctcggg
   142921 gggcggccgg gtggcccacc gggtccgctg ggtccgctgc cccgctccgg cggggggtgg
   142981 ccggctgcag ccgggtccgg ggttccggcc ctggagctcg gggggcggcc gggtggccca
   143041 ccgggtccgc tgggtccgct gccccgctcc ggcggggggt ggccggctgc agccgggtcc
   143101 ggggttccgg ccctggagct cggggggcgg ccgggtggcc caccgggtcc gctgggtccg
   143161 ctgccccgct ccggcggggg gtggccggct gcagccgggt ccggggttcc ggccctggag
   143221 ctcggggggc ggccgggtgg cccaccgggt ccgctgggtc cgctgccccg ctccggcggg
   143281 gatgggggtg cgctcccagg ccggaccctg gtgccaggca gggaccccgc gccacccgct
   143341 tcatgggggg ggaggccgcc gcaaggacgc cgggccggct gggaggtgtg caccccccga
   143401 gcgtctggac gacgctggcg agccgggcca gctcgccttc ttttatcctc tttttggggt
   143461 ctctgtgcaa taccttaagg tttgctcagg agtggggggc ttctcattgg ttaattcagg
   143521 tgtgtgattt tagcccgttg ggttacatta aggtgtgtaa ccaggtgggt ggtacctgga
   143581 ggtcattcta ttgggataac gagaggagga ggggctagag gcccgcgaga tttggggtag
   143641 gcggagcctc aggagggtcc cctccatagg gttgaaccag gagggggagg atcgggctcc
   143701 gccccgatat acctagtggg tggagcctag aggtaggtat ccatagggtt ccattatcct
   143761 ggaggtatcc taagctccgc ccctatatac caggtgggtg gagctaggta ggattcagct
   143821 aggttcctac tggggtaccc ccctacccta ccttaaggtg cgccaccctt cctccttccg
   143881 ttttaatggt agaataacct ataggttatt aacctagtgg tggaataggg tattgcagct
   143941 gggtatatac ctataggtat atagaaccta gaggaaggga accctatagt gtaatccctc
   144001 ccccccctac ccccccctcc cttacggttg cctgagccca tcccccaccc cagcaccccg
   144061 gggtgacgtg gcaccccgcg tgccttactg acttgtcacc tttgcacatt tggtcagctg
   144121 accgatgctc gccacttcct gggtcatgac ctggcctgtg ccttgtccca tggacaatgt
   144181 ccctccagcg tggtggctgc ctttgggatg catcactttg agccactaag cccccgttgc
   144241 tcgccttgcc tgcctcacca tgacacacta agcccctgct aatccatgag ccccgccttt
   144301 aggaagcacc acgtcccggg gacggaagct ggattttggc cagtcttcaa ttttggggag
   144361 tggttttgtg tgagccggaa gttggcaatg gggtgagggt ggcgctggtt aagctgacga
   144421 cctcccaagg tctctcaccc tgggtacaca ggtggggcgg cagcctctaa ctttggctgt
   144481 ggcctctatt tcctcccttt cctagccagg gccatgtgtt cctgcatgtc tacttgcctc
   144541 ctgtggtggc agagcttggc cctgggccca acccccgcct tgggagcctg taggggccaa
   144601 cacccttggt ttgtttgtgt tcctgtttgc tggcaactta ctggcagccg agcagattct
   144661 aatgggcgcc cgccttcttt ctctcttgtt ttattaatag aatctcagcc aggacctata
   144721 cctgagactt caaagtctgg tcctgggttc tgagaccccc aagatttgtc atgcacacct
   144781 gcacacctgt tggtattggg tttctattct tgagtgtgaa agtttgtaaa aaaattcata
   144841 aaatgtcact aattcctctt acctgtttag ggtattgtgc aattcttcag cctgcctatt
   144901 ttcaatttgc ctaaggtggc aatttaagat gtggttaatt aaccattttc ctgtctgaca
   144961 ccactgcatg ggcaaccggg ttccatggca catttagaga taaacataga tgtcttgtct
   145021 tgctcatgtg cagaggaggg ggtgttggtg tgcaatatag tttctggatt ccaaattgag
   145081 ttgggggtgc tattttcact atggaattaa attactgaca ttagacagtg gacaccgggc
   145141 tatatgtggg gatgtctgtg gcttgtcatt tcctcttaga aggtaatccc ccatcttaac
   145201 ttccctttaa attgtgatgc aagccctggg ttatttatag aatgattatc taggtttgat
   145261 agtctgaagg ctgggcagag aatgtttgta atttttattc accttcttta ccccccacga
   145321 gtatccagtt ctagaagatc tcctgatatc ccgggctgcc attattccct tgagtgttat
   145381 agcttcctct taacttaagc aagagctcca ggatgttagc ttttttggtg gggctggttg
   145441 tcaggaagag gttccagtgt tgtcctttat ttttagatgt tagctttgtg ttaggttagt
   145501 atgggctggg tattcactag tgaaggcaac taacacagtt agacgtgcta gttgtgccca
   145561 ctggtgttta tccggtccca aatgtcacca cagaacacag ggggctggat ttggcagcag
   145621 cacttgtgct tttgttgatt tttacccgtg tatcagagtg ggggatgcta gccaatttag
   145681 cttcccctcc ccttaacagg gggtctcgcg gggtgccaat tgtcgcctgc cttcccccgc
   145741 ttccccttgt taacttatag catgataggt aggtcaccta acgtggaagc ctggtgggtg
   145801 atccttcctc ggtagggagc gcttagggct gttgagctca acagccccac ctgggtaaaa
   145861 tgtatgttct aaagagttac ccaattataa caaaactgtt gtagggtaac gaagacctga
   145921 tggaagtggt attgttgccg ttgaaagacg ggtgtcctgg ctcaagttcg cacttcctat
   145981 acagtgttaa agccttgtat cggaagtttg ggcttcgtcc cagtgtactc gataatgtcg
   146041 actgctgcga aaggtttgga ccgtcttcca gtaggtgttg ggggtcccaa atcacgaggt
   146101 taggcaggtg cacttggctc tttaggaggg acccttaagc cagacaatgt agtgcccctt
   146161 ttttttgcaa attggcctta ttattaattt cttgttaaca ctaattctgt tctatgaccc
   146221 tgtgtttttc agatgccgtt gaacgtgtca ctgagctgaa tttggacgca gctacttgac
   146281 ctttgccccc gtgcctccag cgctgataag tgctgcgtcc actttgtgtt acaggtgggc
   146341 caaacctcca gaatatcaat tggtggggcc ttggtgggct gcataaggca gtaggtttga
   146401 ggtgacctac ttggaccatg tggatccagt gtcctgatcc tggaccttga ctatgaaaca
   146461 attctaaaaa aatgcatcat agtccagtgt ccagggacag tgcactcgga agtctcatca
   146521 tctccgtttg tgtgtttagt gtggccagta cggccacccc tgtgccacgc cctggcatgc
   146581 tgctgacatc tggccgccaa tttcagcggg cccttttccc ccttgttcac cccatagcaa
   146641 gaagggtagg ttacatgggt attttcccat cagcacctga ctggccggtg caattagagg
   146701 agagggcaac aacgcaaggc tgttgtttta tttgggttac aagagctgcg gcggtcgatg
   146761 ggttcactga ttacggtttc ctagattgta cagatgaact agaactgtca caatctatgg
   146821 ggtcgtagac agtgtgctta ccagacttcc atggaagatg tgaatttgct gctagctata
   146881 tgggtggtgc tatgggctcc ctagggactc atgtagtggg gctttgtgat agctaatgaa
   146941 tgtggcagct gttgtttgta ctggaccctg aattggaaac agtaacttgg attctgtaac
   147001 acttcatggg tcccgtagtg acaactatgc tgaatatctt gaatatggga ggaggggggc
   147061 tttgggttcc attgtgtgcc ctttcctggc caacgtgagg gtcctagtgt tatagggcgt
   147121 ggcagttttc ttgagggcta ataacccggg tgaggcggtt gtcacaggtg ctagaccctg
   147181 gagttgaacc agtaccactc ggttacaaag tcatggtcta gtagttgtga ccctgcaaag
   147241 ctacgtgggg atgagcagcc agggactttg gttggcaagc agacaggcgg cgcattggaa
   147301 ccccagagga gtgtcccggg gccacctctt tggttctgta catattttgt tattgtacat
   147361 aaccatggag ttggctgtgg tgcactccat ctggtaaggg ggctggtgcg gacgcctgtg
   147421 tttagtctat gccaatgttt acctgccttg ggttactatt ccaaacgacc acacctttga
   147481 ggacacctgg agccctgatc attctcggct tttactgcca cctggcttct gttgggtcag
   147541 acagtttggt gcgctagttg tgtgcttagc agcaacgcac accaggctga ctgccttagc
   147601 agtgtggccc tttattgtgg catcctaagg agggattctg gagtgccttt cgcgtgaagc
   147661 atgccctgag acgtactcga gttaggactt aatcgctcct gtgccgctgg atgagggagc
   147721 gccaatttgt acatcctagc tctggccata gagttagccc acccttgtgt ctccctttgg
   147781 cctttgcggt gccaatttcc ggtggtttcc cttttccgcc cgtttatcca atagcatgta
   147841 agagaggttg cctagatttg gcaactttga gggaacgttc cgtgtagctg gtgacctaac
   147901 acccgcccat caccaccgga cagattctga acttgtcctg tggtgtttgg tgtggttttg
   147961 gggtacgcag gagtacgttg gaatgctttg gagccgagag ggatgggccc gcttgtgcgc
   148021 ttatgtgtta cacggtgcca ataaccggcc cggtgcggct gccccgtgac ccgtgggcct
   148081 taccttcctg gccatcgggg gaccctggtg ctagggtccc ttgtgttgct ttctgccata
   148141 ggggggaaag catcgccttc agaattggct gctccgttgg aacatttgag gcctactgta
   148201 tccgtgtcct gacaacattc cccgcaaaca tgacatgggt taatttaaac atgttttgtt
   148261 tgcttgggaa tgctcttagg gcctggaagc ttgtcattgg attcatcgtt tcctgaacta
   148321 caggcgtagg gcctattgta gcaggcatgt cttcattcct gcgtaccgaa tggcatgaag
   148381 gcacagcctg ttaccattgg cacctttttt ccatgtaaac ctccgtgatc ctgggtcctt
   148441 tggagactca agtgtgaatt tgttttggtg ttcggcgcca gggtatctcg acgttggaat
   148501 gtcaactcaa cttgggcacc tcgataaccg gctcgtggct cgtacagacg attgtttggc
   148561 tctgtaactt gccagggacg gctgacgatg tgtttagtct gccacttgca tccggcgctt
   148621 tggttactcg ggagactaat ggggggtgtg gtatggcaca ggctgggggt gagtctgggg
   148681 atgtccctgg gcgttgctgc agcccattcg ccctctgggg atgagatgtt caggggtggc
   148741 cggtacccta cgctgccgat ttacataata taaattgtaa atgctgcagt agtagggatc
   148801 tggacgcgcg acctgctact cttcggaaac gccaacccag gagcgtcgcc tctggcccca
   148861 tactcccgcc atgcgactgc tcgccccctc ccaggcctcc ctggtgagcc cttgccgctc
   148921 cccgcattcc tgctttcggc gcccctgcgg atcccgatga cagcaggcct ttccttcccc
   148981 cgttaatgaa aagaatgaca gtgaggttgt gacagaagga cagctttatt cagtttacag
   149041 agtgccctcg gaggctacga tattcccgtt aaatgtcttg ttgattctct caaaggtggg
   149101 gagggaggag ctctccacaa caatgttccc tggcagcgtg agcgcgcagc cctgccgttg
   149161 gatgtatctt ctcatgatgg tgctgataga ggggtctccg gcgtagatga aaaaggcctg
   149221 ggccatgctc tggccggtca cgatcgttat ggggttgttg gaaatgttcc ggaccgtcag
   149281 cttgagggtc tggcccggct tccactcctg tgggtagacg tagaagaccg ggttggagga
   149341 gtgggacacg acaacggccg taatcttgga gctcaggggg gcctcgtagg tgttgttgta
   149401 ttccagctcc gtgatgaaat taggaggaat aatcacaggg gagccaaagt agcggatgtc
   149461 tgtggattcc ccgtcccagc gccagtggct cttagggtag gggttgtaac ggaaggcaat
   149521 aatcacatca tccaataggg tcatgcccac cttgacgttc agcgggccct ctcgtttcag
   149581 gtccggcgtg tccacggaga ctcggacgta gcccttaccg cggcgtatgg cgtttaccgg
   149641 acacaccttc cccgggaatg tgtgaatacg ggcgtatgac tttagaaatg ggggcgtgtg
   149701 ctgcgccagc aggtaaggca ggcactcgtc ctggctggtg acgggagagc cactgaggaa
   149761 gatctggggc tcgctggtgt ttagcttgtc cccgctctgg gtgcaggagc gtgtcagctg
   149821 aatgtcgctc tgcccgggca gaatctgcag gtagaggtag gggttcttga ccaatctgat
   149881 gggcacaatg taccaggtaa acttcccttt ctctatgaac aggctgcgcg gattcaggac
   149941 gcttagcacg atgtcctggt cagagtgcat aacgaagaag ggcttgagga atacctcgtt
   150001 gtcttccgct ccaaagaaca aaaacgcgac cgtaaagtag cggctgccgt aggtggtcgt
   150061 gttgaaggag aaagaaggta acttgaagct gagtatctgg cccaccgagg ggcagggagg
   150121 cagctcttgg cactgcgcgt ccagctgcaa tacctgcttg ttggtgacgc ggacgtatga
   150181 ggggaagatc tcgtacttcc acacgcctct catgaacgac gtgtctggtt tttcagtggg
   150241 ccgcaggcgg cggaggctgt tcctgaacga cgagcgccgg gacgctagtg ctgcatgggc
   150301 tcctccgggg taagcttcgg ccatggccgg agctcgtcga cgggcaaggt gagagtcggg
   150361 gggcgggcga cggtgcggcc ccaatacaac tctccgctcg ttagctggta gaatatccgc
   150421 ccggcgtcta ggttgtcact tcgctcggcc ggccagaaga gcgcaagtcc aagtctggtg
   150481 ctggggccga tgtgcagcgg tttgtgcccg cagttgtaga ctgtcatttt tatgggcgag
   150541 tgggcggtcc acacgcgcgg gcgcagcacc cattggtcgc acgccgcctc ctggaatgta
   150601 aacccccaga gagagggcgt gccgccctgg agatggccct gtgccatcac atgtatttcc
   150661 tccttgggtg gaacaacggc gtcgtgctcc gggtggaggg ggaatagcgt ccaggcatct
   150721 ttcagggtca cgagaccggg gtccatgctc agagaacagc cctcccgggc ggtgggcggc
   150781 ccgggctcca gcagaacgtc gcagacccag ccctcctcgg ccctgtccac ctgtatgtcc
   150841 aggtgcacgg acccggaggc tgcgtctcgt gacatggcca ggcctggtgc cagccgacca
   150901 cgtcccgtgt cccagccgag gccgcgccag agcagagccc gggactgact cagggccaca
   150961 tcccctcggc ccgcggacgc cgcctcgcca gcccccgggc cttcatgggc ccgctttcta
   151021 cctctctccg gcaccccagc ctggtcagcc gcagaggaag catgaccttg gggtgggacg
   151081 gggcaggcgt gatcctgggc gcaatctttg ccgatcccca caccttcact ccttgttagg
   151141 ttgatagaat gtcggtacca cgccacgggg ggcgggcccg catagggaaa agccagggag
   151201 agcgatgtgg gcgaggatgg gctcaggcgg ccccagacac gcaatttgcc cccctgggcg
   151261 gccgcagcct gcccctcggc ggcccgtgcc ccagctccgt cacggggggc gcataggagg
   151321 ggtatatcta ggatagccgc acctacacaa atgagacaca gacacaggtc gtgaggattt
   151381 aggcaacgca ggcttgtctt tatagttaca aacatgggag cgtgcacctg gaagatgcag
   151441 ctggggtaga tctttacatc tttacagggc gcagcggccg ccagacactg aagggcagag
   151501 ttcacggcgg gcacctccca gagggagccc accagcccgt acctggccac ggccagggcc
   151561 tcgtaggccg agacgggcag ccggagcttg tggtactgtc cctccggcag gtggagtggg
   151621 acacagttag agaacattag tcctctggtc cctatctcca cccgccaggc ctgtgtgtca
   151681 gtttgcaggg ccatcctcgc actcaggtgg actggctagg cacccttctg aagtatctgg
   151741 cggtgactgt cacctggttc ttgagagagt ccataaaatg gctgaagctc caggcgtata
   151801 gtataatgag caacagggcc aaacaggcgg cggggcctgg gtagtagcgg gcaacgagag
   151861 actctgtgca atcaaacccc aggctcccgg cctcacccag gaagagcagc ggcagggaca
   151921 gcataaacca ggagaaggcg caaatgagtc cggtgaaggt gacgttgcat atcaggcgcg
   151981 gcttccttcc gaattttgtg cgcaaaagtt tccagatgat gataactgtg aggaggacga
   152041 tcaggactgc cgccagtagg tagcagccgg ctttcagtcc ttggacggcc gtgtgcatgc
   152101 ctttggtggg gccttccctg cacatgttgg ggcctctgtt gagattggcg tcggggccca
   152161 tggtaatgag gaggatgata atcagcagga gtaccagaca aaacacgccc atcaggtaca
   152221 ggcacacatt tctgtgggag gttctcttgg gcgttcggct gaacaatgct agggtcttct
   152281 ccaacgccat acccaagtga gtccatacgg agcacatcag gcccaagaac atcatgttct
   152341 gggtcaaaag gcagagaccg gtagacgaga actcctgaat catttttccc agcacccaga
   152401 gcagcagttc tatgagaaga gctatcagcc agacatccat tcggtgaacc aattttctta
   152461 caaagatgat aaacaagatg ccagccagtg ttagcagaat cagcaggacg agcagcaggc
   152521 ttgtcatgcc gctgaggaag gcgctgtagg atttagtgca cgcatcttcc gttgcattga
   152581 cggaagtcat gttggccacc agggtcccca cggtggaccc gggggccatg gtggagagca
   152641 tcttgctggt cagagccaga ctgggtggtg tctgcagcaa aagaggaact tgcccaggca
   152701 gtcagttatt ttgcatgcca cctccctgcc tggtggactt ccagactatt ttctgcattc
   152761 gcccttgcgt gtccattgtt gcaaggagcg atttggagaa aataaactgt gagtttcaca
   152821 gatccacggg ccacgctccc ctgggggctt catgatccca ccgcctttcc cgatgatgat
   152881 gacaaccgcg gctgtctgaa gcggctgacg aaatcggttg agattctgat gagaggcttg
   152941 ggggggtctt tgccctcaag gcgaggctcc ttctcctagg aatgccgagc cccctgcact
   153001 agcttcgctc cactggggat ctttgccagc cttcatacta gattcagcga tcccccggtt
   153061 gggaatcttc gccagccccc cgtcctgcta tcccgctcgt cgccgcgcct cccatgctaa
   153121 gggccccctt cctttccctt gactttgggg atattcggag tctgctctcg ccgctctctt
   153181 ctctcgttta aacgagagaa tagtagtagg gtccagtctc aggccccctc actttgggtc
   153241 ttagaatggt ggccgggctg taaaattctg gaggacggag agggcggccc cggagttgtt
   153301 atcaaagagg cactggagga tgttggccgc tccttggagc agcttgtcga aataatgatc
   153361 cacggccacg ggaacgccgt gccgctcggc gtaggccggg tcctcggcca tctccgtctt
   153421 tctcgccccc ttcactcccc ccttgggctc cacaaagacg tactggatgc ggtcgtggat
   153481 ctggggcagt tcctcgttgc gctcgacgaa cttctggtag acggccaggt gaggcatctg
   153541 ggtgctcttg taggctgaga gcttgcggct gagctccgtt gaaaagcaga gctcccccat
   153601 ggggaccctg ccttcacgga ggtctgtgta ggcctggttt aggatgtcaa tgacgggcaa
   153661 aaagcccaca ggtagccctt gtgtaaatga ctcttggaag ggccggtggg agaggaggct
   153721 ggccgcctcc tttacccggg catccgccag caccaggtcg agcacgcgcc ggcagcgtgt
   153781 ctgcacaaac ttgcaggccg tcttccggac gagctccacc cccttcatca gggtcttgcc
   153841 gtccgtcagc acccccacat atctcttctt tgtaatcagc atcaggcagg agaaggtctt
   153901 ctcggcctcc agggagatgg gggccacaaa caggctccgg gtggtgtggg cggccagggc
   153961 atcggcaaag cgcagggtct cgctctctga aaacccccgg cactcgataa acagcgagtc
   154021 cgtgtccccg tagatgactc gaagctggcc ctcggggttg aggggcgccc aggcgtccgg
   154081 ggagggggcc agggcctgca ggttggcggg gctcagggcc tccacgaagg ccttggcccg
   154141 ctccaacatc gtgcggccct gcagcgtcac cgtctcggcg atggagaggc agggaaagag
   154201 gccgttggcc accccggtga agccgtagac ggcgttgcac gtgcacttga tggccagctg
   154261 ctgcttgtcg aggatggtcc tttggcgcgg atcctcgcag gccgccagca gcttcttgat
   154321 ggccttgcgc ttggccagcc aggaggtcaa cagactagcc aagaaggact cgtgcacgtg
   154381 cttctttaca aagtggtaga cgccccccgt gagcctgaag gactcatagt cttctcccgg
   154441 gcgcaggccg gctagcctgt gctcttctcc cggcgttatc atggtagaat aacagagatt
   154501 atgagcctga atgatgctcg ggtagaggct ggcaaagtcc accaccagaa ccggggagtt
   154561 gtagaatccg gacaggggct ggatgacggt ggccccctgg tagccgtccc ggtcagaggc
   154621 cgagggcatg ggcaggataa agttttcctt ttgggcggcc gccaggaggc aggagaacac
   154681 gcggatctgc tgcccatcgt ccagcacccg cctgcagggg atgtgagcga tcttggcaat
   154741 ctctgccacc tccacgtgga tcacgaaatg gtttagcaga tccatgacca gggccgagtc
   154801 ctgcacgcag tacatgccga gccgcctgcg cccctcgggg cccgctgcaa agaggcgagg
   154861 aatctccttg taatgcacat cctccttctt ggcccccagt aggtgcctgg ctactgtgtc
   154921 cagcttgtag tctgagaggc tgagcttgtc ccggcacacg gcgtacatgt cgatggggat
   154981 gaggccggtg atgcggacct tggtgttggc ccgcaagaag cccttgcccg catcatgggg
   155041 tcgcctgacc tcgcagacgc ccccagccct aattttgccc agagaggctg ggttgatgct
   155101 gtagatgtgc ctggctctgt ccagaatgta gggccagtca aagttggcca cgttgtagcc
   155161 ggtcacaatc tccacgctga ggtctctgat gagctggaag aaggcgtaga gcatgtccag
   155221 ctccgatggg aactcgtaga cctcaacccc ctctatgtct tcgcaggtgc ccagcgtcag
   155281 caggatgcgc ctatagcgcc cggcctcctc ccctgtcgac cagaggacgc aggatatctg
   155341 caggatcagg tcagcctcgt tggtggccgt ggggaagccc tcctccccca gacactcgat
   155401 atcgaaggcc agggcctggt aggagggcca ggagctgtct tcacgccgga ccgagaggtc
   155461 gcccacctca cagtcgtact cgagctcggc gtacgagtcc cggtgctgga ggcgggggat
   155521 ggcgcggcgg cagctgtacc agccaaaggt gacaaagtca ttgtccagga caaagcggcg
   155581 cgtggcatcc acgttggcct caaagatccg acacccgtgc ttgtcttgca gccacgtggc
   155641 cacgtgacac acactgttgg gatgggagag ggtgatcttg tggtagtcgc cggcatggtt
   155701 gccgtagccc ataatggaac ggcgcgtgac cttctccacc gagacccggc agggggtcct
   155761 gcggtcgaag gtgctggcct tgagggcgct gaggactgca aactccacgt ccagaccctg
   155821 aggcgcgctg gcgtagaagt aggcctgctg cccaaacacg ttcacacaca cgctggcccc
   155881 atcggccttg cgccggccca gtagcttgat gacgatgcca catggcacca catacccctg
   155941 tttatccgat ggaatgacgg cgcatttctc gtgcgtgtac accgtctcga gtatgtcgta
   156001 gacatggaag tccagagggc ttccgtgggt gtctgcctcc ggccttgccg tgccctcttg
   156061 ggcacgctgg cgccaccaca tgccctttcc atcctcgtca ccccccacca ccgtcaggga
   156121 gtcttggtag aagcacaggg ggggctgagg cccccgcaca tccaccaccc ctgcggcgcc
   156181 tggtgtctgg aaacacttgg gaatgagacg caggtactcc ttgtcaggct ttttcagaag
   156241 gcctttatta ggtcttagga aagggttata gaagagtccc ccagacatgg ttaaaactca
   156301 gtctctgcct ccccaagcag tgcggcggcg gtctctggat cgtgatagcg tcttctgcgt
   156361 aggcctggaa aacggtccct ggctgcctgc aatgctctgc tggccactga gggtccggcc
   156421 gccctctgag ctgctctctt ttgctcctgg ttttgctcat gcagcgctaa catgatggct
   156481 tgtaattctg tcttactaat gggattaatg cctggaccct caccagaggc atgttgctga
   156541 gcgagctcgt cgatcccggg gtagagcatc tgcaccggct gctgcgacat ctggcgcgtg
   156601 cgcctcgtga gggaaataac caggatcacc acccccgcca ccaggaccag aatgagcatg
   156661 ccgccgaagg ggtttttgaa gaaggagatg aaaccagaga ccaggctgct aaacaaaccc
   156721 cccaccgtgc tgactaggtt ggtgatggac tgacccacgc tacccagact gtccataagt
   156781 tcccccaggc cgtccacgaa ttgatttctt ccgtttgaca ctgcattgtc caaatccttc
   156841 cgcaggccgg cgatgttttg cgcctggaag ttgtactccc ggaagatgcc ctccaggtca
   156901 aagacgttgg aggcacgctg ttcgtcccgt gagtacagct ccagggaggc aaagtcaatg
   156961 ttctcgatga gggaggtgtt tagtgagatg aaggtctgca gggtggcaat gccgtccagc
   157021 tcgatggttt taaagtggtg gtagtcgttg tagacgtgga tctcgttgcc ggactggaag
   157081 tagtactggc tggtcgcctg gcacacctcc gtcatctttt ttgtgaggaa gatctcgttg
   157141 tcggtgccca gctgtccctc gtaggtcttg gtgtcgttga taaagctgaa ggacaccagg
   157201 gggcgcgagt agcacatggt ctcggagcca gggaccctca tgctcttgcg cagggtgacg
   157261 gtggcctggt taacgggcac gcactgggag actgagatga catcccccag gcgcttggcc
   157321 gccaccgcct taccgtagat gctggacatg acggtggttg gattaatctt ggttagttct
   157381 ctcagcacca tgttctgcct cttctgctcc aggcaccagg cccgcgcaag gtctcccagc
   157441 atgcggttga tctggcggcg cagggagtcg taggcaaatt ggatctggac ggtggcggga
   157501 ttgttgaggg tgcccaggga cttcccgggg gccgtggggg gcaccggtgt ggtggcgttc
   157561 cccgcatccc gcctccgacg cctcagaacg gcggcggggg tgctcccgcg ggccgcggat
   157621 ggggctgggg gcgatggact gctggggggt gaggaagtcg gagtggtaag ctccgtcagg
   157681 ttcttgacgg tggccaacga gcgcggggtc agaggtagcc aagctaataa caatcctccg
   157741 ctcgttataa aatatgtaat ggcttcctgg cccttcgtgt aacgatcctg gacggcctcg
   157801 tacttctcat gcatggtctt gttcacctgc tcttcgatgc acttgaaggc gtccgggagc
   157861 tctatgccca cggttgtgtt ggtcacgaag ctagaggtgc cctcgtcagt cacaaaatgt
   157921 attgacttcc ctgtttctgt ggcgatggtc gagtcaaagg tttgccagtg ttgaagcggg
   157981 cagtaggctg tcctgttctc gagcttccaa gatagcgtgt aagtgccctt gtccaggaag
   158041 gctcggcgtt cgccttgcgg gttcgtccct cggttgtcgt agtccactat cttgtagtta
   158101 gttctcacgt ggaaggagtc tgcccgctca tggaaggttt ccttattttt cccgtcatag
   158161 aaaggggaca tttccacagt ctgcccggtg gtggtcacaa agaagtcgaa ggggctgttg
   158221 gacttggcca tcatgtcagt tatcaggcag ttgacggtag ttcttgttct gtaagtccat
   158281 atcaaccacc cgggggcgtc atagagctcc gtctggctgg cgtagcggcg caccccgttg
   158341 gccaggcccc cggtgggctt taggttgacg gtgatgttaa ctccgtcgcg gtctacatac
   158401 acgcgcgtca gcccatcttt tgtcatcttg accgcgttgt agcactggta gatggtatcc
   158461 atctggtcag tttcgtagct gtcaacggag aacttctcct cgtgccggtt ggtcacggag
   158521 tccgcgtacc agccattgta gatgagaatg ttggtcacta tcttggtgta ggagcggacc
   158581 ttaaacgagt agggaataat gttgtcttta aacaccatca acaggccctc cgtgtgattc
   158641 tcccgcgtgc caaacgaggg acactggatg tccgaggaga agcggaacag gtcgccgtgg
   158701 ctggagagct cgcagactcg gaaaggaaag ctggtttgct gacgcgtggc ggtaggctgc
   158761 accgtggtgg cggggggtgc gggctgctct ggggtctgcg caccgagacg gcacgccagg
   158821 gcggctagca gcacgaccac gcttagcacc ctacgccgag tcatctctca tttggaggtg
   158881 caggtagaga agggcatata gatccttaaa tacccacccc ctgcccttat acagaagaat
   158941 tagggggcgg tcagagtcgt acgtgaggta aagcccatcc gggggcaggg cctggccggg
   159001 gctgaccgcg tccgcccggc gcaggatcaa ggaccgcccc caggtcttgt tgtagaggga
   159061 cacggttagg acggcctcgc gcagcgcccg gcacagaatt tgctggctag atgccagtga
   159121 gcccccgggt acgctgtaga agctgttgaa ggaggtctct atccagtcgc tcggctcgat
   159181 gcctggccat atcagggaag tcaggaatgc cttctggtgg ggcagcgtac ctgcggcgtc
   159241 acagcagcga gccagggcca cgttgctggg tgggggaaag agcccgctct cctccgccag
   159301 gggccccgtg atgaaggtgt acaggctgtg cgtcagcgcg tgcaggtgct ccgagctcag
   159361 ggtctgggta aacaggtgtg ttttgatgta cttggaattc tcaaaggcgg caccctcgcc
   159421 ggcgcgcctg tcctcccagg gacccgagac gaaggcccgt ctgtagagga agtggttgcg
   159481 catgcgggcc agctcccagt agaccacgtc cccccagacg cgcaggcaca gggtctcggt
   159541 cagggtctcg ctctgttgcg ccaggcagga ctgcagcttg gccagaccct cggtggccac
   159601 ctggcgcagg tactgctcct tgcgcttgag cgcgtccgag agggcgccgg acgggccggg
   159661 ctctcgtgcc ccagccggcc ggggcacctc cgggctctcc cgggacgcct cctcctcgcc
   159721 tcggcccaac cgctgcatgg ctcggttgag ccgcgtgtac agctcgttcc tcttttgcag
   159781 gatggcccgg tactgggggt gcgccgtgaa ggcggcggcg cagtccgcct tcagcgcctc
   159841 caccgcgtcg cccgaggagc tgtagacccc gccgcagaag agccgctccg tggccccggg
   159901 agccacggcg tcaaacaggt gagtcagcct tgcccccgcc agcgcctcct cgcaggcccc
   159961 ccgcaccagg gccaggcgac gctcccgggc aaacagggca gagaggcggg aatggccgcc
   160021 accctccccc tgccccgttg caccgatagc atggccgcca gagttccaat agaggagctc
   160081 cgagagctcc gccacctccg ggggcactgt cgagaagacg ttgtaggtgt ccagcgctct
   160141 ggtcgccccc tctgcctccg gccgccccgg gcccgggacc gcgccctcct ctgggccgcc
   160201 cggcctcgcc ttctcctcag cctccaacag gtgcccgagc cccgcctggc ggacttcatt
   160261 ctcaaacagt cccgagaccg gctccggatt caccggcacc gccaggtggt tacaggagac
   160321 gtgggtcccc tctgccgtgg aagggttgcc gtggttgggc agaaccatca gctcgcccac
   160381 acagcgccag cagggcacag aggtgatgta gaggcgcggg tctgggatgg gacttacgcc
   160441 ccgaaagcgg cccagcagat ccagggcccg ttccaggctc tccagcccca tggtgtgaga
   160501 catgcaataa aacacgctat tgattctctt cattaaaatc tctatgtcat ttattaggca
   160561 caaacttaca tcgactttat gccccccgta aaactccaca gagtacgcga ctgagggggt
   160621 acggagaggc gggacccggg taccctttct accaggggcg agcagcgcgg cagaggcctc
   160681 tctcgagttc tctagcaggt gcaccagctc cagggacagg gcgctgcatg cacggtcatt
   160741 ctgccgtctc aaacggggaa ggaggatggc ctccagctcg gccagcaggc cggcgttgcg
   160801 caccaccgca gccacgtcca gactccgggg gtccagccgg gtgcacacgc tcagctcaac
   160861 cgccagggcg tacacctggc tgtacgccgc cgccagcagc cccgacatcg ccgccccagg
   160921 ggtctctaga cctcgagtcc ggggagaacg gtggccagac ggcgcttgcg tctgcccccg
   160981 gagccctgcc ctcctccacc cagcagcagc ccggccgagg cctgcgacgc ggtgctgacc
   161041 ggctcggcca cgctgataaa gttgtcctgg gctgccccgg gcccacccca cactccctcc
   161101 agaaagtccc gagcggcctc cgccgtccac tctatcccgc tggaggcaat ggtcgccagg
   161161 gtttctagga cgctgtccgc caggacggag aagcggccca ataagtactc cgcgtcgtcc
   161221 ctagtcagcg aggcgcatgc ctcgcccatg gcatccacaa ggttgcacac cacatcaaac
   161281 acacagtctt cctcctgttt ttgtgatata atggcctcca ggccagccct gatgttctca
   161341 atctcatatg tggtcgcggc ttgggtccgg cgcttcacgg tcaaccctag ggtgggggtg
   161401 gcaaagacaa acttcttccg catggaagag cccccggcct gcttgcgcag cccagccccg
   161461 ggggcctgca gcaggttcct gtccacgccc cggcccataa agtatcccag gttcccggcc
   161521 tggaatatct ggttgttgcc gttgaccccc gtgtacttgt tgatggtcac tggcagcgtg
   161581 acaaccggac gggccttgca gacctggcta agacagtctg tggccgcgca gaccaccgtg
   161641 gtcgcagtaa gggaggaggt ggcctccgcg taggccgctg ccgactccac cgcccgcgtg
   161701 cccagtacgt gggggtagtc acgggcgggc accgactgcg tcctcggcac cagtccctga
   161761 atcaggctga tgtagaactg ggtctggccg cacgccttca ggatggcgtt gttgagcctc
   161821 tgcttggcgt aagtgaccag gttgccaggc accacatcta tgacgttgct ctcttcgtgg
   161881 gcccgggagc ccccgtccac aaagagggcc aggtcagagt actcctccgc gctggccccg
   161941 ctggggacag ggaccgagcg ccgcctggaa aagttgtgcc acaggtacag gcttgagagc
   162001 ttagtgtccg ggaatagggt cttgtggtag gtgttgagga atttcatgta gggcccgttg
   162061 atgatgtagt tctccctcct ggtagtggac ttgatgaagc tgttctggag ggcggcattc
   162121 tcccccgtga agaccaccct gttcttgatc ttgatgttcc tggggcacag catcagcacc
   162181 ttggacatgc gcacaggcag ccgccggccg tacacccggc cctgcagggc cgcgtccagg
   162241 tctggcaggt cgcaggtggg ctccccatgc accaccttgg cctccttggc cgtgaggacc
   162301 cccttgtcga tggccaggct cctaaagttg gtgcacagcg tctggtagtg accctttagc
   162361 cactctgggg ggctctggcc aagcccgggg ttgtcattct catagcacat acagatgggc
   162421 agggagatgt cctgcaggat ggtcagcagt gagcggtaaa acagctgggt gaagatgggg
   162481 caggcgggct gcgcaaaggg gttgcacgag tactgcatca cgtggtagca gctcttgacc
   162541 aggtccttgt aggtgatgtt gttcttggcc atgctgttca taaactggac cacttcggcg
   162601 tccaccgccg catccacgtc cttgaacatc ttgacaaagt cacgcgggcc atggggctcc
   162661 ttctctagct ttccttcagc gtctatgccc agccgagaca gccgctccag caggttctgg
   162721 ttcagctgcc agtaggtgta gcggggctcg tcgtccggcc gctgcccgtc gtcctcctta
   162781 tcgatgaagt tgagaaagtt gcccaaaaag tccgtctcgt tgtaggagcc cgaggccccc
   162841 gagatcacat aggggtccct ccgctgcgtg gacatgacgg gggggaagcg gtccctcagc
   162901 ctaaagaaga gcgtgttcag gcacacggcc ggggcccggc cctcgcagag cgagcacatg
   162961 ggactggcgg ccgcccccgc cacgtagctg cccgtctccg gcaccggggt cagagagctc
   163021 ttctgtccct ggcaaaactg caggtagtag gcatagcggg caagaaggtt gggcgagaag
   163081 gaggccgcat agaccaggtg ctccacagcg tagtttcccg gaccgttggt tccggtcacg
   163141 tctggcccac cccagcccga gaagcagggt cggcggcagg ggtcccaggt cccctcctgc
   163201 agggtcccca ggccgtgggt catgtagaaa ctgttaaaga gactctcctt gccctgaccg
   163261 gttgacttcg agacccccga gacgtagagg acggaattgg tggcaaagat ctgcgtggac
   163321 acgtgggggg ccaggctggc attatatcgg tgtaacgcag ccacacgggc ctctggaccc
   163381 tcacagtcgg caaacagggg ccacgagtcg tagttgaggc tggccggggt ctcgtgcgag
   163441 gcctccagca tggcgggtgc gtagctcacc gccagctcgc atgccgcgct gtccacaatc
   163501 attaaggctc ccgagtccgg gtgactgatg gttgaggctg ggaactcctt gaggggggcc
   163561 accttggcca ccttggcctg gtcctgcagg ctctgcttct ccagcagctc caccagcttg
   163621 cccacccgtc ggacgcgcag cgcctgcgcc agcccggtgt acagcgcctc gtgcatgcag
   163681 cggctgaggt ccgagttgta aaactggcgg agctggggca cgccctctgg gaacacctcc
   163741 ttgtcgtaga gcgggaccct aacgctcgca gactgcccca ccgctacctc ctgttttaac
   163801 gatggaatgg ccaccaggtt tccgctgtag agtcgctcct tgaaggcctc ggttattgcc
   163861 accgccccca ggtaggcaga gggatctagc ccttcgggga agaagtcccc cggcttggag
   163921 ctttccctcg gtagggcgct gtaggcgtcg tacccaaaca cctccctggt ctcgccacag
   163981 agggcctcga gacccggccc ctcaaagatg gggggaacca tatgggcatt gtggaacacg
   164041 tagatgtccc tgtgatagga ggtagcgcgt aggagcccgc agttggggtc gggcctcctg
   164101 tgcagagcct tgacattgat gctgaagccc ggctccacgg tgatgccgca aaggagcggc
   164161 accgtcaggc acctgtggcc cgcgtagccg gtccccagtg tggccacctc cctaagaggg
   164221 taggtggcca gggggtaaaa gtagatgtag ccgcacggac ccggctggct ctggctgccc
   164281 agattatcct cgctagtctg tgcaccctgc atgatgccca aggtatcgcc ccggcctccc
   164341 agtcccacat taaatgttac actttactca tcacgcaaca cccactgttt attcatttac
   164401 aaagatttca ggaagtcagt caggctggcc agggcccacg tcacggggaa ctgacgtctc
   164461 agcgatcttg gcatgccgcc cagcctcgca aaccagagtc tgcgatagag ggccaggtag
   164521 tgggcgattg cccccagcac gaaggcggcg ctcttgtggt catccaggta gtttcgcacc
   164581 gcaaacacca ctgtgtagca cagcaccacc ctgagccgcg accagtagtc gtagtggtcg
   164641 ttgtacactg cgcgcaggac gctgatgatg agccgtacgt gcgtgtcttt gcccccgatg
   164701 tcggctgtcc tgcaggccag ctccgcgtac agcttcctat ccttcctcag ggaggccttg
   164761 atgagccggc agaggaccag ggctggcaaa ggcaggtctt tctcatcccg ggtgaacacc
   164821 gcgtacatgg ccctgaacat gaggtagctg gactcagcca ccttgtcgtc cggcggcgag
   164881 ggcgcgaccc acgcctcgac cggggtcctc acaaacacag aatctgtaga cttggctggc
   164941 ctcatggtct cgtcaggcca gctcacgggc ttcaggctta tatgataaaa tgggcgtggc
   165001 agaatagtat aagacgcgag gcctgggtga ggagagtcca gagcaatggc caggttcatc
   165061 gctcagctcc tcctgttggc ctcctgtgtg gccgccggcc aggctgtcac cgctttcttg
   165121 ggtgagcgag tcaccctgac ctcctactgg aggagggtga gcctcggtcc agagattgag
   165181 gtcagctggt ttaaactggg cccaggagag gagcaggtgc ttattgggcg catgcaccac
   165241 gatgtcatct ttatagagtg gcctttcagg ggcttctttg atatccacag aagtgccaac
   165301 accttctttt tagtagtcac cgctgccaac atctcccatg acggcaacta cctgtgccgc
   165361 atgaaactgg gcgagaccga ggtcaccaag caggaacacc tgagcgtggt gaagcctcta
   165421 acgctgtctg tccactccga aaggtctcag ttcccagact tctctgtcct tactgtgaca
   165481 tgcaccgtga atgcatttcc ccatccccac gtccagtggc tcatgcccga gggcgtggag
   165541 cccgcaccaa ctgcggcaaa tggcggtgtt atgaaggaaa aggatgggag cctctctgtt
   165601 gctgttgacc tgtcacttcc caagccctgg cacctgccag tgacctgcgt tgggaaaaat
   165661 gacaaggagg aagcccacgg ggtttatgtt tctggatact tgtcgcaata aacgcacttg
   165721 cctatttcac cttgttttag tgtggcattg ggggggtggc attgcgggtg gatagcctcg
   165781 cgactcgtgg gaaaatgggc ggaagggcac cgtgggaaaa tagttccagg tgacagcagc
   165841 agtgtgtgaa gattgtcaca gctgctggtt tggagaaaac gggggtgggc ggtgatcagg
   165901 gagaacaatt ccccggggac acctgcacga gacccctggg ctctcaggaa ctccgcccag
   165961 gtcttgccaa ttggggtgat cctgtagcgc cgcggtttca gcatcacagg ttattttgcc
   166021 tgaagcttgc tggggcgtaa atccctctcg ccttgtttct cagagagcat ttcaggccgg
   166081 ttttgcagtc gctgctgcag ctatggggtc cctagaaatg gtgccaatgg gcgcgggtcc
   166141 ccctagcccc ggcggggatc cggatgggta cgatggcgga aacaactccc aatatccatc
   166201 tgcttctggc tcttctggga acacccccac cccaccgaac gatgaggaac gtgaatctaa
   166261 tgaagagccc ccaccgcctt atgaggaccc atattggggc aatggcgacc gtcactcgga
   166321 ctatcaacca ctaggaaccc aagatcaaag tctgtacttg ggattgcaac acgacgggaa
   166381 tgacgggctc cctccccctc cctactctcc acgggatgac tcatctcaac acatatacga
   166441 agaagcgggc agaggaaggt aagagtgcca tctatctgta cttttattta ttgcatcaca
   166501 agtcacatca ataataaggg cgccatctag cgggagatgt tatccacacc atcccaattc
   166561 acatctcagg gacaacaggt caaagttctt tgttgacacc cccagcgctg gctccagggg
   166621 gtggaagcgt tggatgcagt cctccgcatc ggggcggacg cctcctccca acgcgtttct
   166681 gcggatcagt cgctggctgg tgggcatcgg agtcggtggg cggtcctcca cggggacacg
   166741 ctccttcttg gccttgttct ttgacctttt ggacattctt ctgaaggaac ggcggagagt
   166801 agcgtagaat ccagccagtg gtctacccgg tcgcatggtg gcttcttaga tgaggagcag
   166861 gcataaaagt ccaaacagga cacagagtac caccaggagt agtcttagtc tgctgacgtc
   166921 tgggtcctcg gggcaggggt ggctaggcct ggtctccgta gaagagccgg gcaggccgca
   166981 ggcagaggac tgctgctcta gcaaagcacg ctccaggacg tgtaccatct cgagagtgag
   167041 gcacagctgt tttcgtggac ttttatacag taaggacaag gaaagaaggc cagaggaatg
   167101 tggaaagatg agcgaggaca ggtgtggagg ttttgggcta gctcttagtt tctgggtgtg
   167161 agagagggat taaagtgctt atgcgcaaag aatgtgtcaa caacaggtgt tcctgcctct
   167221 gctggcatga gttaggtgtg gcttgggctg aatccaaatg tgtattggca caagatggaa
   167281 agcaaagttg ctggagttac tgggtgggag acagggatgt atgtggtccc ccgctggtat
   167341 gccagtaccc tgtggaagta aggggcctca tctgcctggt agttgtgttg tgcagaggtc
   167401 tgatgtgtgt aggaggggtg ggttcaacgc aggggcgttg gtggcggagt ctggcaacgc
   167461 ccgggtcctt gctacctgtg tggtgtgtta agggctgggt aaaggtgtct gccaattctc
   167521 gcatgtcctc ctttcccctt gttttgaaat agaatatgaa tgtggctttt cagcctagac
   167581 agacagtgtg gctaagggag tgtgtgccag ttaaggtgat tagctaaggc attcccagta
   167641 aatggaggga gagtcagtca ggcaagccta tgacatggta atgcctagaa gtaaagaaag
   167701 gttagtcata gtagcttagc tgaactgggc cgtgggggtc gtcatcatct ccaccggaac
   167761 cagaagaacc caaaagcagc gtaggaaggt gtggatcacc gccgccatgg ccggaatcat
   167821 gactatgacc gccgcctccg tctgtcatca aaggcgggcc ctggtcacct cctttgtttt
   167881 caacctcttc cgtcaattgt ggagggcctc catcatttcc agcagagtcg ctagggctat
   167941 gaggcagcgg gtcatgtggg ccattgtcat cagtgttgtc agggtcctgt gggccattgt
   168001 catcagtgtt gtcagggtcc tgaggcagcg ggtcatgtgg gccattgtca tcagtgttgt
   168061 cagggtcctg tgggccattg tcatcagtgt tgtcagggtc ctgtgggcca ttgtcaggac
   168121 cacctccagg tgcgcctagg ttttgagagc agagtggggg tccgtcgccg gctccactca
   168181 cgagcaggtg gtgtctgccc tcgttggagt tagagtcaga ttcatggcca gaatcatcgg
   168241 tagcttgttg agggtgcggg agggagtcat cgtggtggtg ttcatcactg tgtcgttgtc
   168301 catggtaata catccagatt aaaatcgcca gaaacaggag gagccaaagg agatcaacca
   168361 atagagtcca ccagttttgt tgtagataga gagcaataat gagcaggatg aggtctagga
   168421 agaaggctag gaagaaggcc aaaagctgcc agatggtggc accaagtcgc cagagcatct
   168481 ccaataagta gatccagata cctaagactg cgttgaaaaa agagtgttag ggttggaaaa
   168541 gtgggggtgt ggtaaataat tcctagggaa tgttagatct taccaagtaa gcacccgaag
   168601 atgaacagca caattccaag gaacaatgcc tgtccgtgca aattccagag agcgatgagc
   168661 aggagggtga ctggggaaag aggagaaagt gcgttagaga aggaagagta agggaaaggg
   168721 ggtgtggggc aaagggtgta atacttactc atcagtagga gtatacaaag ggctccaagt
   168781 ggacagagaa ggtctcttct gaagataaag atgatcaaaa ttataattat aagcatgaga
   168841 gcaaaggaat agaggacaag gagggctcct ccagtccagt cactcataac gatgtacagc
   168901 caaaacagta gcgccaagag gaggagaagg agagcaaggc ctagggaaga ggagaggggg
   168961 ggtcctcgag ggggccgtcg cgggcccggt gggcccctct caaggtcgtg ttccatcctc
   169021 agggcagtgt gtcaggagca aggcagttga ggaaagaagg gggcagagca gtgtgagagg
   169081 cttatgtagg gcggctacgt cagagtaacg cgtgtttctt gggatgtagg cccgggggga
   169141 tttgcggggt ctgccggagg cagtacgggt acagatttcc cgaaagcggc ggtgtgtgtg
   169201 tgcatgtaag cgtagaaagg ggaagtagaa agcgtgtgtt tgtgttagaa aagcgggtcc
   169261 ccggggggca agctgtggga atgcggtggc caagtgcaac aggaaatgga aaggcagtgc
   169321 ggcaatcaga agggggagtg cgtagtgttg tgggaagcgg cagtgtaatc tgcacaaaga
   169381 ggcgcggggc gcgcaacgtt gggaggtcgt tggcggcagg cgggaggccg tgctttaggg
   169441 gggttcaggt gaggcaaggc tgtggggtaa ccgtagggga ggcgggtgag gcggctaaga
   169501 gggctaaggg tcggcgggtg acgaagcagc agacggcgga tatgggaatt tcagaatgag
   169561 gtggcggatt caggcgaaaa gggtgtgggc tgtgcgagtg tcatgaggca ggcgcggaaa
   169621 gtcgctgcgg cttgctgggg catggggggc cgcgcattcc tggaaaaagt ggagggggcg
   169681 tggccttccc ccgcggcccc ccagcccccc cgcacagagc ggcgctacgg cgggcgggcg
   169741 gcggggggtc ggggtccgcg ggctccgggg gctgcgggcg gtggatggcg gcggacgttc
   169801 cggggatcgg gggggtcggg gggcgccgcg cgggcgcagc catgcgtgac cgtgatgagg
   169861 gggcagggtc gcagggggtg tgtctggtgg gggcgggagc ggggggcggc gcgggagcct
   169921 gcacgccgtt ggagggtaga atgacagggg gcggggacag agaggcggtc gcgcccccgg
   169981 ccgcgccagc caagccccca aggggggcgg ggagcgggca atggagcgtg acgaagggcc
   170041 ccagggctga ccccggcaaa cgtgacccgg ggctccgggg tgacccagcc aagcgtgacc
   170101 aaggggcccg tgggtgacac aggcaaccct gacaaaggcc ccccaggaaa gacccccggg
   170161 gggcatcggg gggtggggca tggggggccg cgcattcctg gaaaaagtgg agggggcgtg
   170221 gccttccccc gcggcccccc agcccccccg cacagagcgg cgctacggcg ggcgggcggc
   170281 ggggggtcgg ggtccgcggg ctccgggggc tgcgggcggt ggatggcggc ggacgttccg
   170341 gggatcgggg gggtcggggg gcgccgcgcg ggcgcagcca tgcgtgaccg tgatgagggg
   170401 gcagggtcgc agggggtgtg tctggtgggg gcgggagcgg ggggcggcgc gggagcctgc
   170461 acgccgttgg agggtagaat gacagggggc ggggacagag aggcggtcgc gcccccggcc
   170521 gcgccagcca agcccccaag gggggcgggg agcgggcaat ggagcgtgac gaagggcccc
   170581 agggctgacc ccggcaaacg tgacccgggg ctccggggtg acccagccaa gcgtgaccaa
   170641 ggggcccgtg ggtgacacag gcaaccctga caaaggcccc ccaggaaaga cccccgtggg
   170701 gcatgggggg ccgcgcattc ctggaaaaag tggagggggc gtggccttcc cccgcggccc
   170761 cccagccccc ccgcacagag cggcgctacg gcgggcgggc ggcggggggt cggggtccgc
   170821 gggctccggg ggctgcgggc ggtggatggc ggcggacgtt ccggggatcg ggggggtcgg
   170881 ggggcgccgc gcgggcgcag ccatgcgtga ccgtgatgag ggggcagggt cgcagggggt
   170941 gtgtctggtg ggggcgggag cggggggcgg cgcgggagcc tgcacgccgt tggagggtag
   171001 aatgacaggg ggcggggaca gagaggcggt cgcgcccccg gccgcgccag ccaagccccc
   171061 aaggggggcg gggagcgggc aatggagcgt gacgaagggc cccagggctg accccggcaa
   171121 acgtgacccg gggctccggg gtgacccagc caagcgtgac caaggggccc gtgggtgaca
   171181 caggcaaccc tgacaaaggc cccccaggaa agacccccgg ggggcatcgg ggggtggggc
   171241 atggggggcc gcgcattcct ggaaaaagtg gagggggcgt ggccttcccc cgcggccccc
   171301 cagccccccc gcacagagcg gcgctacggc gggcgggcgg cggggggtcg gggtccgcgg
   171361 gctccggggg ctgcgggcgg tggatggcgg cggacgttcc ggggatcggg ggggtcgggg
   171421 ggcgccgcgc gggcgcagcc atgcgtgacc gtgatgaggg ggcagggtcg cagggggtgt
   171481 gtctggtggg ggcgggagcg gggggcggcg cgggagcctg cacgccgttg gagggtagaa
   171541 tgacaggggg cggggacaga gaggcggtcg cgcccccggc cgcgccagcc aagcccccaa
   171601 ggggggcggg gagcgggcaa tggagcgtga cgaagggccc cagggctgac cccggcaaac
   171661 gtgacccggg gctccggggt gacccagcca agcgtgacca aggggcccgt gggtgacaca
   171721 ggcaaccctg acaaaggccc cccaggaaag acccccgggg ggcatcgggg ggggtgttgg
   171781 cgggggcatg ggggggtcgg atttcgccct tattgccctg ttt
//
DBGET integrated database retrieval system