GenomeNet

Database: RefSeq
Entry: NC_009333
LinkDB: NC_009333
Original site: NC_009333 
LOCUS       NC_009333             137969 bp    DNA     linear   VRL 04-JUN-2019
DEFINITION  Human herpesvirus 8 strain GK18, complete genome.
ACCESSION   NC_009333
VERSION     NC_009333.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Human gammaherpesvirus 8 (Kaposi's sarcoma-associated herpesvirus)
  ORGANISM  Human gammaherpesvirus 8
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae;
            Rhadinovirus.
REFERENCE   1  (bases 1 to 137969)
  AUTHORS   Rezaee,S.A., Cunningham,C., Davison,A.J. and Blackbourn,D.J.
  TITLE     Kaposi's sarcoma-associated herpesvirus immune modulation: an
            overview
  JOURNAL   J. Gen. Virol. 87 (PT 7), 1781-1804 (2006)
   PUBMED   16760382
REFERENCE   2  (bases 115410 to 137969)
  AUTHORS   Glenn,M., Rainbow,L., Aurade,F., Davison,A. and Schulz,T.F.
  TITLE     Identification of a spliced gene from Kaposi's sarcoma-associated
            herpesvirus encoding a protein with similarities to latent membrane
            proteins 1 and 2A of Epstein-Barr virus
  JOURNAL   J. Virol. 73 (8), 6953-6963 (1999)
   PUBMED   10400794
REFERENCE   3  (bases 1 to 137969)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (04-JUN-2019) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 137969)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-FEB-2006) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
REFERENCE   5  (bases 1 to 137969)
  AUTHORS   Glenn,M.A., Rainbow,L., Aurade,F., Davison,A.J. and Schulz,T.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-APR-1999) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AF148805.
            On Nov 5, 2009 this sequence version replaced NC_003409.1.
            Construction: The HHV-8 genome present in virions consists of a
            unique region (U) flanked at each end by variable numbers of a
            direct repeat (TR). The number of copies of TR totals 35-45, giving
            a genome size of approximately 170 kbp. The sequence is depicted as
            U followed by a single copy of TR. In virion DNA, each genome end
            is thought to terminate with a partial copy of TR such that
            circularization would create a complete copy of TR.
            Transcription: PolyA signals are known for some genes and predicted
            for many from the locations of AATAAA or ATTAAA motifs.
            Nomenclature: With a few exceptions, the primary nomenclature is
            that assigned originally to HHV-8 genes. The names of HHV-1
            counterparts (UL1-UL54) are indicated for core genes inherited from
            the ancestor of the Alpha-, Beta- and Gammaherpesvirinae;
            functional information on these genes may be derived from HHV-1.
            The names of HHV-5 counterparts are indicated for genes inherited
            from the ancestor of Beta- and Gammaherpesvirinae that lack
            counterparts in the Alphaherpesvirinae.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..137969
                     /organism="Human gammaherpesvirus 8"
                     /mol_type="genomic DNA"
                     /strain="GK18"
                     /isolation_source="classic Kaposi's sarcoma"
                     /host="Homo sapiens"
                     /db_xref="taxon:37296"
                     /country="Greece"
                     /type="P"
                     /common="Kaposi's sarcoma-associated herpesvirus"
                     /acronym="HHV-8"
                     /acronym="KSHV"
                     /note="cloned from tissue as overlapping cosmids; no cell
                     line contains this virus strain"
     misc_feature    1..137168
                     /note="unique (U) region; flanked by variable numbers of
                     terminal repeat (TR) in genomic DNA"
     misc_feature    1..7439
                     /note="insert in cos86; contains copies of TR at left end"
     gene            4..1083
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
                     /db_xref="GeneID:4961511"
     regulatory      4..9
                     /regulatory_class="TATA_box"
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
     mRNA            29..1083
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
                     /db_xref="GeneID:4961511"
     CDS             105..944
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
                     /note="ITAM-containing signal transducing membrane
                     glycoprotein; contains an Ig domain"
                     /codon_start=1
                     /product="K1"
                     /protein_id="YP_001129350.1"
                     /db_xref="GeneID:4961511"
                     /translation="MFLYVVCSLAVCFRGLLSLSLQSSPNLCPGVISTPYTLTCPSNT
                     SLPTSWYCNDTRLLRVTQGTLTVDTLICNFSCVGQSGHRYSLWITWYAQPVLQTFCGQ
                     PSNTVTCGQHVTLYCSTSGNNVTVWHLPNGQNETVSQTKYYNFTLMNQTEGCYACSNG
                     LSSRLSNRLCFSARCANITPETHTVSVSSTTGFRTFATAPTLFVMKEVKSTYLYIQEH
                     LLVFMTLVALIGTMCGILGTIIFAHCQKQRDSNKTVPQQLQDYYSLHDLCTEDYTQPV
                     DWY"
     misc_feature    210..422
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
                     /note="Glycoprotein K1 of Kaposi's sarcoma-associated
                     herpes virus; Region: KSHV_K1; pfam11049"
                     /db_xref="CDD:287961"
     misc_feature    582..941
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
                     /note="K1 glycoprotein; Region: K1; pfam02960"
                     /db_xref="CDD:281025"
     gene            1052..17026
                     /gene="ORF4"
                     /locus_tag="HHV8GK18_gp02"
                     /db_xref="GeneID:4961488"
     regulatory      1053..1058
                     /regulatory_class="polyA_signal_sequence"
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
     polyA_site      1083
                     /gene="K1"
                     /locus_tag="HHV8GK18_gp01"
     CDS             1112..2764
                     /gene="ORF4"
                     /locus_tag="HHV8GK18_gp02"
                     /note="complement control protein; membrane protein;
                     contains four SCR domains"
                     /codon_start=1
                     /product="KCP"
                     /protein_id="YP_001129351.1"
                     /db_xref="GeneID:4961488"
                     /translation="MAFLRQTLWILWTFTMVIGQDNEKCSQKTLIGYRLKMSRDGDIA
                     VGETVELRCRSGYTTYARNITATCLQGGTWSEPTATCNKKSCPNPGEIQNGKVIFHGG
                     QDALKYGANISYVCNEGYFLVGREYVRYCMIGASGQMAWSSSPPFCEKEKCHRPKIEN
                     GDFKPDKDYYEYNDAVHFECNEGYTLVGPHSIACAVNNTWTSNMPTCELAGCKFPSVT
                     HGYPIQGFSLTYKHKQSVTFACNDGFVLRGSPTITCNVTEWDPPLPKCVLEDIDDPNN
                     SNPGRLHPTPNEKPNGNVFQRSNYTEPPTKPEDTHTAATCDTNCEQPPKILPTSEGFN
                     ETTTSNTITKQLEDEKTTSQPNTHITSALTSMKAKGNFTNKTNNSTDLHIASTPTSQD
                     DATPSIPSVQTPNYNTNAPTRTLTSLHIEEGPSNSTTSEKATASTLSHNSHKNDTGGI
                     YTTLNKTTQLPSTNKPTNSQAKSSTKPRVETHNKTTSNPAISLTDSADVPQRPREPTL
                     PPIFRPPASKNRYLEKQLVIGLLTAVALTCGLITLFHYLFFR"
     misc_feature    1229..1912
                     /gene="ORF4"
                     /locus_tag="HHV8GK18_gp02"
                     /note="secreted complement-binding protein; Provisional;
                     Region: PHA02927"
                     /db_xref="CDD:222943"
     misc_feature    2189..>2662
                     /gene="ORF4"
                     /locus_tag="HHV8GK18_gp02"
                     /note="BDLF3; Provisional; Region: PHA03255"
                     /db_xref="CDD:165513"
     misc_feature    1272..41618
                     /note="insert in cos79"
     gene            3179..17026
                     /gene="ORF6"
                     /locus_tag="HHV8GK18_gp03"
                     /db_xref="GeneID:4961521"
     CDS             3179..6577
                     /gene="ORF6"
                     /locus_tag="HHV8GK18_gp03"
                     /note="single-stranded DNA-binding protein; herpesvirus
                     core gene UL29 family"
                     /codon_start=1
                     /product="ORF6"
                     /protein_id="YP_001129352.1"
                     /db_xref="GeneID:4961521"
                     /translation="MALKGPQTLEENIGSAAPTGPCGYLYAYVTHNFPIGEASLLGNG
                     YPEAKVFSLPLLHGLTVESDFPLNVKAVHKKIDATTASVKLTSYHREAIVFHNTHLFQ
                     PIFQGKGLEKLCRESRELFGFSTFVEQQHKGTLWSPEACPQLPCANEIFMAVIVTEGF
                     KERLYGGKLVPVPSQTTPVHIGEHQAFKIPLYDEDLFGPSRAQELCRFYNPDISRYLH
                     DSIFTGIAQALRVKDVSTVIQASERQFVHDQYKIPKLVQAKDFPQCASRGTDGSTLMV
                     IDSLVAELGMSYGLSFIEGPQDSCEVLNYDTWPIFENCETPDARLRALEVWHAEQALH
                     IGAQLFAANSVLYLTRVAKLPQKNQRGDANMYNSFYLQHGLGYLSEATVKENGASAFK
                     GVPVSALDGSSYTLQHLAYASSFSPHLLARMCYYLQFLPHHKNTNSQSYNVVDYVGTA
                     APSQMCDLCQGQCPAVCINTLFYRMKDRFPPVLSNVKRDPYVITGTAGTYNDLEILGN
                     FATFREREEEGNPVEDAPKYTYWQLCQNITEKLASMGISEGGDALRTLIVDIPSFVKV
                     FKGIDSTVEAELLKFINCMIKNNYNFRENIKSVHHILQFACNVYWQAPCPVFLTLYYK
                     SLLTVIQDICLTSCMMYEQDNPAVGIVPSEWLKMHFQTMWTNFKGACFDKGAITGGEL
                     KIVHQSMFCDLFDTDAAIGGMFAPARMQVRIARAMLMVPKTIKIKNRIIFSNSTGAES
                     IQAGFMKPASQRDSYIVGGPYMKFLNALHKTLFPSTKTSALYLWHKIGQTTKNPILPG
                     VSGEHLTELCNYVKASSQAFEEINVLDLVPDTLTSYAKIKLNSSILRACGQTQFYATT
                     LSCLSPVTQLVPAEEYPHVLGPVGLSSPDEYRVKVAGRSVTIVQSTLKQAVSTNGRLR
                     PIITVPLVVNKYTGSNGNTNVFHCANLGYFSGRGVDRNLRPESVPFKKNNVSSMLRKR
                     HVIMTPLVDRLVKRIVGINSGEFEAEAVKRSVQNVLEDRDNPNLPKTVVLELVKHLGS
                     SCASLTEEDVIYYLGPYAVLGDEVLSLLSTVGQAGVPWTAEGVASVIQDIIDDCELQF
                     VGPEEPCLIQGQSVVEELFPSPGVPSLTVGKKRKIASLLSDLDL"
     misc_feature    3200..6547
                     /gene="ORF6"
                     /locus_tag="HHV8GK18_gp03"
                     /note="single-stranded DNA binding protein; Provisional;
                     Region: PHA03367"
                     /db_xref="CDD:223059"
     gene            6594..17026
                     /gene="ORF7"
                     /locus_tag="HHV8GK18_gp04"
                     /db_xref="GeneID:4961505"
     CDS             6594..8681
                     /gene="ORF7"
                     /locus_tag="HHV8GK18_gp04"
                     /note="subunit of terminase; herpesvirus core gene UL28
                     family"
                     /codon_start=1
                     /product="ORF7"
                     /protein_id="YP_001129353.1"
                     /db_xref="GeneID:4961505"
                     /translation="MAKELAAVYADVSALAMDLCLLSYADPATLDTKSLALTTGKFQS
                     LHGTLLPLLRRQNAHECSGLSLELEHLLENVADALTTLGVCTSRKLSPEEHFSLLHLD
                     ITCNKHRSVRFNFYGNWALELKLSLINDVEIFFKRLSSVFYCIGSGSALEGLGEVLRF
                     VGKLRGISPVPGPDLYVSNLPCLECLQEVCLTPNQGTSLQAMLPDTACSHICTPACGE
                     PVRGLFENELKQLGLQTPESIPTTPCQSRVRQDDEIRQSSLMAVGDHHIFGEVTRSVL
                     EISNLIYWSSGHSDATCDGDRDCSHLASLFTHEADMHKRRVDLAGCLGERGTPKHFFD
                     CFRPDSLETLFCGGLFSSVEDTIESLQKDCSSAFYQQVNYTTALQKQNEFYVRLSKLL
                     AAGQLNLGKCSTESCPSEARRQLVGGDKPEEVLRDAKHRQELYLQKVARDGFKKLSDC
                     IRHQGHILSQTLGLRLWGSVIYNEASALQNHFLHRAQFISLPWQDLTVDCPTRFENSK
                     YIKNSLYCQRLGREHVEILTLEFYKLITGPLSKRHTLFPSPPNVTLAQCFEAAGMLPH
                     QKMMVSEMIWPSIEPKDWIEPNFNQFYSFENQDINHLQKRAWEYIRELVLSVSLYNRT
                     WERELKILLTPQGSPGFKEPKPAGLTTGLYLTFETSAPLVLVDKKYGWIFKDLYALLY
                     HHLQLSNHNDSQV"
     misc_feature    6597..8414
                     /gene="ORF7"
                     /locus_tag="HHV8GK18_gp04"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     gene            8665..17026
                     /gene="ORF8"
                     /locus_tag="HHV8GK18_gp05"
                     /db_xref="GeneID:4961501"
     CDS             8665..11202
                     /gene="ORF8"
                     /locus_tag="HHV8GK18_gp05"
                     /note="envelope glycoprotein gB; herpesvirus core gene
                     UL27 family"
                     /codon_start=1
                     /product="ORF8"
                     /protein_id="YP_001129354.1"
                     /db_xref="GeneID:4961501"
                     /translation="MTPRSRLATLGTVILLVCFCAGAAHSRGDTFQTSSSPTPPGSSS
                     KAPTKPGEEASGPKSVDFYQFRVCSASITGELFRFNLEQTCPDTKDKYHQEGILLVYK
                     KNIVPHIFKVRRYRKIATSVTVYRGLTESAITNKYELPRPVPLYEISHMDSTYQCFSS
                     MKVNVNGVENTFTDRDDVNTTVFLQPVEGLTDNIQRYFSQPVIYAEPGWFPGIYRVRT
                     TVNCEIVDMIARSAEPYNYFVTSLGDTVEVSPFCYNESSCSTTPSNKNGLSVQVVLNH
                     TVVTYSDRGTSPTPQNRIFVETGAYTLSWASESKTTAVCPLALWKTFPRSIQTTHEDS
                     FHFVANEITATFTAPLTPVANFTDTYSCLTSDINTTLNASKAKLASTHVPNGTVQYFH
                     TTGGLYLVWQPMSAINLTHAQGDSGNPTSSPPPSASPMTTSASRRKRRSASTAAAGGG
                     GSTDNLSYTQLQFAYDKLRDGINQVLEELSRAWCREQVRDNLMWYELSKINPTSVMTA
                     IYGRPVSAKFVGDAISVTECINVDQSSVNIHKSLRTNSKDVCYARPLVTFKFLNSSNL
                     FTGQLGARNEIILTNNQVETCKDTCEHYFITRNETLVYKDYAYLRTINTTDISTLNTF
                     IALNLSFIQNIDFKAIELYSSAEKRLASSVFDLETMFREYNYYTHRLAGLREDLDNTI
                     DMNKERFVRDLSEIVADLGGIGKTVVNVASSVVTLCGSLVTGFINFIKHPLGGMLMII
                     IVIAIILIIFMLSRRTNTIAQAPVKMIYPDVDRRAPPSGGAPTREEIKNILLGMHQLQ
                     QEERQKADDLKKSTPSVFQRTANGLRQRLRGYKPLTQSLDISPETGE"
     misc_feature    8800..11187
                     /gene="ORF8"
                     /locus_tag="HHV8GK18_gp05"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     misc_feature    11325..53653
                     /note="insert in cos29"
     gene            11329..17026
                     /gene="ORF9"
                     /locus_tag="HHV8GK18_gp06"
                     /db_xref="GeneID:4961513"
     CDS             11329..14367
                     /gene="ORF9"
                     /locus_tag="HHV8GK18_gp06"
                     /note="DNA polymerase catalytic subunit; herpesvirus core
                     gene UL30 family"
                     /codon_start=1
                     /product="ORF9"
                     /protein_id="YP_001129355.1"
                     /db_xref="GeneID:4961513"
                     /translation="MDFFNPFIDPTRGGPRNTVRQPTPSQSPTVPSETRVCRLIPACF
                     QTPGRPGVVAVDTTFPPTYFQGPKRGEVFAGETGSIWKTRRGQARNAPMSHLIFHVYD
                     IVETTYTADRCEDVPFSFQTDIIPSGTVLKLLGRTLDGASVCVNVFRQRCYFYTLAPQ
                     GVNLTHVLQQALQAGFGRASCGFSTEPVRKKILRAYDTQQYAVQKITLSSSPMMRTLS
                     DRLTTCGCEVFESNVDAIRRFVLDHGFSTFGWYECSNPAPRTQARDSWTELEFDCSWE
                     DLKFIPERTEWPPYTILSFDIECMGEKGFPNATQDEDMIIQISCVLHTVGNDKPYTRM
                     LLGLGTCDPLPGVEVFEFPSEYDMLAAFLSMLRDYNVEFITGYNIANFDLPYIIARAT
                     QVYDFKLQDFTKIKTGSVFEVHQPRGGSDGGNFMRSQSKVKISGIVPIDMYQVCREKL
                     SLSDYKLDTVAKQCLGRQKDDISYKDIPPLFKSGPDGRAKVGNYCVIDSVLVMDLLLR
                     FQTHVEISEIAKLAKIPTRRVLTDGQQIRVFSCLLEAAATEGYILPVPKGDAVSGYQG
                     ATVISPSPGFYDDPVLVVDFASLYPSIIQAHNLCYSTLIPGDSLHLHPHLSPDDYETF
                     VLSGGPVHFVKKHKRESLLAKLLTVWLAKRKEIRKTLASCTDPALKTILDKQQLAIKV
                     TCNAVYGFTGVASGILPCLNIAETVTLQGRKMLERSQAFVEAISPERLAGLLRRPVDV
                     SPDARFKVIYGDTDSLFICCMGFNMDSVSDFAEELASITTNTLFRSPIKLEAEKIFKC
                     LLLLTKKRYVGVLSDDKVLMKGVDLIRKTACRFVQEKSSQVLDLILREPSVKAAAKLI
                     SGQATDWVYREGLPEGFVKIIQVLNASHRELCERSVPVDKLTFTTELSRPLADYKTQN
                     LPHLTVYQKLQARQEELPQIHDRIPYVFVDAPGSLRSELAEHPEYVKQHGLRVAVDLY
                     FDKLVHAVANIIQCLFQNNTSATVAILYNFLDIPVTFPTP"
     misc_feature    11734..12708
                     /gene="ORF9"
                     /locus_tag="HHV8GK18_gp06"
                     /note="DNA polymerase family B, exonuclease domain;
                     Region: DNA_pol_B_exo1; pfam03104"
                     /db_xref="CDD:397292"
     misc_feature    12898..14289
                     /gene="ORF9"
                     /locus_tag="HHV8GK18_gp06"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:395085"
     gene            14485..17026
                     /gene="ORF10"
                     /locus_tag="HHV8GK18_gp07"
                     /db_xref="GeneID:4961456"
     CDS             14485..15741
                     /gene="ORF10"
                     /locus_tag="HHV8GK18_gp07"
                     /note="derived from herpesvirus dUTPase; related to HHV-5
                     UL82, UL83 and UL84"
                     /codon_start=1
                     /product="ORF10"
                     /protein_id="YP_001129356.1"
                     /db_xref="GeneID:4961456"
                     /translation="MQTEATFILGDWEITVSNCRFTCSSLTCGPLYRSSGDYTRLRIP
                     FSLDRLIRDHAIFGLVPNIEDLLTHGSCVAVVADANATGGNARRIVAPGVINNFSEPI
                     GIWVRGPPPQTRKEAIKFCIFFVSPLPPREMTTYVFKGGDLPPGAEEPETLHSAEAPL
                     PSRETLVTGQLRSTSPRTYTGYFHSPVPLSFLDLLTFESMGCENVEGDPEPLTPKYLT
                     FTQTGERLYKVTVHNTHSTACKKARIRFVYRPTPSARQLVMGQASPLITTPLGARVFA
                     VYPDCEKTIPPQETTTLRIQLLFEQHGANAGECAFVIMGLARETKFVSFPAVLLPGKH
                     EHLTVFNPQTHPLTIQRDTIVGVAMACYIHPGKAASQAPYSFYDCKEESWHVGLFQIK
                     HGPGGVCTPPCHVAIRADRHEEPMQS"
     misc_feature    14503..15645
                     /gene="ORF10"
                     /locus_tag="HHV8GK18_gp07"
                     /note="Herpesvirus dUTPase protein; Region: Herpes_ORF11;
                     pfam04797"
                     /db_xref="CDD:309783"
     gene            15756..17026
                     /gene="ORF11"
                     /locus_tag="HHV8GK18_gp08"
                     /db_xref="GeneID:4961439"
     CDS             15756..16979
                     /gene="ORF11"
                     /locus_tag="HHV8GK18_gp08"
                     /note="derived from herpesvirus dUTPase; related to HHV-5
                     UL82, UL83 and UL84"
                     /codon_start=1
                     /product="ORF11"
                     /protein_id="YP_001129357.1"
                     /db_xref="GeneID:4961439"
                     /translation="MAQESEQCSRAFAVCSSKRQLGRGEPVWDSVIHPSHIVISNRVP
                     LLLREQNICLPSCPSVGQILHRAYPNFTFDNTHRKQQTETYTAFYAFGDQNNKVRILP
                     TVVESSSSVLIFRLRASVSANIAVGGLKIIILALTLVHAQGVYLRCGKDLSTPHCAPA
                     IVQREVLSSGFEPQFTVTGIPVTSSNLNQCYFLVRKPKSRLAKPFARLSAETTEECRV
                     RSIRLGKTHLRISVTAPAQETPVWGLVTTSFSLTPTAPLAFDRNPYNHETFACNARHY
                     IPVIYSGPKITLAPRGRQVVWHNNSYTSSLPCKVTAIVSNHCCNCDIFLEDSEWRPNK
                     PAPLKLVNTSDHPVILEPDTHIGNALFIIAPKARGLRRLTRLTTKTIELPGGVKIDSR
                     KLQTFRKMYVATGRS"
     misc_feature    15756..16976
                     /gene="ORF11"
                     /locus_tag="HHV8GK18_gp08"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03365"
                     /db_xref="CDD:177602"
     regulatory      17021..17026
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF4, ORF6, ORF7, ORF8, ORF9, ORF10, ORF11"
     gene            complement(17166..18519)
                     /gene="ORF2"
                     /locus_tag="HHV8GK18_gp09"
                     /db_xref="GeneID:4961454"
     gene            complement(17166..17841)
                     /gene="K2"
                     /locus_tag="HHV8GK18_gp10"
                     /db_xref="GeneID:4961449"
     regulatory      complement(17166..17171)
                     /regulatory_class="polyA_signal_sequence"
                     /note="K2, ORF2"
     CDS             complement(17227..17841)
                     /gene="K2"
                     /locus_tag="HHV8GK18_gp10"
                     /note="interleukin-6; vIL-6"
                     /codon_start=1
                     /product="K2"
                     /protein_id="YP_001129358.1"
                     /db_xref="GeneID:4961449"
                     /translation="MRWFKLWSILLVGSLLVSGTRGKLPDAPEFEKDLLIQRLNWMLW
                     VIDECFRDLCYRTGICKGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFF
                     EFEVLFKFLTTEFGKSVINVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGR
                     LQGLKYWVRHFASFYVLSAMEKFAGQAVRVLNSIPDVTPDVHDK"
     misc_feature    complement(17269..17727)
                     /gene="K2"
                     /locus_tag="HHV8GK18_gp10"
                     /note="Interleukin-6 homologues; Region: IL6; smart00126"
                     /db_xref="CDD:128431"
     CDS             complement(17887..18519)
                     /gene="ORF2"
                     /locus_tag="HHV8GK18_gp09"
                     /note="dihydrofolate reductase"
                     /codon_start=1
                     /product="ORF2"
                     /protein_id="YP_001129359.1"
                     /db_xref="GeneID:4961454"
                     /translation="MDPTLYCVVAVDTKLGIGKNRCLPWPALRGDMRRFRQLTTDCAP
                     GKQNMVVMGRRTWLSIPAGCRPLAGRINVVLSRTLETPPPGAHFLASSLDAALGLARS
                     PELAQQIDKVWVIGGGNLYREALTGPWPVRLFLTRVLHDFACDVFLSHDSLAAYARVN
                     PKPGEQERVFQERGIFYMFETYIKVTQSSDTALPDLERPRPATPPFSETS"
     misc_feature    complement(17971..18507)
                     /gene="ORF2"
                     /locus_tag="HHV8GK18_gp09"
                     /note="Dihydrofolate reductase (DHFR). Reduces
                     7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH
                     as a cofactor. This is an essential step in the
                     biosynthesis of deoxythymidine phosphate since
                     5,6,7,8-tetrahydrofolate is required to regenerate 5;
                     Region: DHFR; cd00209"
                     /db_xref="CDD:238127"
     misc_feature    complement(order(18112..18114,18157..18159,18175..18177,
                     18310..18312,18427..18429,18445..18447,18496..18498))
                     /gene="ORF2"
                     /locus_tag="HHV8GK18_gp09"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     misc_feature    complement(order(18163..18174,18289..18291,18352..18360,
                     18469..18471,18490..18492))
                     /gene="ORF2"
                     /locus_tag="HHV8GK18_gp09"
                     /note="NADP+ binding site [chemical binding]; other site"
                     /db_xref="CDD:238127"
     gene            complement(18573..19542)
                     /gene="K3"
                     /locus_tag="HHV8GK18_gp11"
                     /db_xref="GeneID:4961486"
     regulatory      complement(18573..18578)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="K3"
                     /locus_tag="HHV8GK18_gp11"
     CDS             complement(18574..19542)
                     /gene="K3"
                     /locus_tag="HHV8GK18_gp11"
                     /function="downregulation of MHC-I"
                     /note="E3 ubiquitin ligase; membrane protein; related to
                     K5; MIR1; ORF12"
                     /codon_start=1
                     /product="K3"
                     /protein_id="YP_001129360.1"
                     /db_xref="GeneID:4961486"
                     /translation="MEDEDVPVCWICNEELGNERFRACGCTGELENVHRSCLSTWLTI
                     SRNTACQICGVVYNTRVVWRPLREMTLLPRLTYQEGLELIVFIFIMTLGAAGLAAATW
                     VWLYIVGGHDPEIDHVAAAAYYVFFVFYQLFVVFGLGAFFHMMRHVGRAYAAVNTRVE
                     VFPYRPRPTSPECAVEEIELQEILPRGDNQDEEGPAGAAPGDQDGPADGAPVHRDSEE
                     SVDEAAGYKEAGEPTHNDGRDDNVEPTAVGCDCNNLGAERYRATYCGGYVGAQSGDGA
                     YSVSCHNKAGPSSLVDILPQGLLGGGYGSMGVIRKRSAVSSALMFH"
     misc_feature    complement(19381..19521)
                     /gene="K3"
                     /locus_tag="HHV8GK18_gp11"
                     /note="The RING-variant domain is a C4HC3 zinc-finger like
                     motif found in a number of cellular and viral proteins;
                     Region: RINGv; smart00744"
                     /db_xref="CDD:128983"
     gene            complement(19822..21036)
                     /gene="ORF70"
                     /locus_tag="HHV8GK18_gp12"
                     /db_xref="GeneID:4961481"
     regulatory      complement(19822..19827)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF70"
                     /locus_tag="HHV8GK18_gp12"
     CDS             complement(20023..21036)
                     /gene="ORF70"
                     /locus_tag="HHV8GK18_gp12"
                     /note="thymidylate synthase"
                     /codon_start=1
                     /product="ORF70"
                     /protein_id="YP_001129361.1"
                     /db_xref="GeneID:4961481"
                     /translation="MFPFVPLSLYVAKKLFRARGFRFCQKPGVLALAPEVDPCSIQHE
                     VTGAETPHEELQYLRQLREILCRGSDRLDRTGIGTLSLFGMQARYSLRDHFPLLTTKR
                     VFWRGVVQELLWFLKGSTDSRELSRTGVKIWDKNGSREFLAGRGLAHRREGDLGPVYG
                     FQWRHFGAAYVDADADYTGQGFDQLSYIVDLIKNNPHDRRIIMCAWNPADLSLMALPP
                     CHLLCQFYVADGELSCQLYQRSGDMGLGVPFNIASYSLLTYMLAHVTGLRPGEFIHTL
                     GDAHIYKTHIEPLRLQLTRTPRPFPRLEILRSVSSMEEFTPDDFRLVDYCPHPTIRME
                     MAV"
     misc_feature    complement(20026..>20886)
                     /gene="ORF70"
                     /locus_tag="HHV8GK18_gp12"
                     /note="bifunctional dihydrofolate reductase-thymidylate
                     synthase; Provisional; Region: PTZ00164"
                     /db_xref="CDD:240299"
     gene            complement(21275..21764)
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /db_xref="GeneID:4961514"
     regulatory      complement(21275..21280)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
     CDS             complement(21480..21764)
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="interleukin 8-like CC chemokine; vCCL-2; vMIP-II"
                     /codon_start=1
                     /product="K4"
                     /protein_id="YP_001129362.1"
                     /db_xref="GeneID:4961514"
                     /translation="MDTKGILLVAVLTALLCLQSGDTLGASWHRPDKCCLGYQKRPLP
                     QVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTAR"
     misc_feature    complement(21498..21674)
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="Intercrine alpha family (small cytokine C-X-C)
                     (chemokine CXC); Region: SCY; smart00199"
                     /db_xref="CDD:197570"
     misc_feature    complement(order(21498..21524,21621..21638,21651..21665))
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="putative receptor binding site [active]"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(21624..21638,21651..21659))
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="N-loop [active]"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(21552..21554,21558..21560,21624..21632))
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(21504..21506,21513..21518,21525..21527,
                     21531..21533,21585..21587,21606..21608))
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(21585..21587,21603..21605))
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(21558..21560,21564..21566))
                     /gene="K4"
                     /locus_tag="HHV8GK18_gp13"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238170"
     gene            complement(21907..23078)
                     /gene="K4.2"
                     /locus_tag="HHV8GK18_gp14"
                     /db_xref="GeneID:4961450"
     gene            complement(21907..22461)
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /db_xref="GeneID:4961436"
     regulatory      complement(21907..21912)
                     /regulatory_class="polyA_signal_sequence"
                     /note="K4.1, K4.2"
     CDS             complement(22117..22461)
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="interleukin 8-like CC chemokine; vCCL-3;
                     vMIP-Ibeta"
                     /codon_start=1
                     /product="K4.1"
                     /protein_id="YP_001129363.1"
                     /db_xref="GeneID:4961436"
                     /translation="MWSMCWVLRAHLGLLFWVAVIELCAASGPATIMASDCCENSLSS
                     ARLPPDKLICGWYWTSTVYCRQKAVIFVTHSGRKVCGSPAKRRTRLLMEKHTEIPLAK
                     RVALRAGKGLCP"
     misc_feature    complement(22174..22353)
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="small cytokines, including a number of secreted
                     growth factors and interferons involved in mitogenic,
                     chemotactic, and inflammatory activity; distinguished from
                     other cytokines by their receptors, which are G-protein
                     coupled receptors; divided into 4...; Region: Chemokine;
                     cl00134"
                     /db_xref="CDD:412179"
     misc_feature    complement(order(22174..22206,22270..22275,22309..22332,
                     22339..22353))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="putative receptor binding site [active]"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22174..22179,22186..22191,22198..22203,
                     22219..22227,22249..22257,22270..22272,22288..22290,
                     22294..22296,22339..22341,22345..22347))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22222..22224,22228..22230,22252..22254,
                     22270..22275,22282..22284,22339..22341,22345..22347))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="dimer interface (P form) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22225..22227,22252..22254,22345..22347))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="putative receptor binding cleft [active]"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22309..22332,22339..22347))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="N-loop [active]"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22174..22179,22186..22191,22198..22203,
                     22219..22221,22225..22227,22249..22251,22255..22257,
                     22288..22290,22294..22296,22339..22341))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="dimer interface (I form) [polypeptide binding];
                     other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22231..22233,22237..22239,22309..22317,
                     22324..22332))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22183..22185,22192..22197,22204..22206,
                     22210..22212,22264..22266,22288..22290))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(22270..22275)
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238098"
     misc_feature    complement(order(22237..22239,22243..22245))
                     /gene="K4.1"
                     /locus_tag="HHV8GK18_gp15"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238098"
     CDS             complement(22530..23078)
                     /gene="K4.2"
                     /locus_tag="HHV8GK18_gp14"
                     /note="contains hydrophobic domains"
                     /codon_start=1
                     /product="K4.2"
                     /protein_id="YP_001129364.1"
                     /db_xref="GeneID:4961450"
                     /translation="MQISFAEVLGKPVGRAGFLDRGKWDRCPLYDLFSHLATSATFSG
                     TASGFGAVSGVLPGSCSGIAWSIKPGNYDPLIPFETLMTWDIGSKNPRLTKYWTLLTT
                     SAAPGVSPVSSCFVFGGGGRGECLVSVLLLFFCVCTFGCFGKPYRCAIFWVIHKLHLA
                     TLVFIVAFGEEKRGDPWSPGLQ"
     repeat_region   23082..24228
                     /rpt_family="LIR1"
                     /rpt_type=inverted
     repeat_region   24230..24808
                     /rpt_family="DR1"
                     /rpt_type=direct
     repeat_region   24823..25045
                     /rpt_family="DR2"
                     /rpt_type=direct
     gene            complement(25865..26635)
                     /gene="K5"
                     /locus_tag="HHV8GK18_gp16"
                     /db_xref="GeneID:4961442"
     CDS             complement(25865..26635)
                     /gene="K5"
                     /locus_tag="HHV8GK18_gp16"
                     /function="downregulation of MHC-I"
                     /note="E3 ubiquitin ligase; membrane protein; related to
                     K3; MIR2"
                     /codon_start=1
                     /product="K5"
                     /protein_id="YP_001129365.1"
                     /db_xref="GeneID:4961442"
                     /translation="MASKDVEEGVEGPICWICREEVGNEGIHPCACTGELDVVHPQCL
                     STWLTVSRNTACQMCRVIYRTRTQWRSRLNLWPEMERQEIFELFLLMSVVVAGLVGVA
                     LCTWTLLVILTAPAGTFSPGAVLGFLCFFGFYQIFIVFAFGGICRVSGTVRALYAANN
                     TRVTVLPYRRPRRPTANEDNIELTVLVGPAGGTDEEPTDESSEGDVASGDKERDGSSG
                     DEPDGGPNDRAGLRGTARTDLCAPTKKPVRKNHPKNNG"
     misc_feature    complement(26456..26596)
                     /gene="K5"
                     /locus_tag="HHV8GK18_gp16"
                     /note="The RING-variant domain is a C4HC3 zinc-finger like
                     motif found in a number of cellular and viral proteins;
                     Region: RINGv; smart00744"
                     /db_xref="CDD:128983"
     misc_feature    complement(order(26459..26461,26468..26470,26507..26509,
                     26516..26518,26525..26527,26540..26542,26582..26584,
                     26591..26593))
                     /gene="K5"
                     /locus_tag="HHV8GK18_gp16"
                     /note="cross-brace motif; other site"
                     /db_xref="CDD:319409"
     gene            complement(27067..27576)
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /db_xref="GeneID:4961510"
     regulatory      complement(27067..27072)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
     CDS             complement(27289..27576)
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="interleukin 8-like CC chemokine; vCCL-1; vMIP-I"
                     /codon_start=1
                     /product="K6"
                     /protein_id="YP_001129366.1"
                     /db_xref="GeneID:4961510"
                     /translation="MAPVHVLCCVSVLLATFYLTPTESAGSLVSYTPNSCCYGFQQHP
                     PPVQILKEWYPTSPACPKPGVILLTKRGRQICADPSKNWVRQLMQRLPAIA"
     misc_feature    complement(27304..27480)
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="Intercrine alpha family (small cytokine C-X-C)
                     (chemokine CXC); Region: SCY; smart00199"
                     /db_xref="CDD:197570"
     misc_feature    complement(order(27304..27330,27427..27444,27457..27471))
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="putative receptor binding site [active]"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(27430..27444,27457..27465))
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="N-loop [active]"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(27358..27360,27364..27366,27430..27438))
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(27310..27312,27319..27324,27331..27333,
                     27337..27339,27391..27393,27412..27414))
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="putative glycosaminoglycan (GAG) binding site
                     [chemical binding]; other site"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(27391..27393,27409..27411))
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="30s-loop; other site"
                     /db_xref="CDD:238170"
     misc_feature    complement(order(27364..27366,27370..27372))
                     /gene="K6"
                     /locus_tag="HHV8GK18_gp17"
                     /note="40s-loop; other site"
                     /db_xref="CDD:238170"
     gene            28774..29876
                     /gene="K7"
                     /locus_tag="HHV8GK18_gp18"
                     /db_xref="GeneID:4961500"
     CDS             28774..29154
                     /gene="K7"
                     /locus_tag="HHV8GK18_gp18"
                     /note="IAP-like inhibitor of apoptosis; contains
                     hydrophobic domain; vIAP"
                     /codon_start=1
                     /product="K7"
                     /protein_id="YP_001129367.1"
                     /db_xref="GeneID:4961500"
                     /translation="MGTLEIKGASLSQFSTGTAQSPWLPLHLWILCSLLAFLPLLVFI
                     GAADCGLIASLLAIYPSWLSARFSVLLFPHWPESCSTKNTARSGALHKPAEQKLRFAQ
                     KPCHGNYTVTPCGLLHWIQSPGQL"
     gene            28819..29895
                     /locus_tag="HHV8_gs01"
                     /db_xref="GeneID:4961489"
     misc_RNA        28819..29895
                     /locus_tag="HHV8_gs01"
                     /product="T1.1"
                     /note="nut-1; PAN"
                     /db_xref="GeneID:4961489"
     regulatory      29871..29876
                     /regulatory_class="polyA_signal_sequence"
                     /note="K7, T1.1"
     repeat_region   29927..30055
                     /rpt_family="DR3"
                     /rpt_type=direct
     gene            30242..30834
                     /gene="ORF16"
                     /locus_tag="HHV8GK18_gp19"
                     /db_xref="GeneID:4961447"
     CDS             30242..30769
                     /gene="ORF16"
                     /locus_tag="HHV8GK18_gp19"
                     /note="bcl-2-like inhibitor of apoptosis; vBcl-2"
                     /codon_start=1
                     /product="ORF16"
                     /protein_id="YP_001129368.1"
                     /db_xref="GeneID:4961447"
                     /translation="MDEDVLPGEVLAIEGIFMACGLNEPEYLYHPLLSPIKLYITGLM
                     RDKESLFEAMLANVRFHSTTGINQLGLSMLQVSGDGNMNWGRALAILTFGSFVAQKLS
                     NEPHLRDFALAVLPVYAYEAIGPQWFRARGGWRGLKAYCTQVLTRRRGRRMTALLGSI
                     ALLATILAAVAMSRR"
     misc_feature    30347..30643
                     /gene="ORF16"
                     /locus_tag="HHV8GK18_gp19"
                     /note="BCL (B-Cell lymphoma); contains BH1, BH2 regions;
                     Region: BCL; smart00337"
                     /db_xref="CDD:214626"
     misc_feature    30485..30523
                     /gene="ORF16"
                     /locus_tag="HHV8GK18_gp19"
                     /note="BH1 [active]"
                     /db_xref="CDD:132900"
     misc_feature    30617..30652
                     /gene="ORF16"
                     /locus_tag="HHV8GK18_gp19"
                     /note="BH2 [active]"
                     /db_xref="CDD:132900"
     regulatory      30829..30834
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF16"
                     /locus_tag="HHV8GK18_gp19"
     gene            complement(30857..32524)
                     /gene="ORF17"
                     /locus_tag="HHV8GK18_gp20"
                     /db_xref="GeneID:4961478"
     gene            complement(30857..31786)
                     /gene="ORF17.5"
                     /locus_tag="HHV8GK18_gp21"
                     /db_xref="GeneID:4961482"
     regulatory      complement(30857..30862)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF17, ORF17.5"
     CDS             complement(30920..32524)
                     /gene="ORF17"
                     /locus_tag="HHV8GK18_gp20"
                     /note="capsid maturational protease; minor capsid scaffold
                     protein; herpesvirus core gene UL26 family"
                     /codon_start=1
                     /product="ORF17"
                     /protein_id="YP_001129369.1"
                     /db_xref="GeneID:4961478"
                     /translation="MAQGLYVGGFVDVVSCPKLEQELYLDPDQVTDYLPVTEPLPITI
                     EHLPETEVGWTLGLFQVSHGIFCTGAITSPAFLELASRLADTSHVARAPVKNLPKEPL
                     LEILHTWLPGLSLSSIHPRELSQTPSGPVFQHVSLCALGRRRGTVAVYGHDAEWVVSR
                     FSSVSKSERAHILQHVSSCRLEDLSTPNFVSPLETLMAKAIDASFIRDRLDLLKTDRG
                     VASILSPAYLKASQFPVGIQAVTPPRPAMNSSGQEDIISIPKSAFLSMLQSSIDGMKT
                     TAAKMSHTLSGPGLMGCGGQMFPTDHHLPSYVSNPAPPYGYAYKNPYDPWYYSPQLPG
                     YRTGKRKRGAEDDEGHLFPGEEPAYHKDILSMSKNIAEIQSELKEMKLNGWHAGPPPS
                     SSAAAAAVDPHYRPHANSAAPCQFPTMKEHGGTYVHPPIYVQAPHGQFQQAAPILFAQ
                     PHVSHPPVSTGLAVVGAPPAEPTPASSTQSIQQQAPETTHTPCAAVEKDAPTPNPTSN
                     RVEASSRSSPKSKIRKMFCEELLNKQ"
     misc_feature    complement(30926..32512)
                     /gene="ORF17"
                     /locus_tag="HHV8GK18_gp20"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     CDS             complement(30920..31786)
                     /gene="ORF17.5"
                     /locus_tag="HHV8GK18_gp21"
                     /note="major capsid scaffold protein; herpesvirus core
                     gene UL26.5 family"
                     /codon_start=1
                     /product="ORF17.5"
                     /protein_id="YP_001129370.1"
                     /db_xref="GeneID:4961482"
                     /translation="MNSSGQEDIISIPKSAFLSMLQSSIDGMKTTAAKMSHTLSGPGL
                     MGCGGQMFPTDHHLPSYVSNPAPPYGYAYKNPYDPWYYSPQLPGYRTGKRKRGAEDDE
                     GHLFPGEEPAYHKDILSMSKNIAEIQSELKEMKLNGWHAGPPPSSSAAAAAVDPHYRP
                     HANSAAPCQFPTMKEHGGTYVHPPIYVQAPHGQFQQAAPILFAQPHVSHPPVSTGLAV
                     VGAPPAEPTPASSTQSIQQQAPETTHTPCAAVEKDAPTPNPTSNRVEASSRSSPKSKI
                     RKMFCEELLNKQ"
     misc_feature    complement(30926..>31780)
                     /gene="ORF17.5"
                     /locus_tag="HHV8GK18_gp21"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     gene            32523..33535
                     /gene="ORF18"
                     /locus_tag="HHV8GK18_gp22"
                     /db_xref="GeneID:4961499"
     CDS             32523..33296
                     /gene="ORF18"
                     /locus_tag="HHV8GK18_gp22"
                     /note="related to HHV-5 UL79"
                     /codon_start=1
                     /product="ORF18"
                     /protein_id="YP_001129371.1"
                     /db_xref="GeneID:4961499"
                     /translation="MLGKYVCETEPLSPGLRRLMWRFLQNKNLNTFHAQELRFIHLVL
                     CKMYNFGLNVYLLREATANAGTYDEVVLGRKVPAEVWKLVYDGLEEMGVSSEMLLCEA
                     YRDSLWMHLNDKVGLLRGLANYLFHRLGVTHDVRIAPENLVDGNFLFNLGSVLPCRLL
                     LAAGYCLAFWGSDEHERWVRFFAQKLFICYLIVSGRLMPQRSLLVWASETGYPGPVEA
                     VCRDIRSMYGIRTYAVSGYLPAPSEAQLAYLGAFNNNAV"
     misc_feature    32526..33287
                     /gene="ORF18"
                     /locus_tag="HHV8GK18_gp22"
                     /note="UL79 family; Region: Herpes_UL79; pfam03049"
                     /db_xref="CDD:281098"
     gene            complement(32967..35483)
                     /gene="ORF20"
                     /locus_tag="HHV8GK18_gp23"
                     /db_xref="GeneID:4961477"
     gene            complement(32967..34942)
                     /gene="ORF19"
                     /locus_tag="HHV8GK18_gp24"
                     /db_xref="GeneID:4961508"
     regulatory      complement(32967..32972)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF19, ORF20"
     CDS             complement(33293..34942)
                     /gene="ORF19"
                     /locus_tag="HHV8GK18_gp24"
                     /note="putative portal-capping protein; herpesvirus core
                     gene UL25 family"
                     /codon_start=1
                     /product="ORF19"
                     /protein_id="YP_001129372.1"
                     /db_xref="GeneID:4961508"
                     /translation="MLTSERSYLRYPKNRRWTEAGRFWAPHPENVLFIHKPTMEETRR
                     VALGLRSQLVRNRERKTKAHLLSLELDRLVQVHDSRVRVINADIDAVKQMIGNMTWSD
                     NIDMPQSRSHEPPLVTSPPQASHRNFTVAIVPGDPHFSVDRDLRGELMPTLYMNQNQW
                     LPSFGPWFISLTDNAMQRRVFPKELKGTVNFQNSTSLKLISHTLTTVASTTADFFADA
                     RHLTDTQAALCLVNAYFCQKTSRQLPATPDDLLADLPQKLDLLITQLKQESGPGDFSF
                     TYSNPQERASLAPLNKESRYPTAFFQRHKLHAMMAKAGLFPHNKGTGAPGTAPAMDLV
                     FAITSAMFGSDIPPFSAYQWNLRAGIVALEVFILAYGLLEFGQVARGHPNRRLNLVSL
                     LGPKFQPGALPDPNAPMLKRGQLFSFISEHYIIPTLQANPNAPVSFIFPGIILAALEA
                     RSTVSHKQPGPFVNLTGSRFNEIFEILNQQLTFRDPLALLQARTALRLATEEGLDVLL
                     SHPSPPTLLQEIIKSQFGGGDDYDRAYFMVLGCLPVVLAVV"
     misc_feature    complement(33362..34879)
                     /gene="ORF19"
                     /locus_tag="HHV8GK18_gp24"
                     /note="Herpesvirus UL25 family; Region: Herpes_UL25;
                     pfam01499"
                     /db_xref="CDD:396196"
     regulatory      33530..33535
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF18"
                     /locus_tag="HHV8GK18_gp22"
     CDS             complement(34710..35483)
                     /gene="ORF20"
                     /locus_tag="HHV8GK18_gp23"
                     /note="nuclear protein; herpesvirus core gene UL24 family"
                     /codon_start=1
                     /product="ORF20"
                     /protein_id="YP_001129373.1"
                     /db_xref="GeneID:4961477"
                     /translation="MVRPTEAEVKKSLSRLPAARKRAGNRAHLATYRRLLKYSTLPDL
                     WRFLSSRPQNPPLGHHRLFFEVTLGHRIADCVILVSGGHQPVCYVVELKTCLSHQLIP
                     TNTVRTSQRAQGLCQLSDSIHYIAHSAPPGTEAWTITPLLIFKNQKTLKTVYSESPGA
                     FPTPVHTTEGKLCAFLTARENADIRKVLSKVPKKPKMDRGGKILGPTPGKRAVYSQAH
                     HGRNKKGRPWTAQPTRAKSRTKDKGTPAFPRAGPACSGP"
     misc_feature    complement(34923..35441)
                     /gene="ORF20"
                     /locus_tag="HHV8GK18_gp23"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; pfam01646"
                     /db_xref="CDD:307668"
     misc_feature    35181..73829
                     /note="insert in cos4"
     gene            35482..39416
                     /gene="ORF21"
                     /locus_tag="HHV8GK18_gp25"
                     /db_xref="GeneID:4961484"
     CDS             35482..37224
                     /gene="ORF21"
                     /locus_tag="HHV8GK18_gp25"
                     /note="thymidine kinase; herpesvirus core gene UL23
                     family"
                     /codon_start=1
                     /product="ORF21"
                     /protein_id="YP_001129374.1"
                     /db_xref="GeneID:4961484"
                     /translation="MAEGGFGADSVGRGGEKASVTRGGRWDLGSSDDESSTSTTSTDM
                     DDLPEERKPLTGKSVKTSYIYDVPTVPTSKPWHLMHDNSLYATPRFPPRPLIRHPSEK
                     GSIFASRLSATDDDSGDYAPMDRFAFQSPRVCGRPPLPPPNHPPPATRPADASMGDVG
                     WADLQGLKRTPKGFLKTSTKGGSLKARGRDVGDRLRDGGFAFSPRGVKSAIGQNIKSW
                     LGIGESSATAVPVTTQLMVPVHLIRTPVTVDYRNVYLLYLEGVMGVGKSTLVNAVCGI
                     LPQERVTSFPEPMVYWTRAFTDCYKEISHLMKSGKAGDPLTSAKIYSCQNKFSLPFRT
                     NATAILRMMQPWNVGGGSGRGTHWCVFDRHLLSPAVVFPLMHLKHGRLSFDHFFQLLS
                     IFRATEGDVVAILTLSSAESLRRVRARGRKNDGTVEQNYIRELAWAYHAVYCSWIMLQ
                     YITVEQMVQLCVQTTNIPEICFRSVRLAHKEETLKNLHEQSMLPMITGVLDPVRHHPV
                     VIELCFCFFTELRKLQFIVADADKFHDDVCGLWTEIYRQILSNPAIKPRAINWPALES
                     QSKAVNHLEETCRV"
     misc_feature    35620..37212
                     /gene="ORF21"
                     /locus_tag="HHV8GK18_gp25"
                     /note="thymidine kinase; Provisional; Region: PHA03132"
                     /db_xref="CDD:222997"
     gene            37212..39416
                     /gene="ORF22"
                     /locus_tag="HHV8GK18_gp26"
                     /db_xref="GeneID:4961506"
     CDS             37212..39404
                     /gene="ORF22"
                     /locus_tag="HHV8GK18_gp26"
                     /note="envelope glycoprotein gH; herpesvirus core gene
                     UL22 family"
                     /codon_start=1
                     /product="ORF22"
                     /protein_id="YP_001129375.1"
                     /db_xref="GeneID:4961506"
                     /translation="MQGLAFLAALACWRCISLTCGATGALPTTATTITRSATQLINGR
                     TNLSIELEFNGTSFFLNWQNLLNVITEPALTELWTSAEVAEDLRVTLKKRQSLFFPNK
                     TVVISGDGHRYTCEVPTSSQTYNITKGFNYSALPGHLGGFGINARLVLGDIFASKWSL
                     FARDTPEYRVFYPMNVMAVKFSISIGNNESGVALYGVVSEDFVVVTLHNRSKEANETA
                     SHLLFGLPDSLPSLKGHATYDELTFARNAKYALVAILPKDSYQTLLTENYTRIFLNMT
                     ESTPLEFTRTIQTRIVSIEARRACAAQEAAPDIFLVLFQMLVAHFLVARGIAEHRFVE
                     VDCVCRQYAELYFLRRISRLCMPTFTTVGYNHTTLGAVAATQIARVSATKLASLPRSS
                     QETVLAMVQLGARDGAVPSSILEGIAMVVEHMYTAYTYVYTLGDTERKLMLDIHTVLT
                     DSCPPKDSGVSEKLLRTYLMFTSMCTNIELGEMIARFSKPDSLNIYRAFSPCFLGLRY
                     DLHPAKLRAEAPQSSALTRTAVARGTSGFAELLHALHLDSLNLIPAINCSKITADKII
                     ATVPLPHVTYIISSEALSNAVVYEVSEIFLKSAMFISAIKPDCSGFNFSQIDRHIPIV
                     YNISTPRRGCPLCDSVIMSYDESDGLQSLMYVTNERVQTNLFLDKSPFFDNNNLHIHY
                     LWLRDNGTVVEIRGMYRRRAASALFLILSFIGFSGVIYFLYRLFSILY"
     misc_feature    37371..38852
                     /gene="ORF22"
                     /locus_tag="HHV8GK18_gp26"
                     /note="Herpesvirus glycoprotein H main domain; Region:
                     Herpes_glycop_H; pfam02489"
                     /db_xref="CDD:396858"
     misc_feature    38871..39299
                     /gene="ORF22"
                     /locus_tag="HHV8GK18_gp26"
                     /note="Herpesvirus glycoprotein H C-terminal domain;
                     Region: Herpes_glycoH_C; pfam17488"
                     /db_xref="CDD:407519"
     gene            complement(39397..42877)
                     /gene="ORF24"
                     /locus_tag="HHV8GK18_gp27"
                     /db_xref="GeneID:4961485"
     gene            complement(39397..40615)
                     /gene="ORF23"
                     /locus_tag="HHV8GK18_gp28"
                     /db_xref="GeneID:4961503"
     regulatory      complement(39397..39402)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF23, ORF24"
     CDS             complement(39401..40615)
                     /gene="ORF23"
                     /locus_tag="HHV8GK18_gp28"
                     /note="tegument protein; herpesvirus core gene UL21
                     family"
                     /codon_start=1
                     /product="ORF23"
                     /protein_id="YP_001129376.1"
                     /db_xref="GeneID:4961503"
                     /translation="MLRVPDVKASLVEGAARLSTGERVFHVLTSPAVAAMVGVSNPEV
                     PMPLLFEKFGTPDSSTLPLYAARHPELSLLRIMLSPHPYALRSHLCVGEETASLGVYL
                     HSKPVVRGHEFEDTQILPECRLAITSDQSYTNFKIIDLPAGCRRVPIHAANKRVVIDE
                     AANRIKVFDPESPLPRHPITPRAGQTRSILKHNIAQVCERDIVSLNTDNEAASMFYMI
                     GLRRPRLGESPVCDFNTVTIMERANNSITFLPKLKLNRLQHLFLKHVLLRSMGLENIV
                     SCFSSLYGAELAPAKTHEREFFGALLERLKRRVEDAVFCLNTIEDFPFREPIRQPPDC
                     SKVLIEAMEKYFMMCSPKDRQSAAWLGAGVVELICDGNPLSEVLGFLAKYMPIQKECT
                     GNLLKIYALLTV"
     misc_feature    complement(39404..40615)
                     /gene="ORF23"
                     /locus_tag="HHV8GK18_gp28"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03148"
                     /db_xref="CDD:223001"
     regulatory      39411..39416
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF21, ORF22"
     CDS             complement(40619..42877)
                     /gene="ORF24"
                     /locus_tag="HHV8GK18_gp27"
                     /note="related to HHV-5 UL87"
                     /codon_start=1
                     /product="ORF24"
                     /protein_id="YP_001129377.1"
                     /db_xref="GeneID:4961485"
                     /translation="MAALEGPLLLPPSASLTTSPQTTCYQATWESQLEIFCCLATNSH
                     LQAELTLEGLDKMMQPEPTFFACRAIRRLLLGERLHPFIHQEGTLLGKVGRRYSGEGL
                     IIDGGGVFTRGQIDTDNYLPAVGSWELTDDCDKPCEFRELRSLYLPALLTCTICYKAM
                     FRIVCRYLEFWEFEQCFHAFLAVLPHSLQPTIYQNYFALLESLKHLSFSIMPPASPDA
                     QLHFLKFNISSFMATWGWHGELVSLRRAIAHNVERLPTVLKNLSKQSKHQDVKVNGRD
                     LVGFQLALNQLVSRLHVKIQRKDPGPKPYRVVVSTPDCTYYLVYPGTPAIYRLVMCMA
                     VADCIGHSCSGLHPCANFLGTHETPRLLAATLSRIRYAPKDRRAAMKGNLQACFQRYA
                     ATDARTLGSSTVSDMLEPTKHVSLENFKITIFNTNMVINTKISCHVPNTLQKTILNIP
                     RLTNNFVIRKYSVKEPSFTISVFFSDNMCQGTAININISGDMLHFLFAMGTLKCFLPI
                     RHIFPVSIANWNSTLDLHGLENQYMVRMGRKNVFWTTNFPSVVSSKDGLNVSWFKAAT
                     ATISKVYGQPLVEQIRHELAPILTDQHARIDGNKNRIFSLLEHRNRSQIQTLHKRFLE
                     CLVECCSFLRLDVACIRRAAARGLFDFSKKIISHTKSKHECAVLGYKKCNLIPKIYAR
                     NKKTRLDELGRNANFISFVATTGHRFAALKPQIVRHAIRKLGLHWRHRTAASNEQTPP
                     ADPRVRCVRPLV"
     misc_feature    complement(40661..42838)
                     /gene="ORF24"
                     /locus_tag="HHV8GK18_gp27"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03374"
                     /db_xref="CDD:223063"
     gene            42876..48846
                     /gene="ORF25"
                     /locus_tag="HHV8GK18_gp29"
                     /db_xref="GeneID:4961452"
     CDS             42876..47006
                     /gene="ORF25"
                     /locus_tag="HHV8GK18_gp29"
                     /note="major capsid protein; herpesvirus core gene UL19
                     family"
                     /codon_start=1
                     /product="ORF25"
                     /protein_id="YP_001129378.1"
                     /db_xref="GeneID:4961452"
                     /translation="MEATLEQRPFPYLATEANLLTQIKESAADGLFKSFQLLLGKDAR
                     EGSVRFEALLGVYTNVVEFVKFLETALAAACVNTEFKDLRRMIDGKIQFKISMPTIAH
                     GDGRRPNKQRQYIVMKACNKHHIGAEIELAAADIELLFAEKETPLDFTEYAGAIKTIT
                     SALQFGMDALERGLVDTVLAVKLRHAPPVFILKTLGDPVYSERGLKKAVKSDMVSMFK
                     AHLIEHSFFLDKAELMTRGKQYVLTMLSDMLAAVCEDTVFKGVSTYTTASGQQVAGVL
                     ETTDSVMRRLMNLLGQVESAMSGPAAYASYVVRGANLVTAVSYGRAMRNFEQFMARIV
                     DHPNALPSVEGDKAALADGHDEIQRTRIAASLVKIGDKFVAIESLQRMYNETQFPCPL
                     NRRIQYTYFFPVGLHLPVPRYSTSVSVRGVESPAIQSTETWVVNKNNVPLCFGYQNAL
                     KSICHPRMHNPTQSAQALNQAFPDPDGGHGYGLRYEQTPNMNLFRTFHQYYMGKNVAF
                     VPDVAQKALVTTEDLLHPTSHRLLRLEVHPFFDFFVHPCPGARGSYRATHRTMVGNIP
                     QPLAPREFQESRGAQFDAVTNMTHVIDQLTIDVIQETAFDPAYPLFCYVIEAMIHGQE
                     EKFVMNMPLIALVIQTYWVNSGKLAFVNSYHMVRFICTHMGNGSIPKEAHGHYRKILG
                     ELIALEQALLKLAGHETVGRTPITHLVSALLDPHLLPPFAYHDVFTDLMQKSSRQPII
                     KIGDQNYDNPQNRATFINLRGRMEDLVNNLVNIYQTRVNEDHDERHVLDVAPLDENDY
                     NPVLEKLFYYVLMPVCSNGHMCGMGVDYQNVALTLTYNGPVFADVVNAQDDILLHLEN
                     GTLKDILQAGDIRPTVDMIRVLCTSFLTCPFVTQAARVITKRDPAQSFATHEYGKDVA
                     QTVLVNGFGAFAVADRSREAAETMFYPVPFNKLYADPLVAATLHPLLANYVTRLPNQR
                     NAVVFNVPSNLMAEYEEWHKSPVAAYAASCQATPGAISAMVSMHQKLSAPSFICQAKH
                     RMHPGFAMTVVRTDEVLAEHILYCSRASTSMFVGLPSVVRREVRSDAVTFEITHEIAS
                     LHTALGYSSVIAPAHVAAITTDMGVHCQDLFMIFPGDAYQDRQLHDYIKMKAGVQTGS
                     PGNRMDHVGYTAGVPRCENLPGLSHGQLATCEIIPTPVTSDVAYFQTPSNPRGRAACV
                     VSCDAYSNESAERLLYDHSIPDPAYECRSTNNPWASQRGSLGDVLYNITFRQTALPGM
                     YSPCRQFFHKEDIMRYNRGLYTLVNEYSARLAGAPATSTTDLQYVVVNGTDVFLDQPC
                     HMLQEAYPTLAASHRVMLDEYMSNKQTHAPVHMGQYLIEEVAPMKRLLKLGNKVVY"
     misc_feature    42912..46979
                     /gene="ORF25"
                     /locus_tag="HHV8GK18_gp29"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:397301"
     gene            47032..48846
                     /gene="ORF26"
                     /locus_tag="HHV8GK18_gp30"
                     /db_xref="GeneID:4961509"
     CDS             47032..47949
                     /gene="ORF26"
                     /locus_tag="HHV8GK18_gp30"
                     /note="capsid triplex protein; herpesvirus core gene UL18
                     family"
                     /codon_start=1
                     /product="ORF26"
                     /protein_id="YP_001129379.1"
                     /db_xref="GeneID:4961509"
                     /translation="MALDKSIVVNFTSRLFADELAALQSKIGSVLPLGDCHRLQNIQA
                     LGLGCVCSRETSPDYIQIMQYLSKCTLAVLEEVRPDSLRLTRMDPSDNLQIKNVYAPF
                     FQWDSNTQLAVLPPFFSRKDSTIVLESNGFDLVFPMVVPQQLGHAILQQLLVYHIYSK
                     ISAGAPDDVNMAELDLYTTNVSFMGRTYRLDVDNTDPRTALRVLDDLSMYLCILSALV
                     PRGCLRLLTALVRHDRHPLTEVFEGVVPDEVTRIDLDQLSVPDDITRMRVMFSYLQSL
                     SSIFNLGPRLHVYAYSAETLAASCWYSPR"
     misc_feature    47032..47943
                     /gene="ORF26"
                     /locus_tag="HHV8GK18_gp30"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03258"
                     /db_xref="CDD:165516"
     gene            47973..48846
                     /gene="ORF27"
                     /locus_tag="HHV8GK18_gp31"
                     /db_xref="GeneID:4961487"
     CDS             47973..48845
                     /gene="ORF27"
                     /locus_tag="HHV8GK18_gp31"
                     /codon_start=1
                     /product="ORF27"
                     /protein_id="YP_001129380.1"
                     /db_xref="GeneID:4961487"
                     /translation="MASSDILSVARTDDGSVCEVSLRGGRKKTTVYLPDTEPWVVETD
                     AIKDAFLSDGIVDMARKLHRGALPSNSHNGLRMVLFCYCYLQNCVYLALFLCPLNPYL
                     VTPSSIEFAEPVVAPEVLFPHPAEMSRGCDDAIFCKLPYTVPIINTTFGRIYPNSTRE
                     PDGRPTDYSMALRRAFAVMVNTSCAGVTLCRGETQTASRNHTEWENLLAMFSVIIYAL
                     DHNCHPEALSIASGIFDERDYGLFISQPRSVPSPTPCDVSWEDIYNGTYLARPGNCDP
                     WPNLSTPPLILNFK"
     misc_feature    47973..48842
                     /gene="ORF27"
                     /locus_tag="HHV8GK18_gp31"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03147"
                     /db_xref="CDD:165418"
     misc_feature    48627..89886
                     /note="insert in cos19"
     regulatory      48841..48846
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF25, ORF26, ORF27"
     gene            49091..49399
                     /gene="ORF28"
                     /locus_tag="HHV8GK18_gp32"
                     /db_xref="GeneID:4961507"
     CDS             49091..49399
                     /gene="ORF28"
                     /locus_tag="HHV8GK18_gp32"
                     /note="membrane protein"
                     /codon_start=1
                     /product="ORF28"
                     /protein_id="YP_001129381.1"
                     /db_xref="GeneID:4961507"
                     /translation="MSMTSPSPVTGGMVDGSVLVRMATKPPVIGLITVLFLLVIGACV
                     YCCIRVFLAARLWRATPLGRATVAYQVLRTLGPQAGSHAPPTVGIATQEPYRTIYMPD
                     "
     gene            complement(49461..54775)
                     /gene="ORF29"
                     /locus_tag="HHV8GK18_gp33"
                     /db_xref="GeneID:4961443"
     regulatory      complement(49461..49466)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF29"
                     /locus_tag="HHV8GK18_gp33"
     CDS             complement(join(49462..50604,53855..54775))
                     /gene="ORF29"
                     /locus_tag="HHV8GK18_gp33"
                     /note="putative ATPase subunit of terminase; herpesvirus
                     core gene UL15 family"
                     /codon_start=1
                     /product="ORF29"
                     /protein_id="YP_001129382.1"
                     /db_xref="GeneID:4961443"
                     /translation="MLLSRHRERLAANLQETAKDAGERWELSAPTFTRHCPKTARMAH
                     PFIGVVHRINSYSSVLETYCTRHHPATPTSANPDVGTPRPSEDNVPAKPRLLESLSTY
                     LQMRCVREDAHVSTADQLVEYQAARKTHDSLHACSVYRELQAFLVNLSSFLNGCYVPG
                     VHWLEPFQQQLVMHTFFFLVSIKAPQKTHQLFGLFKQYFGLFETPNSVLQTFKQKASV
                     FLIPRRHGKTWIVVAIISMLLASVENINIGYVAHQKHVANSVFAEIIKTLCRWFPPKN
                     LNIKKENGTIIYTRPGGRSSSLMCATCFNKNSIRGQTFNLLYVDEANFIKKDALPAIL
                     GFMLQKDAKLIFISSVNSSDRSTSFLLNLRNAQEKMLNVVSYVCADHREDFHLQDALV
                     SCPCYRLHIPTYITIDESIKTTTNLFMEGAFDTELMGEGAASSNATLYRVVGDAALTQ
                     FDMCRVDTTAQQVQKCLGKQLFVYIDPAYTNNTEASGTGVGAVVTSTQTPTRSLILGM
                     EHFFLRDLTGAAAYEIASCACTMIKAIAVLHPTIERVNAAVEGNSSQDSGVAIATVLN
                     EICPLPIHFLHYTDKSSALQWPIYMLGGEKSSAFETFIYALNSGTLSASQTVVSNTIK
                     ISFDPVTYLVEQVRAIKCVPLRDGGQSYSAKQKHMSDDLLVAVVMAHFMATDDRHMYK
                     PISPQ"
     misc_feature    complement(join(50596..50604,53855..54655))
                     /gene="ORF29"
                     /locus_tag="HHV8GK18_gp33"
                     /note="Probable DNA packing protein, N-terminus; Region:
                     DNA_pack_N; pfam02500"
                     /db_xref="CDD:280634"
     misc_feature    complement(49480..50517)
                     /gene="ORF29"
                     /locus_tag="HHV8GK18_gp33"
                     /note="Probable DNA packing protein, C-terminus; Region:
                     DNA_pack_C; pfam02499"
                     /db_xref="CDD:280633"
     gene            50723..54176
                     /gene="ORF30"
                     /locus_tag="HHV8GK18_gp34"
                     /db_xref="GeneID:4961433"
     CDS             50723..50956
                     /gene="ORF30"
                     /locus_tag="HHV8GK18_gp34"
                     /note="related to HHV-5 UL91"
                     /codon_start=1
                     /product="ORF30"
                     /protein_id="YP_001129383.1"
                     /db_xref="GeneID:4961433"
                     /translation="MGEPVDPGHVVNEKDFEECEQFFSQPLREQVVAGVRALDGLGLA
                     DSLCHKTERLCLLMDLVGTECFARVCRLDTGAK"
     misc_feature    50750..50914
                     /gene="ORF30"
                     /locus_tag="HHV8GK18_gp34"
                     /note="Protein of unknown function (DUF717); Region:
                     DUF717; pfam05338"
                     /db_xref="CDD:283089"
     gene            50953..54176
                     /gene="ORF31"
                     /locus_tag="HHV8GK18_gp35"
                     /db_xref="GeneID:4961498"
     CDS             50953..51537
                     /gene="ORF31"
                     /locus_tag="HHV8GK18_gp35"
                     /note="related to HHV-5 UL92"
                     /codon_start=1
                     /product="ORF31"
                     /protein_id="YP_001129384.1"
                     /db_xref="GeneID:4961498"
                     /translation="MKSVASPLCQFHGVFCLYQCRQCLAYHVCDGGAECVLLHTPESV
                     ICELTGNCMLGNIQEGQFLGPVPYRTLDNQVDRDAYHGMLACLKRDIVRYLQTWPDTT
                     VIVQEIALGDGVTDTISAIIDETFGECLPVLGEAQGGYALVCSMYLHVIVSIYSTKTV
                     YNSMLFKCTKNKKYDCIAKRVRTKWMRMLSTKDT"
     misc_feature    50953..51516
                     /gene="ORF31"
                     /locus_tag="HHV8GK18_gp35"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     gene            51504..54176
                     /gene="ORF32"
                     /locus_tag="HHV8GK18_gp36"
                     /db_xref="GeneID:4961479"
     CDS             51504..52868
                     /gene="ORF32"
                     /locus_tag="HHV8GK18_gp36"
                     /function="DNA packaging"
                     /note="tegument protein; herpesvirus core gene UL17
                     family"
                     /codon_start=1
                     /product="ORF32"
                     /protein_id="YP_001129385.1"
                     /db_xref="GeneID:4961479"
                     /translation="MDAHAINERYVGPRCHRLAHVVLPRTFLLHHAIPLEPEIIFSTY
                     TRFSRSPGSSRRLVVCGKRVLPGEENQLASSPSGLALSLPLFSHDGNFHPFDISVLRI
                     SCPGSNLSLTVRFLYLSLVVAMGAGRNNARSPTVDGVSPPEGAVAHPLEELQRLARAT
                     PDPALTRGPLQVLTGLLRAGSDGDRATHHMALEAPGTVRGESLDPPVSQKGPARTRHR
                     PPPVRLSFNPVNADVPATWRDATNVYSGAPYYVCVYERGGRQEDDWLPIPLSFPEEPV
                     PPPPGLVFMDDLFINTKQCDFVDTLEAACRTQGYTLRQRVPVAIPRDAEIADAVKSHF
                     LEACLVLRGLASEASAWIRAATSPPLGRHACWMDVLGLWESRPHTLGLELRGVNCGGT
                     DGDWLEILKQPDVQKTVSGSLVACVIVTPALEAWLVLPGGFAIKGRYRASKEDLVFIR
                     GRYG"
     misc_feature    51504..52826
                     /gene="ORF32"
                     /locus_tag="HHV8GK18_gp36"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:398316"
     gene            52861..54176
                     /gene="ORF33"
                     /locus_tag="HHV8GK18_gp37"
                     /db_xref="GeneID:4961502"
     CDS             52861..53865
                     /gene="ORF33"
                     /locus_tag="HHV8GK18_gp37"
                     /note="tegument protein; herpesvirus core gene UL16
                     family"
                     /codon_start=1
                     /product="ORF33"
                     /protein_id="YP_001129386.1"
                     /db_xref="GeneID:4961502"
                     /translation="MASRRRKLRNFLNKECIWTVNPMSGDHIKVFNACTSISPVYDPE
                     LVTSYALSVPAYNVSVAILLHKVMGPCVAVGINGEMIMYVVSQCVSVRPVPGRDGMAL
                     IYFGQFLEEASGLRFPYIAPPPSREHVPDLTRQELVHTSQVVRRGDLTNCTMGLEFRN
                     VNPFVWLGGGSVWLLFLGVDYMAFCPGVDGMPSLARVAALLTRCDHPDCVHCHGLRGH
                     VNVFRGYCSAQSPGLSNICPCIKSCGTGNGVTRVTGNRNFLGLLFDPIVQSRVTALKI
                     TSHPTPTHVENVLTGVLDDGTLVPSSKAPWVLLRMSDYFSRLLIYECKKLKALGLRSY
                     "
     misc_feature    52876..53841
                     /gene="ORF33"
                     /locus_tag="HHV8GK18_gp37"
                     /note="Herpesvirus UL16/UL94 family; Region: Herpes_UL16;
                     pfam03044"
                     /db_xref="CDD:281094"
     regulatory      54171..54176
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF30, ORF31, ORF32, ORF33"
     gene            54635..58974
                     /gene="ORF34"
                     /locus_tag="HHV8GK18_gp38"
                     /db_xref="GeneID:4961504"
     regulatory      54635..54640
                     /regulatory_class="TATA_box"
                     /gene="ORF34"
                     /locus_tag="HHV8GK18_gp38"
     mRNA            54665..58974
                     /gene="ORF34"
                     /locus_tag="HHV8GK18_gp38"
                     /db_xref="GeneID:4961504"
     CDS             54774..55757
                     /gene="ORF34"
                     /locus_tag="HHV8GK18_gp38"
                     /note="related to HHV-5 UL95"
                     /codon_start=1
                     /product="ORF34"
                     /protein_id="YP_001129387.1"
                     /db_xref="GeneID:4961504"
                     /translation="MFALSSLVSEGDPEVTSRYVKGVQLALDLSENTPGQFKLIETPL
                     NSFLLVSNVMPEVQPICSGLPALRPDFSNLHLPRLEKLQRVLGQGFGAAGEEIALDPS
                     HVETHEKGQVFYNHYATEEWTWALTLNKDALLREAVDGLCDPGTWKGLLPDDPLPLLW
                     LLFNGPASFCRADCCLYKQHCGYPGPVLLPGHMYAPKRDLLSFVNHALKYTKFLYGDF
                     SGTWAAACRPPFATSRIQRVVSQMKIIDASDTYISHTCLLCHIYQQNSIIAGQGTHVG
                     GILLLSGKGTQYITGNVQTQRCPTTGDYLIIPSYDIPAIITMIKENGLNQL"
     misc_feature    54774..55742
                     /gene="ORF34"
                     /locus_tag="HHV8GK18_gp38"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            55635..58974
                     /gene="ORF35"
                     /locus_tag="HHV8GK18_gp39"
                     /db_xref="GeneID:4961512"
     regulatory      55635..55640
                     /regulatory_class="TATA_box"
                     /gene="ORF35"
                     /locus_tag="HHV8GK18_gp39"
     mRNA            55666..58974
                     /gene="ORF35"
                     /locus_tag="HHV8GK18_gp39"
                     /db_xref="GeneID:4961512"
     CDS             55738..56190
                     /gene="ORF35"
                     /locus_tag="HHV8GK18_gp39"
                     /note="tegument protein; herpesvirus core gene UL14
                     family"
                     /codon_start=1
                     /product="ORF35"
                     /protein_id="YP_001129388.1"
                     /db_xref="GeneID:4961512"
                     /translation="MDSTNSKREFIKSALEANINRRAAVSLFDRFGGSSAVFEKQFQD
                     AQHAVRAHGALKREAELGTLVRKAGQRFEALKRERSILRQPRDLPRVADIDALVDAVA
                     DLKEEVAVRLDALEENGEETPTHSSSEIKDTIVRWRLDDLPPVCPETP"
     misc_feature    55747..56178
                     /gene="ORF35"
                     /locus_tag="HHV8GK18_gp39"
                     /note="Gammaherpesvirus protein of unknown function
                     (DUF848); Region: DUF848; pfam05852"
                     /db_xref="CDD:283504"
     gene            56075..58974
                     /gene="ORF36"
                     /locus_tag="HHV8GK18_gp40"
                     /db_xref="GeneID:4961434"
     CDS             56075..57409
                     /gene="ORF36"
                     /locus_tag="HHV8GK18_gp40"
                     /note="serine-threonine protein kinase; herpesvirus core
                     gene UL13 family"
                     /codon_start=1
                     /product="ORF36"
                     /protein_id="YP_001129389.1"
                     /db_xref="GeneID:4961434"
                     /translation="MRWKRMERRPPLTPLRRSRTQSSGGGLTICPRCALKLPKATRIS
                     ERPWASTWQLNQHIQVSKTKKATAYLKAPREWGQCTHQDPDWSKRLGRGAFGIIVPIS
                     EDLCVKQFDSRREFFYEAIANDLMQATRERYPMHSGGSRLLGFVQPCIPCRSIVYPRM
                     KCNLLQLDWSQVNLSVMAAEFTGLMAAVSFLNRYCGMVHCDVSPDNILATGDLTPMNP
                     GRLVLTDFGSVALHSGSKWTNLVVTSNLGFKQHCYDFRVPPKLICKHLYKPSCVLFQC
                     YLSSLGKMHAQVLDQPYPISPNMGLTIDMSSLGYTLLTCLELYLDLPLNNPLKFLGSA
                     TRDGRPEPMYYLGFMIPRVVMTQILSAVWTMTLDLGLDCTGKAQAIPMRQEHQLAFQK
                     QCYLYKANQKAESLANCSDKLNCPMLKSLVRKLLERDFFNHGGHPHTRGLVF"
     misc_feature    56336..>56803
                     /gene="ORF36"
                     /locus_tag="HHV8GK18_gp40"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:419665"
     misc_feature    order(56342..56356,56366..56368,56396..56398,56444..56446,
                     56492..56494,56543..56554,56561..56563,56567..56572,
                     56675..56677,56681..56683,56687..56692,56696..56698,
                     56747..56749,56756..56758,56786..56788,56792..56803)
                     /gene="ORF36"
                     /locus_tag="HHV8GK18_gp40"
                     /note="active site"
                     /db_xref="CDD:270870"
     misc_feature    order(56342..56353,56366..56368,56396..56398,56492..56494,
                     56543..56554,56561..56563,56570..56572,56687..56692,
                     56696..56698,56747..56749)
                     /gene="ORF36"
                     /locus_tag="HHV8GK18_gp40"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    order(56444..56446,56567..56569,56675..56677,56681..56683,
                     56756..56758,56786..56788,56792..56803)
                     /gene="ORF36"
                     /locus_tag="HHV8GK18_gp40"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    order(56744..56776,56783..56803)
                     /gene="ORF36"
                     /locus_tag="HHV8GK18_gp40"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:270870"
     gene            57372..58974
                     /gene="ORF37"
                     /locus_tag="HHV8GK18_gp41"
                     /db_xref="GeneID:4961483"
     CDS             57372..58832
                     /gene="ORF37"
                     /locus_tag="HHV8GK18_gp41"
                     /function="host shutoff"
                     /note="deoxyribonuclease; herpesvirus core gene UL12
                     family; SOX"
                     /codon_start=1
                     /product="ORF37"
                     /protein_id="YP_001129390.1"
                     /db_xref="GeneID:4961483"
                     /translation="MEATPTPADLFSEDYLVDTLDGLTVDDQQAVLASLSFSKFLKHA
                     KVRDWCAQAKIQPSMPALRMAYNYFLFSKVGEFIGSEDVCNFFVDRVFGGVRLLDVAS
                     VYAACSQMNAHQRHHICCLVERATSSQSLNPVWDALRDGIISSSKFHWAVKQQNTSKK
                     IFSPWPITNNHFVAGPLAFGLRCEEVVKTLLATLLHPDEANCLDYGFMQSPQNGIFGV
                     SLDFAANVKTDTEGRLQFDPNCKVYEIKCRFKYTFAKMECDPIYAAYQRLYEAPGKLA
                     LKDFFYSISKPAVEYVGLGKLPSESDYLVAYDQEWEACPRKKRKLTPLHNLIRECILH
                     NSTTESDVYVLTDPQDTRGQISIKARFKANLFVNVRHSYFYQVLLQSSIVEEYIGLDS
                     GIPRLGSPKYYIATGFFRKRGYQDPVNCTIGGDALDPHVEIPTLLIVTPVYFPRGAKH
                     RLLHQAANFWSRSAKDTFPYIKWDFSYLSANVPHSP"
     misc_feature    57450..58805
                     /gene="ORF37"
                     /locus_tag="HHV8GK18_gp41"
                     /note="Herpesvirus alkaline exonuclease; Region:
                     Herpes_alk_exo; pfam01771"
                     /db_xref="CDD:280025"
     gene            58787..58974
                     /gene="ORF38"
                     /locus_tag="HHV8GK18_gp42"
                     /db_xref="GeneID:4961435"
     CDS             58787..58972
                     /gene="ORF38"
                     /locus_tag="HHV8GK18_gp42"
                     /note="myristylated tegument protein anchored in envelope;
                     herpesvirus core gene UL11 family"
                     /codon_start=1
                     /product="ORF38"
                     /protein_id="YP_001129391.1"
                     /db_xref="GeneID:4961435"
                     /translation="MGFLLSICKRPSQPVDVDGEPLDVVVDYDPIRVSEKGMLLEQSQ
                     SPYPALKKKKKNKEAIY"
     misc_feature    58787..58879
                     /gene="ORF38"
                     /locus_tag="HHV8GK18_gp42"
                     /note="Protein of unknown function (DUF2733); Region:
                     DUF2733; pfam10813"
                     /db_xref="CDD:287750"
     regulatory      58952..58957
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF34, ORF35, ORF36, ORF37, ORF38"
     polyA_site      58974
                     /note="ORF34, ORF35, ORF36, ORF37, ORF38"
     gene            complement(59000..60274)
                     /gene="ORF39"
                     /locus_tag="HHV8GK18_gp43"
                     /db_xref="GeneID:4961437"
     regulatory      complement(59000..59005)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF39"
                     /locus_tag="HHV8GK18_gp43"
     CDS             complement(59072..60274)
                     /gene="ORF39"
                     /locus_tag="HHV8GK18_gp43"
                     /note="envelope glycoprotein gM; herpesvirus core gene
                     UL10 family"
                     /codon_start=1
                     /product="ORF39"
                     /protein_id="YP_001129392.1"
                     /db_xref="GeneID:4961437"
                     /translation="MRASKSDRFLMSSWVKLLFVAVIMYICSAVVPMAATYEGLGFPC
                     YFNNLVNYSALNLTVRNSAKHLTPTLFLEKPEMLVYIFWTFIVDGIAIVYYCLAAVAV
                     YRAKHVHATTMMSMQSWIALLGSHSVLYVAILRMWSMQLFIHVLSYKHVLMAAFVYCI
                     HFCISFAHIQSLITCNSAQWEIPLLEQHVPDNTMMESLLTRWKPVCVNLYLSTTALEM
                     LLFSLSTMMAVGNSFYVLVSDAIFGAVNMFLALTVVWYINTEFFLVKFMRRQVGFYVG
                     VFVGYLILLLPVIRYENAFVQANLHYIVAINISCIPILCILAIVIRVIRSDWGLCTPS
                     AAYMPLATSAPTVDRTPTVHQKPPPLPAKTRARAKVKDISTPAPRTQYQSDHESDSEI
                     DETQMIFI"
     misc_feature    complement(59297..60274)
                     /gene="ORF39"
                     /locus_tag="HHV8GK18_gp43"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     cl28128"
                     /db_xref="CDD:332949"
     gene            60407..62644
                     /gene="ORF40"
                     /locus_tag="HHV8GK18_gp44"
                     /db_xref="GeneID:4961438"
     CDS             join(60407..61756,61884..62543)
                     /gene="ORF40"
                     /locus_tag="HHV8GK18_gp44"
                     /note="subunit of helicase-primase complex; herpesvirus
                     core gene UL8 family"
                     /codon_start=1
                     /product="ORF40"
                     /protein_id="YP_001129393.1"
                     /db_xref="GeneID:4961438"
                     /translation="MATSEETAAGYVIGVYFHSVHVHCRIIVWQVNFLPLDPNDGETE
                     CYFVVDTLTKEAMERMPEIQECVPSITEHARDLAIWELALRLQNQTIVKAVRTASLPV
                     VLIMTVGRIVNDVIPCPNVRTPRPLACAYLHCEATVTFEVPLTGPAASTGTWHSSIYR
                     ECAISAIEICLKTSRGIYSCQSNEAPEAKREKRGLDISDVFVCLTYDIPIAGRVLSLL
                     VPHAPAFHVLWINEDSKWNGAAVEFFRALHHKLFSERNGIPPLWLYVFPGAVEEGTAF
                     APLLPAFPCIPLRYGSPTSLDRASVQWDLFEPHILTHFDGIKRTSLADTVFGYDSLAI
                     SRECEDQYVWPTPVTDININLCTDSDTMAIVREPSGLVAVNLEALLRTDSVLSRVSSI
                     VSLDTLLDLSTPECRRSVELRYNSLLSTVLSWSTSRGHKWAAIVKWKLFFLVQALEPE
                     QWSPEFKDLKRACQMAGFTLKGGTSGDLVFSSHANLLFSTSMGYFLHAGSPRSTAGTG
                     GEPNPRHITGPDTEGNGEHRNSPNLCGFVTWLQSLTTCIERALNMPPDTSWLQLIEEV
                     IPLYFHRRRQTSFWLIPLSHCEGIPVCPPLPFDCLAPRLFIVTKSGPMCYRAGFSLPV
                     DVNYLFYLEQTLKAVRQVSPQEHNPQDAKEMTLQLEAWTRLLSLF"
     misc_feature    60413..61756
                     /gene="ORF40"
                     /locus_tag="HHV8GK18_gp44"
                     /note="Herpesvirus DNA helicase/primase complex associated
                     protein; Region: Herpes_HEPA; cl28610"
                     /db_xref="CDD:391819"
     misc_feature    62148..62540
                     /gene="ORF40"
                     /locus_tag="HHV8GK18_gp44"
                     /note="Herpesvirus helicase-primase complex component;
                     Region: Herpes_heli_pri; pfam05774"
                     /db_xref="CDD:283441"
     gene            complement(62534..65052)
                     /gene="ORF43"
                     /locus_tag="HHV8GK18_gp45"
                     /db_xref="GeneID:4961497"
     gene            complement(62534..63371)
                     /gene="ORF42"
                     /locus_tag="HHV8GK18_gp46"
                     /db_xref="GeneID:4961440"
     regulatory      complement(62534..62639)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF42, ORF43"
     CDS             complement(62535..63371)
                     /gene="ORF42"
                     /locus_tag="HHV8GK18_gp46"
                     /note="tegument protein; herpesvirus core gene UL7 family"
                     /codon_start=1
                     /product="ORF42"
                     /protein_id="YP_001129394.1"
                     /db_xref="GeneID:4961440"
                     /translation="MSLERALARLTGVPMSTHAPKTRESEEACPVYPHPVVPRLVLEV
                     HRKNNALVGSNTPKMSVMGHLDIACLREHVKSRLSSPNFVGFTVVCLVEHEDMVTHID
                     LHPHVFQERVCLLRPTSPGITELCCLLSMLENCRDMSPTFLRSIICRARKTHERTPGM
                     DAAFVMHGIETLTATAAFVYELSVDDHFRATPLVMFKLHKAIGDASTPMGGLMKPIYL
                     ESFKLESSGENEDDKQTCADPVNIFYCDTIFTKHLENNEVLKYLKMCTLFKPPIVSLF
                     SK"
     misc_feature    complement(62637..63254)
                     /gene="ORF42"
                     /locus_tag="HHV8GK18_gp46"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7;
                     pfam01677"
                     /db_xref="CDD:279943"
     regulatory      62639..62644
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF40"
                     /locus_tag="HHV8GK18_gp44"
     CDS             complement(63235..65052)
                     /gene="ORF43"
                     /locus_tag="HHV8GK18_gp45"
                     /note="portal protein; herpesvirus core gene UL6 family"
                     /codon_start=1
                     /product="ORF43"
                     /protein_id="YP_001129395.1"
                     /db_xref="GeneID:4961497"
                     /translation="MLRMNPGLGSSISVHPSELSISLFEILQGKYSYVRGQTLHCSLR
                     NPGVFFRQLFIHLYKNALANCSYDHVLSDWRTYESSAKTRWPEKEAQWGSYRRSTFDS
                     WAQTMRMTLDHLLLNAINRVLYAKTQLSYERYVDWVVTVGMVPVVKHTPDHKLVNSIQ
                     EQLMKDCQRLASGEKTIGRILTSVTQEISNLVSSLSALYIPGYSEVSIDYDCVKNTFV
                     GLYKQKRVHVEVITMPAILAGRVIFDSPIQRMYTSIMSCHRTAEHAKLCQLLNTAPTK
                     ALVGSACNNVYKDIMTHLEQASQRTDPKRELLNLLMKLAENKTVSGVTDVVEDFVTDV
                     SQNIVDKNKLFGTGQETTTQGLRRQVSNSVFKCLTNQINEQFDTITQLEKERELCMKR
                     LKCIETQLSHQQPGDAKGPGSVNLLTANTFQSLGRLQDPSLQLTSSHIPSGSAVLNSF
                     FSSYIPPVRESMKDLTNLWESEMFQTYKLAPVVDNQGQRLSVTYSQDTISILLGPFTY
                     VIADLLQMELISHSFVSSSLQDIAAYLYQTSRLFVYITDVGQKYCLVTPPFENVPGKG
                     PGETDWSANEYSCPEDSRVRRGLSRIPPPCGAPPCPGSA"
     misc_feature    complement(63397..64986)
                     /gene="ORF43"
                     /locus_tag="HHV8GK18_gp45"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:396361"
     gene            64991..67399
                     /gene="ORF44"
                     /locus_tag="HHV8GK18_gp47"
                     /db_xref="GeneID:4961457"
     CDS             64991..67357
                     /gene="ORF44"
                     /locus_tag="HHV8GK18_gp47"
                     /note="helicase subunit of helicase-primase complex;
                     herpesvirus core gene UL5 family"
                     /codon_start=1
                     /product="ORF44"
                     /protein_id="YP_001129396.1"
                     /db_xref="GeneID:4961457"
                     /translation="MDSSEGCTDMDEPSPGFILNMTSDAKVRSVVEQIDRLSNITTSP
                     PEMGWYDLEFDPLEDEGPFLPFSAYVITGTAGAGKSTSVSALHQNLNCLITGATVVAA
                     QNLSRALKSYCPTIYHAFGFKSRHINICQRKVPKVTQSSIEQLQRYELARYWPTVTDI
                     IREFMRKKQKGQYSSLSQSAFRLLCRMGGANLWTSNIIVIDEAGTLSSHILTAVVFFY
                     WFYNSWLDTPLYRNGAVPCIVCVGSPTQTDAFQSVFNHTQQRNEISACDNVLTFLLGK
                     REVADYIRLDENWALFINNKRCTDPQFGHLLKTLEYNLDISPELMDYIDRFVVPKSKI
                     LDPLEYAGWTRLFISHQEVKSFLATLHTCLSSNKDAVSTKLFTCPVVCEVFTEPFEEY
                     KRAVGLTHMTPIEWVTKNLFRLSNYSQFADQDMAVVGTYITDASTQITFATKFVKNSY
                     ATLTGKTKKCICGFHGSYQRFKSILDGELFIESHSHDNPAYVYSFLSTLLYNAMYSFY
                     AHGVKQGHEEFLRDLRELPVSQELISEMSSEDVLGQEGDTDAFYLTASLPPSPTHAAL
                     PTLVAYYSGAKELFCNRLALARRHFGDEFLHSDFSTFTVNIVVRDGVDFVSTSPGLHG
                     LVAYASTIDTYIIQGYTFLPVRFGRPGGQRLSEDLRRKMPSIVVQDSSGFIACLENNV
                     TKMTETLEGGDVFNICCAGDYGISSNLAMTIVKAQGVSLSRVAISFGNHRNIRASLVY
                     VGVSRAIDARYLVMDSNPLKLMDRGDAQSPSSKYIIKALCNPKTTLIY"
     misc_feature    65024..67354
                     /gene="ORF44"
                     /locus_tag="HHV8GK18_gp47"
                     /note="Helicase; Region: Herpes_Helicase; pfam02689"
                     /db_xref="CDD:280797"
     regulatory      67394..67399
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF44"
                     /locus_tag="HHV8GK18_gp47"
     gene            complement(67444..71480)
                     /gene="ORF48"
                     /locus_tag="HHV8GK18_gp48"
                     /db_xref="GeneID:4961458"
     gene            complement(67444..70014)
                     /gene="ORF47"
                     /locus_tag="HHV8GK18_gp49"
                     /db_xref="GeneID:4961475"
     gene            complement(67444..69503)
                     /gene="ORF46"
                     /locus_tag="HHV8GK18_gp50"
                     /db_xref="GeneID:4961472"
     gene            complement(67444..68675)
                     /gene="ORF45"
                     /locus_tag="HHV8GK18_gp51"
                     /db_xref="GeneID:4961474"
     regulatory      67444..67449
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF45, ORF46, ORF47, ORF48"
     CDS             complement(67452..68675)
                     /gene="ORF45"
                     /locus_tag="HHV8GK18_gp51"
                     /function="inhibition of IRF-7"
                     /note="virion phosphoprotein"
                     /codon_start=1
                     /product="ORF45"
                     /protein_id="YP_001129397.1"
                     /db_xref="GeneID:4961474"
                     /translation="MAMFVRTSSSTHDEERMLPIEGAPRRRPPVKFIFPPPPLSSLPG
                     FGRPRGYAGPTVIDMSAPDDVFAEDTPSPPATPLDLQISPDQSSGESEYDEDEEDEDE
                     EENDDVQEEDEPEGYPADFFQPLSHLRPRPLARRAHTPKPVAVVAGRVRSSTDTAESE
                     ASMGWVSQDDGFSPAGLSPSDDEGVAILEPMAAYTGTGAYGLSPASRNSVPGTQSSPY
                     SDPDEGPSWRPLRAAPTAIVDLTSDSDSDDSSNSPDVNNEAAFTDARHFSHQPPSSEE
                     DGEDQGEVLSQRIGLMDVGQKRKRQSTASSGSEDVVRCQRQPNLSRKAVASVIIISSG
                     SDTDEEPSSAVSVIVSPSSTKGHLPTQSPSTSAHSISSGSTTTAGSRCSDPTRILAST
                     PPLCGNGAYNWPWLD"
     CDS             complement(68736..69503)
                     /gene="ORF46"
                     /locus_tag="HHV8GK18_gp50"
                     /note="uracil-DNA glycosylase; herpesvirus core gene UL2
                     family"
                     /codon_start=1
                     /product="ORF46"
                     /protein_id="YP_001129398.1"
                     /db_xref="GeneID:4961472"
                     /translation="MDAWLQQTVFRGTLSISQGVDDRDLLLAPKWISFLSLSSFLKQK
                     LLSLLRQIRELRLTTTVYPPQDKLMWWSHCCDPEDIKVVILGQDPYHKGQATGLAFSV
                     DPQCQVPPSLRSIFRELEASVPNFSTPSHGCLDSWARQGVLLLNTVLTVEKGRAGSHE
                     GLGWDWFTSFIISSISSKLEHCVFLLWGRKAIDRTPLINAQKHLVLTAQHPSPLASLG
                     GRHSRWPRFQGCNHFNLANDYLTRHRRETVDWGLLEQ"
     misc_feature    complement(68745..69503)
                     /gene="ORF46"
                     /locus_tag="HHV8GK18_gp50"
                     /note="uracil-DNA glycosylases (UDG) and related enzymes;
                     Region: UDG-like; cl00483"
                     /db_xref="CDD:412404"
     misc_feature    complement(order(68856..68870,68874..68879,68934..68936,
                     68940..68942,69066..69068,69165..69167,69234..69248))
                     /gene="ORF46"
                     /locus_tag="HHV8GK18_gp50"
                     /note="active site"
                     /db_xref="CDD:381678"
     misc_feature    complement(order(68874..68876,69066..69068,69234..69248))
                     /gene="ORF46"
                     /locus_tag="HHV8GK18_gp50"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:381678"
     misc_feature    complement(69234..69248)
                     /gene="ORF46"
                     /locus_tag="HHV8GK18_gp50"
                     /note="motif A [structural motif]; Region: motif A"
                     /db_xref="CDD:381678"
     CDS             complement(69511..70014)
                     /gene="ORF47"
                     /locus_tag="HHV8GK18_gp49"
                     /note="envelope glycoprotein gL; herpesvirus core gene UL1
                     family"
                     /codon_start=1
                     /product="ORF47"
                     /protein_id="YP_001129399.1"
                     /db_xref="GeneID:4961475"
                     /translation="MGIFALFAVLWTTLLVTSHAYVALPCCAIQASAASTLPLFFAVH
                     SIHFADPNHCNGVCIAKLRSKTGDITVETCVNGFNLRSFLVAVVRRLGSWASQENLRL
                     LWYLQRSLTAYTVGFNATTADSSIHNVNIIIISVGKAMNRTGSVSGSQTRAKSSSRRA
                     HAGQKGK"
     misc_feature    complement(69658..69939)
                     /gene="ORF47"
                     /locus_tag="HHV8GK18_gp49"
                     /note="Viral glycoprotein L; Region: Phage_glycop_gL;
                     pfam11108"
                     /db_xref="CDD:371377"
     CDS             complement(70272..71480)
                     /gene="ORF48"
                     /locus_tag="HHV8GK18_gp48"
                     /codon_start=1
                     /product="ORF48"
                     /protein_id="YP_001129400.1"
                     /db_xref="GeneID:4961458"
                     /translation="MEVCIPIPGIGDENCESWRAQIVAFGTTSGFVKTERILRGLFPE
                     RGHPGFLASLVVLKHTLASPGGLNTRLNLLPVLQMLKYVGQEMYMRAKCQATASDMTL
                     IWDDCKDRFMLILEQACGCHQCMTVVEEITHCSAISAPPSSLSHGRHILSAGLINFAR
                     RQVLLGGSVSFSEFSIPDLIQTPEQYPFVDVEFRRELSLISSCLNVCWLYHIFIEHIT
                     SDVRRLESCMASVLEEYGGLSPTRPWAEAVTFLSQLPRPTRKPWKELSVSRINVEARL
                     LDTLVMQLEKPVPVEIIKHALAILGTAGHVWNPEHQLACPDTRTCRERVSKGPCVGDG
                     DVTLVHTARMDISNPSSVSPDGDVHYSGPPRTPAYGVVLECADDSDDSLDDFLENLSQ
                     TCDSSDDEYD"
     misc_feature    complement(70797..71480)
                     /gene="ORF48"
                     /locus_tag="HHV8GK18_gp48"
                     /note="Herpesvirus protein of unknown function (DUF832);
                     Region: DUF832; pfam05734"
                     /db_xref="CDD:283407"
     gene            71695..76818
                     /gene="ORF50"
                     /locus_tag="HHV8GK18_gp52"
                     /db_xref="GeneID:4961526"
     CDS             join(71695..71712,72671..74728)
                     /gene="ORF50"
                     /locus_tag="HHV8GK18_gp52"
                     /function="induces switch from latent to lytic infection"
                     /note="transactivator; RTA"
                     /codon_start=1
                     /product="ORF50"
                     /protein_id="YP_001129401.1"
                     /db_xref="GeneID:4961526"
                     /translation="MAQDDKGKKLRRSCVESFVGLSDELKAQLYQCVLLINDAYETIY
                     DPSDLNRVVEDVCIRIMKECSKLGALCGLFTDINMFNLFCFFRASRMRTKGAAGYNVP
                     CAEASQGIIRILTERILFCTEKAFLTAACSGVSLPPAICKLLHEIYTEMKAKCLGAWR
                     RLVCNRRPIMILTSSLLKLYNTYDTAGLLSEQSRALCLLVFQPVYLPRIMAPLEIMTK
                     GQLAPENFYSITGSAEKRRPITTGKVTGLSYPGSGLMPESLILPILEPGLLPASMVDL
                     SDVLAKPAVILSAPALSQFVISKPHPNMPHTVSIIPFNPSGTDPAFISTWQAASQNMV
                     YNTSTAPLKPATGSSQTVSVKAVAQGAVITATTVPQAMPARGTGGELPVMSASTPARD
                     QVAACFVAENTGDSPDNPSSFLTSCHPCDPNTVIVAQQFQPPQCVTLLQVTCAPSSTP
                     PPDSTVRAPVVQLPTVVPLPASAFLPALAQPEASGEELPGGHDGDQGVPCRDSTAAAT
                     AAEATTPKRKQRSKERSSKKRKALTVPEADTTPSTTTPGTSLGSITTPQDVHATDVAT
                     SEGPSEAQPPLLSLPPPLDVDQSLFALLDEAGPETWDVGSPLSPTDDALLSSILQGLY
                     QLDTPPPLRSPSPASFGPESPADIPSPSGGEYTQLQPVRATSATPANEVQESGTLYQL
                     HQWRNYFRD"
     misc_feature    72905..74605
                     /gene="ORF50"
                     /locus_tag="HHV8GK18_gp52"
                     /note="Herpesvirus transcription activation factor
                     (transactivator); Region: Herpes_TAF50; pfam03326"
                     /db_xref="CDD:308764"
     gene            complement(71728..72637)
                     /gene="ORF49"
                     /locus_tag="HHV8GK18_gp53"
                     /db_xref="GeneID:4961448"
     regulatory      complement(71728..71733)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF49"
                     /locus_tag="HHV8GK18_gp53"
     CDS             complement(71729..72637)
                     /gene="ORF49"
                     /locus_tag="HHV8GK18_gp53"
                     /codon_start=1
                     /product="ORF49"
                     /protein_id="YP_001129402.1"
                     /db_xref="GeneID:4961448"
                     /translation="MTSRRPLKDHLFNHLFRYHYPSWDQILQELDTLSVATLNPDCHV
                     PALNVEKTLYLAKTIQILVQHRQSEPYLVPAARANLAYSLQQLYKLGNDKIRGVINGM
                     LPLVDAGCIGFERELIKGLPRVLTLQYPHTAPLESEPPTADCTEWCLSHFVGASGRLR
                     SEVRDILTTHNGTCAPSFQWMASVVKKFFLVETVIYEDFQDTDFNVQLNLCFFWTAVV
                     QMYQRCIYEQKLVHIISTSLTLLKSTARSFFAWYDLYRPNLGSAALVKYTEHLIRALT
                     PDCSDVELGELCSHLHHCKHALFSIQ"
     misc_feature    complement(71741..72586)
                     /gene="ORF49"
                     /locus_tag="HHV8GK18_gp53"
                     /note="BRRF1-like protein; Region: Herpes_BBRF1;
                     pfam04793"
                     /db_xref="CDD:368123"
     misc_feature    74411..116152
                     /note="insert in cos32"
     gene            74949..76818
                     /gene="K8"
                     /locus_tag="HHV8GK18_gp54"
                     /db_xref="GeneID:4961462"
     CDS             join(74949..75662,75744..75890)
                     /gene="K8"
                     /locus_tag="HHV8GK18_gp54"
                     /function="switch from latent to lytic infection
                     (putative)"
                     /note="bZIP transcription factor"
                     /codon_start=1
                     /product="K8"
                     /protein_id="YP_001129403.1"
                     /db_xref="GeneID:4961462"
                     /translation="MPRMKDIPTKSSPGTDNSEKDEAVIEEDLSLNGQPFFTDNTDGG
                     ENEVSWTSSLLSTYVGCQPPAIPVCETVIDLTAPSQSGAPGDEHLPCSLNAETKFHIP
                     DPSWTLSHTPPRGPHISQQLPTRRSKRRLHRKFEEERLCTKAKQGAGRPVPASVVKVG
                     NITPHYGEELTRGDAVPAAPITPPYPRVQRPAQPTHVLFSPVFVSLKAEVCDQSHSPT
                     RKQGRYGRVSSKAYTRQLQQALEEKDAQLCFLAARLEAHKEQIIFLRDMLMRMCQQPA
                     SPTDAPLPPC"
     misc_feature    74949..75662
                     /gene="K8"
                     /locus_tag="HHV8GK18_gp54"
                     /note="Kaposi's sarcoma-associated herpesvirus (KSHV) K8
                     protein; Region: KSHV_K8; pfam07188"
                     /db_xref="CDD:284577"
     gene            76014..76818
                     /gene="K8.1"
                     /locus_tag="HHV8GK18_gp55"
                     /db_xref="GeneID:4961469"
     CDS             join(76014..76437,76532..76794)
                     /gene="K8.1"
                     /locus_tag="HHV8GK18_gp55"
                     /note="envelope glycoprotein; ORF51"
                     /codon_start=1
                     /product="K8.1"
                     /protein_id="YP_001129404.1"
                     /db_xref="GeneID:4961469"
                     /translation="MSSTQIRTEIPVALLILCLCLVACHANCPTYRSHLGFWQEGWSG
                     QVYQDWLGRMNCSYENMTALEAVSLNGTRLAAGSPSSEYPNVSVSVEDTSASGSGEDA
                     IDESGSGEEERPVTSHVTFMTQSVQATTELTDALISAFSGSYSSGEPSRTTRIRVSPV
                     AENGRNSGASNRVPFSATTTTTRGRDAHYNAEIRTHLYILWAVGLLLGLVLILYLCVP
                     RCRRKKPYIV"
     variation       76723..76796
                     /gene="K8.1"
                     /locus_tag="HHV8GK18_gp55"
                     /note="74 bp deleted in cos19 and cos32, and also in the
                     majority of DNA from the original biopsy; this disrupts
                     the transmembrane anchor domain of the K8.1 protein;
                     sequence shown as wild type (undeleted)"
                     /replace=""
     regulatory      76813..76818
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF50, K8, K8.1"
     gene            complement(76823..77296)
                     /gene="ORF52"
                     /locus_tag="HHV8GK18_gp56"
                     /db_xref="GeneID:4961496"
     regulatory      complement(76823..76828)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF52"
                     /locus_tag="HHV8GK18_gp56"
     CDS             complement(76901..77296)
                     /gene="ORF52"
                     /locus_tag="HHV8GK18_gp56"
                     /codon_start=1
                     /product="ORF52"
                     /protein_id="YP_001129405.1"
                     /db_xref="GeneID:4961496"
                     /translation="MAAPRGRPKKDLTMEDLTAKISQLTVENRELRKALGSTADPRDR
                     PLTATEKEAQLTATVGALSAAAAKKIEARVRTIFSKVVTQKQVDDALKGLSLRIDVCM
                     SDGGTAKPPPGANNRRRRGASTTRAGVDD"
     misc_feature    complement(76919..77266)
                     /gene="ORF52"
                     /locus_tag="HHV8GK18_gp56"
                     /note="Herpesvirus BLRF2 protein; Region: Herpes_BLRF2;
                     pfam05812"
                     /db_xref="CDD:283470"
     gene            complement(77377..77764)
                     /gene="ORF53"
                     /locus_tag="HHV8GK18_gp57"
                     /db_xref="GeneID:4961468"
     regulatory      complement(77377..77382)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF53"
                     /locus_tag="HHV8GK18_gp57"
     CDS             complement(77432..77764)
                     /gene="ORF53"
                     /locus_tag="HHV8GK18_gp57"
                     /note="envelope glycoprotein gN; herpesvirus core gene
                     UL49A family"
                     /codon_start=1
                     /product="ORF53"
                     /protein_id="YP_001129406.1"
                     /db_xref="GeneID:4961468"
                     /translation="MTASTVALALFVASILGHCWVTANSTGVASSTERSSPSTAGLSA
                     RPSPGPTSVTTPGFYDVACSADSFSPSLSSFSSVWALINALLVVVATFFYLVYLCFFK
                     FVDEVVHA"
     misc_feature    complement(77441..77680)
                     /gene="ORF53"
                     /locus_tag="HHV8GK18_gp57"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            77835..78792
                     /gene="ORF54"
                     /locus_tag="HHV8GK18_gp58"
                     /db_xref="GeneID:4961459"
     CDS             77835..78722
                     /gene="ORF54"
                     /locus_tag="HHV8GK18_gp58"
                     /note="deoxyuridine triphosphatase; herpesvirus core gene
                     UL50 family"
                     /codon_start=1
                     /product="ORF54"
                     /protein_id="YP_001129407.1"
                     /db_xref="GeneID:4961459"
                     /translation="MQSDSAPLPRVEYVFETSKFRMTSRANEARLRLTNECPILVRPH
                     EPFIMPTGIHFTRTPSCAFILTGETDKDVFCHTGLIDGGYRGEIQVILLNKRKYPVTL
                     YRGELNICLSAFNYVLPPLRDVSFLTPPMYANDAGFDVMVMHSMVIPPTTDQPFMIYL
                     GVETPGPPEPHVALALGRSGLASRGIVIDVSEWGPRGLQLKFYNYSGQPWLAQPGSRI
                     CQIVFVERRHILKGFKKCLRHRKLAPGVRFREARVHFREDTNSVRKHTHEDNPVHEPN
                     VATASADIRGTKGLGSSGF"
     misc_feature    77844..78719
                     /gene="ORF54"
                     /locus_tag="HHV8GK18_gp58"
                     /note="dUTPase; Provisional; Region: PHA03131"
                     /db_xref="CDD:222996"
     regulatory      78787..78792
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF54"
                     /locus_tag="HHV8GK18_gp58"
     gene            complement(78818..79547)
                     /gene="ORF55"
                     /locus_tag="HHV8GK18_gp59"
                     /db_xref="GeneID:4961432"
     regulatory      complement(78818..78823)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="ORF55"
                     /locus_tag="HHV8GK18_gp59"
     CDS             complement(78864..79547)
                     /gene="ORF55"
                     /locus_tag="HHV8GK18_gp59"
                     /note="tegument protein; herpesvirus core gene UL51
                     family"
                     /codon_start=1
                     /product="ORF55"
                     /protein_id="YP_001129408.1"
                     /db_xref="GeneID:4961432"
                     /translation="MSSPWYTWTCCGINLFGRGNHAYKRLGDPLEGCPERWRQEIDLG
                     LPPGVCLGDVVQSNLGTTALHQTYLLAVQSNKITDYLKRFDVAKIPAGCQETVKTQVK
                     KLQSIQNVVWNTMLALAVGEITVDDSALQSLLNKRAGECVSLMEMEKLATAMASDDSV
                     IWASEISHSLSEPTSVLPLTPAVTRQPEATLPKPPTEDPSVSAMHSSIPPRPSSTLEE
                     TTESAIGST"
     misc_feature    complement(78939..79547)
                     /gene="ORF55"
                     /locus_tag="HHV8GK18_gp59"
                     /note="Herpes virus U44 protein; Region: Herpes_U44;
                     pfam04533"
                     /db_xref="CDD:282401"
     gene            79535..83713
                     /gene="ORF56"
                     /locus_tag="HHV8GK18_gp60"
                     /db_xref="GeneID:4961445"
     CDS             79535..82066
                     /gene="ORF56"
                     /locus_tag="HHV8GK18_gp60"
                     /note="primase subunit of helicase-primase complex;
                     herpesvirus core gene UL52 family"
                     /codon_start=1
                     /product="ORF56"
                     /protein_id="YP_001129409.1"
                     /db_xref="GeneID:4961445"
                     /translation="METTYRREALTVRVIFCTSGDSAETIADVLTGAPTSASFFSVLH
                     DLFYSQILAPRVTLKLCLPARRPGNGTRCSPVLVLRTDASVASGFLGGRPLEASDIKY
                     MLLSDQTAGLFKPLLEIIGGARAPPNQDACTFQSQVAWLRTKFVTALRKLYKMTPSPY
                     WMLSAFGAQEAQFVLTSSFYFFEHTVVCTTETVSHLSRLFSPQQGQTLVSVTSHEELG
                     QLYGTSPFRRRVPAFVAYVKEKLARDSLETEAIDRTIDQIRGKLMLSNQDLVHFIYIS
                     FYQCLNKRAFLRYSRQTSSSSALRELGEDPQLCGALHGEFRDHVQSYYHKKTYLSTYI
                     DIRYVGGVLPDGYFGGSLVGERCVYWCGQSKDTASLLATISQQVPHLRLQNEFAGMLD
                     VAALRGSDDGQFKEGLFSHSQALPLYRCEFLGKQFFTMLQEDGLERYWEQSVIFPGDQ
                     DWDMLSDKDLTYRIFYHDLSLSLPTLKEQLLVSRHEYFNPRLPVYRWVLDFDLPVCRD
                     IDRTFEEVHSLCCSLREAILDIIQLLGPVDPRTHPVYFFKSACPPDEWRGEDVASTSF
                     CRCHDKLGMRIIVPFPEGVCVVGSEPMVALTGILNRTIKLDPELVHRFPSIQKKGGPF
                     DCGIYGRGRSVRLPHCYKVGLVGELCRLLKILVCHPAPNGKAQYVRRAFTLRELLHHS
                     PGHSAGHVGRIIYSIMDRNENFLENKTISYLPAKIPHIFQRIETLSGRSIEDWLHSAV
                     WDKAYDTICKFFPDEKAQQFSHVAFTQQGENIIQLRPRQGRHFLCINHNHKNKSKTVR
                     VFLTLHSIRVSEVTVTLMSQCFASKCNNNVPTAHFSFVVPVGLAS"
     misc_feature    79550..82060
                     /gene="ORF56"
                     /locus_tag="HHV8GK18_gp60"
                     /note="helicase-primase primase subunit BSLF1;
                     Provisional; Region: PHA03142"
                     /db_xref="CDD:222999"
     gene            82169..83713
                     /gene="ORF57"
                     /locus_tag="HHV8GK18_gp61"
                     /db_xref="GeneID:4961525"
     CDS             join(82169..82217,82326..83644)
                     /gene="ORF57"
                     /locus_tag="HHV8GK18_gp61"
                     /note="post-transcriptional regulator; herpesvirus core
                     gene UL54 family"
                     /codon_start=1
                     /product="ORF57"
                     /protein_id="YP_001129410.1"
                     /db_xref="GeneID:4961525"
                     /translation="MVQAMIDMDIMKGILEDSVSSSEFDESRDDETDAPTLEDEQLSE
                     PAEPPADERIRGTQSAQGIPPPLGRIPKKSQGRSQLRSEIQFCSPLSRPRSPSPVNRY
                     GKKIKFGTAGQNTRPPPEKRPRRRPRDRLQYGRTTRGGQCRAAPKRATRRPQVNCQRQ
                     DDDVRQGVSDAVKKLRLPASMIIDGESPRFDDSIIPRHHGACFNVFIPAPPSHVPEVF
                     TDRDITALIRAGGKDDELINKKISAKKIDHLHRQMLSFVTSRHNQAYWVSCRRETAAA
                     GGLQTLGAFVEEQMTWAQTVVRHGGWFDEKDIDIILDTAIFVCNAFVTRFRLLHLSCV
                     FDKQSELALIKQVAYLVAMGNRLVEACNLLGEVKLNFRGGLLLAFVLTIPGMQSRRSI
                     SARGQELFRTLLEYYRPGDVMGLLNVIVMEHHSLCRNSECAAATRAAMGSAKFNKGLF
                     FYPLS"
     misc_feature    82982..83635
                     /gene="ORF57"
                     /locus_tag="HHV8GK18_gp61"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; pfam05459"
                     /db_xref="CDD:398881"
     regulatory      83708..83713
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF56, ORF57"
     gene            complement(83887..85415)
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
                     /db_xref="GeneID:4961464"
     mRNA            complement(83887..85388)
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
                     /db_xref="GeneID:4961464"
     polyA_site      complement(83887)
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
     regulatory      complement(83903..83908)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
     CDS             complement(83960..85309)
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
                     /note="interferon regulatory factor"
                     /codon_start=1
                     /product="K9"
                     /protein_id="YP_001129411.1"
                     /db_xref="GeneID:4961464"
                     /translation="MDPGQRPNPFGAPGAIPKKPCLSQGSPGTSGSGAPCDEPSRSES
                     PGEGPSGTGGSAAAGDITRQAVVAAITEWSRTRQLRISTGASEGKASIKDWIVCQVNS
                     GKFPGVEWEDEERTRFRIPVTPLADPCFEWRRDGELGVVYIRERGNMPVDASFKGTRG
                     RRRMLAALRRTRGLQEIGKGISQDGHHFLVFRVRKPEEEQCVECGVVAGAVHDFNNMA
                     RLLQEGFFSPGQCLPGEIVTPVPSCTTAEGQEAVIDWGRLFIRMYYNGEQVHELLTTS
                     QSGCRISSALRRDPAVHYCAVGSPGQVWLPNVPNLACEIAKRELCDTLDACAKGILLT
                     SSCNGIFCVCYHNGPVHFIGNTVPPDSGPLLLPQGKPTRIFNPNTFLVGLANSPLPAP
                     SHVTCPLVKLWLGKPVAVGKLEPHAPSPRDFAARCSNFSDACVVLEIMPKPLWDAMQ"
     misc_feature    complement(84722..85039)
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
                     /note="interferon regulatory factor; Region: IRF;
                     smart00348"
                     /db_xref="CDD:128642"
     misc_feature    complement(order(84803..84805,84812..84817,84821..84823,
                     84938..84940))
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
                     /note="DNA sequence recognition sites [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238051"
     misc_feature    complement(order(84788..84790,84797..84799,84803..84808))
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
                     /note="metal-binding site"
                     /db_xref="CDD:238051"
     misc_feature    complement(<84152..84541)
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
                     /note="Interferon-regulatory factor 3; Region: IRF-3;
                     pfam10401"
                     /db_xref="CDD:402154"
     regulatory      complement(85410..85415)
                     /regulatory_class="TATA_box"
                     /gene="vIRF-1"
                     /locus_tag="HHV8GK18_gp62"
     gene            complement(86106..89172)
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
                     /db_xref="GeneID:4961495"
     mRNA            complement(join(86106..88442,88544..89142))
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
                     /db_xref="GeneID:4961495"
     mRNA            complement(join(86106..88442,88544..89040))
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
                     /db_xref="GeneID:4961495"
     polyA_site      complement(86106)
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
     regulatory      complement(86125..86130)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
     CDS             complement(join(86174..88442,88544..89010))
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
                     /note="interferon regulatory factor"
                     /codon_start=1
                     /product="vIRF-4"
                     /protein_id="YP_001129412.1"
                     /db_xref="GeneID:4961495"
                     /translation="MPKAGGSEWATLWIIDALENNKFPYFSWFDRNNLLFAAPAPLPA
                     GSDIPPGWYSVYHAFDEECDRVYGPSPVVGQTVYGRFGRLLRGTRRAVVRNDLRYSDT
                     FGGSYVVWQLVRTPFKNCTYCYGAAYGPEKLQRFIQCLLSPPMQTTATRRSDTREQSY
                     EEAGAAAPAPPKAPSGLRGRPRKSNRYYNVGDITTEQKAACSVWIPVNEGASTSGMGS
                     SGTRQVTQASSFTWRVPGDPPAPSTLTGPSDPHSSGAGLPGTAPPKPQHETRLAGTVS
                     GVSGVAQTPGDTGQLAPPMRDGSRLPSTSPWIPACFPWGDLPVTGWWPQGASGLPEKV
                     HPPTTGQFDPLSPRWTYTGIPSSQLNPAAPSWIPPHAQAGTFVGEFSQGAPLAPQGLL
                     PQSGQCASAWLPRRETGAEGACGASTEGRAPQGAASERVYPFEPQPPSAPAPGYAKPS
                     CYNWSPLAEPPATRPIRAPVWHPPVGHAVVPEVRTPLWIPWSSGGAPNQGLSHTQGGA
                     SATPSAGAPPTPEVAERQEPSSSGIPYVCQGDNMATGYRRVTTSSGALEVEIIDLTGD
                     SDTPSTTVASTPLPVSGPRVFQPTVLYSAPEPAVNPEVSHLPTELERRECVCPGSGER
                     PRVPLVSTYAGDRYAVGGYGPEQSLVPPPLGLPLTLSNLQGEDICTWEEGLGNILSEL
                     QEEPSSSTRQATDRRRPRSRSPHGRRTPVSHSGPEKPPSKMFFDPPDSQRVSFVVEIF
                     VYGNLRGTLRREGDAGEAMLCSWPVGDTLGHLCQSFVPELLRIPRLTVPSPEQMEILN
                     RVFEGLGHGFPIFCSMSGIYSRNATQVEGWWFGNPNSRYERILRSFSPRVPQQLFNTA
                     RYLATTAAIPQTPLSVNPVTCGTVFFGASPASTENFQNVPLTVKIFIGSIWDSLH"
     misc_feature    complement(87008..>88216)
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     regulatory      complement(89066..89071)
                     /regulatory_class="TATA_box"
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
     regulatory      complement(89167..89172)
                     /regulatory_class="TATA_box"
                     /gene="vIRF-4"
                     /locus_tag="HHV8GK18_gp63"
     gene            complement(89473..91512)
                     /gene="vIRF-3"
                     /locus_tag="HHV8GK18_gp64"
                     /db_xref="GeneID:4961493"
     mRNA            complement(join(89473..90945,91042..91512))
                     /gene="vIRF-3"
                     /locus_tag="HHV8GK18_gp64"
                     /db_xref="GeneID:4961493"
     polyA_site      complement(89473)
                     /gene="vIRF-3"
                     /locus_tag="HHV8GK18_gp64"
     regulatory      complement(89487..89492)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="vIRF-3"
                     /locus_tag="HHV8GK18_gp64"
     CDS             complement(join(89700..90945,91042..91496))
                     /gene="vIRF-3"
                     /locus_tag="HHV8GK18_gp64"
                     /note="interferon regulatory factor"
                     /codon_start=1
                     /product="vIRF-3"
                     /protein_id="YP_001129413.1"
                     /db_xref="GeneID:4961493"
                     /translation="MAGRRLTWISEFIVGALDSDKYPLVKWLDRSTGTFLAPAARNDV
                     IPLDSLQFFIDFKRECLSKGLHPRDLLGSPITAFGKICTTSRRLRRLPGEEYEVVQGI
                     NCRRWRLLCAEVKECWWCVHARTHLHSGSSLWEILYQHSVRLEKHRRRPRPFVGENSD
                     SSEEDHPAFCDVPVTQTGAESEDSGDEGPSTRHSASGVQPVDDANADSPGSGDEGPST
                     RHSDSQPPPADETTVHTDNVEDDLTLLDKESACALMYHVGQEMDMLMRAMCDEDLFDL
                     LGIPEDVIATSQPGGDTDASGVVTEGSIAASAVGAGVEDVYLAGALEAQNVAGEYVLE
                     ISDEEVDDGAGLPPASRRRPVVGEFLWDDGPRRHERPTTRRIRHRKLRSAYYRVARPP
                     VMITDRLGVEVFYFGRPAMSLEVERKVFILCSQNPLADISHSCLHSRKGLRVLLPKPD
                     DNNTGPGDVNLLAAVLRSFASGLVIVSLRSGIYVKNLCKSTVLYHGNNPPKKFGVICG
                     LSSRAVLDVFNVAQYRIQGHEHIKKTTVFIGGDPTSAEQFDMVPLVIKLRLRSVTCDD
                     "
     gene            complement(91853..94353)
                     /gene="vIRF-2"
                     /locus_tag="HHV8GK18_gp65"
                     /db_xref="GeneID:4961491"
     mRNA            complement(join(91853..93620,93742..94325))
                     /gene="vIRF-2"
                     /locus_tag="HHV8GK18_gp65"
                     /db_xref="GeneID:4961491"
     polyA_site      complement(91853)
                     /gene="vIRF-2"
                     /locus_tag="HHV8GK18_gp65"
     regulatory      complement(91881..91886)
                     /regulatory_class="polyA_signal_sequence"
                     /gene="vIRF-2"
                     /locus_tag="HHV8GK18_gp65"
     CDS             complement(join(92066..93620,93742..94229))
                     /gene="vIRF-2"
                     /locus_tag="HHV8GK18_gp65"
                     /note="interferon regulatory factor"
                     /codon_start=1
                     /product="vIRF-2"
                     /protein_id="YP_001129414.1"
                     /db_xref="GeneID:4961491"
                     /translation="MPRYTESEWLTDFIIDALDSGRFWGVGWLDEQKRIFTVPGRNRR
                     ERMPEGFDDFYEAFLEERRRHGLPEIPETETGLGCFGRLLRTANRARQERPFTIYKGK
                     MKLNRWIMTPRPYKGCEGCLVYLTQEPAMKNMLKALFGIYPHDDKHREKALRRSLRKK
                     AQREAARKQAAAVATPTTSSAAEVSSRSQSEDTESSDSENELWVGAQGFVGRDMHSLF
                     FEEPEPSGFGSSGQSSSLLAPDSPRPSTSQVQGPLHVHTPTDLCLPTGGLPSPVIFPH
                     ETQGLLAPPAGQSQTPFSPEGPVPSHVSGLDDCLPMVDHIEGCLLDLLSDVGQELPDL
                     GDLGELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSGQELPDL
                     GDLSELLCETASPQGPMQSEGGEEGSTESVSVLPATHPLESSAPGASVMGSSFQASDN
                     VDDFIDCIPPLCRDDRDVEDQEKADQTFYWYGSDMRPKVLTATQSVAAYLSKKQAIYK
                     VGDKLVPLVVEVYYFGEKVKTHFDLTGGIVICSQVPEASPEHICQTVPPYKCLLPRTA
                     HCSVDANRTLEQTLDRFSMGVVAIGTNMGIFLKGLLEYPAYFVGNASRRRIGKCRPLS
                     HRHEIQQAFDVERHNREPEGSRYASLFLGRRPSPEYDWDHYPVILHIYLAPFYHRD"
     repeat_region   92780..93127
                     /rpt_family="DR4"
                     /rpt_type=direct
     regulatory      complement(94348..94353)
                     /regulatory_class="TATA_box"
                     /gene="vIRF-2"
                     /locus_tag="HHV8GK18_gp65"
     gene            complement(94557..100300)
                     /gene="ORF61"
                     /locus_tag="HHV8GK18_gp66"
                     /db_xref="GeneID:4961490"
     gene            complement(94557..97893)
                     /gene="ORF60"
                     /locus_tag="HHV8GK18_gp67"
                     /db_xref="GeneID:4961455"
     gene            complement(94557..95650)
                     /gene="ORF58"
                     /locus_tag="HHV8GK18_gp68"
                     /db_xref="GeneID:4961480"
     gene            complement(94577..101300)
                     /gene="ORF62"
                     /locus_tag="HHV8GK18_gp69"
                     /db_xref="GeneID:4961461"
     gene            complement(94577..96845)
                     /gene="ORF59"
                     /locus_tag="HHV8GK18_gp70"
                     /db_xref="GeneID:4961492"
     CDS             complement(94577..95650)
                     /gene="ORF58"
                     /locus_tag="HHV8GK18_gp68"
                     /note="multiple transmembrane protein; herpesvirus core
                     gene UL43 family"
                     /codon_start=1
                     /product="ORF58"
                     /protein_id="YP_001129415.1"
                     /db_xref="GeneID:4961480"
                     /translation="MCRLDSERALSLFSYLSGTLAATPFLWCFIFKALYSFTLFTTEI
                     TAVFFWSLPVTHLALICMCLCPAAQKQLDRRLEWICASAVFAAVVCAAFSGFTFSRVP
                     FIPGLCVLNCLLLLPYPLATATAVYQAPPIVHRYYELGFCGAFMVYYLLLFKKVFVSG
                     VFWLPFIVFLVGGLLAFRHLEQHVYIRAGMQRRRAIFIMPGKYITYSVFQAWAYCRRE
                     VVVFVTLLLATLISTASIGLLTPVLIGLDKYMTLFYVGLLSCVGVSVASRRALFVLLP
                     LAAVLLTLVHILGSGPDMLLVRSCLCCLFLVSMLAAMGVEIQLIRRKLHRALNAPQMV
                     LALCTVGNLCISCLLSVINKVVG"
     misc_feature    complement(94589..95635)
                     /gene="ORF58"
                     /locus_tag="HHV8GK18_gp68"
                     /note="Herpesvirus BMRF2 protein; Region: Herpes_BMRF2;
                     pfam04633"
                     /db_xref="CDD:282486"
     regulatory      complement(94584..94589)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF58, ORF59, ORF60, ORF61, ORF62"
     CDS             complement(95655..96845)
                     /gene="ORF59"
                     /locus_tag="HHV8GK18_gp70"
                     /note="DNA polymerase processivity subunit; herpesvirus
                     core gene UL42 family"
                     /codon_start=1
                     /product="ORF59"
                     /protein_id="YP_001129416.1"
                     /db_xref="GeneID:4961492"
                     /translation="MPVDFHYGVRVDVTLLSKIRRVNEHIKSATKTGVVQVHGSACTP
                     TLSVLSSVGTAGVLGLRIKNALTPLVGHTEGSGDVSFSFRNTSVGSGFTHTRELFGAN
                     VLDAGIAFYRKGEACDTGAQPQFVRTTISYGDNLTSTVHKSVVDQKGILPFHDRMEAG
                     GRTTRLLLCGKTGAFLLKWLRQQKTKEDQTVTVSVSETLSIVTFSLGGVSKIIDFKPE
                     TKPVSGWDGLKGKKSVDVGVVHTDALSRVSLESLIAALRLCKVPGWFTPGLIWHSNEI
                     LEVEGVPTGCQSGDVKLSVLLLEVNRSVSAEGGESSQKVPDSIPDSRRQPELESPDSP
                     PLTPVGPFGPLEDASEDAASVTSCPPAAPTKDSTKRPHKRRSDSSQSRDRGKVPKTTF
                     NPLI"
     misc_feature    complement(95658..96830)
                     /gene="ORF59"
                     /locus_tag="HHV8GK18_gp70"
                     /note="Herpes DNA replication accessory factor; Region:
                     Herpes_DNAp_acc; pfam04929"
                     /db_xref="CDD:282746"
     CDS             complement(96976..97893)
                     /gene="ORF60"
                     /locus_tag="HHV8GK18_gp67"
                     /note="ribonucleotide reductase small subunit; herpesvirus
                     core gene UL40 family"
                     /codon_start=1
                     /product="ORF60"
                     /protein_id="YP_001129417.1"
                     /db_xref="GeneID:4961455"
                     /translation="MDSVDRFLYTSDHDGFLALTRETWQNRWFPSQIPLHLDVSHVHQ
                     LSDADKDFYRFLFTFLGMAERLVNFNIEDLVTNFNSHDVAHYYAEQVAMENIHGVVYA
                     NILKIFFNNSRGELLAYAAKIILDPALCEKLEWLHSRVRKATTKAQKILMFLIVEGIY
                     FISSFYSISLCRVRGIMPGVCLANDYISRDELLHTKAASMLYNTMVEIQEKPSHAEVQ
                     ALFREAVNIEIRFIQAKAAGVTLVNVVDIRRFLEATADRILRDIFVPPIFGTPPPEAC
                     PLSYTGSFKAVNFFERDNSDYTTCVTDDL"
     misc_feature    complement(97081..97872)
                     /gene="ORF60"
                     /locus_tag="HHV8GK18_gp67"
                     /note="Ribonucleotide reductase, small chain; Region:
                     Ribonuc_red_sm; pfam00268"
                     /db_xref="CDD:395206"
     misc_feature    complement(order(97312..97314,97321..97323,97423..97425,
                     97603..97605,97612..97614,97702..97704))
                     /gene="ORF60"
                     /locus_tag="HHV8GK18_gp67"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153108"
     CDS             complement(97922..100300)
                     /gene="ORF61"
                     /locus_tag="HHV8GK18_gp66"
                     /note="ribonucleotide reductase large subunit; herpesvirus
                     core gene UL39 family"
                     /codon_start=1
                     /product="ORF61"
                     /protein_id="YP_001129418.1"
                     /db_xref="GeneID:4961490"
                     /translation="MSVRTFCQVHLGAVPPERRGSQVSAGQLSDFDMCAQSLIDFLKV
                     RVGWDVRANAMAGRLWHQIMEARCPATLKQYLGIFRGVLGHRVESFIQKNIDALEDML
                     CAYRRSKAYEDTLNCGYLSAVRLYDTYVLRTMGTEPVYESVAQMFMRVSVFVACQCLE
                     HECLYWLARDLIEDAKSVSEMAIVEYVFGYLAAQHVCCATPILRSAGVEGGQLASCFI
                     LQPSMMNEPGTLDALYHDMSPLLASKSGVGLDVTSFSHQKNIASCLKLVDAQVHYFND
                     NNIRPVGASAYMELWHSQICDFLNAKLPENPDRCHSLFQGVCIPTLFFRMYEKDPSKL
                     WYLFDPATAPNLIKLYGAAFDNEYERLVRAGKYVSCMPLKSMMFTLIHTIIKTGSPYV
                     LLKEALNEHHWTDTQGMAINCSNLCAEIVQLPGRNTSVCNLANICLPKCLRTVESARV
                     GTTDANRPFFCFEALGDAVRVAVLVINACILGGSHPTPGVERGQKERSMGIGVQGLAD
                     VFAELGYGYLDAESAELDKNIFQSMYYTAVETSHNLVLEGQGVPFHGWEVSNFAKGRF
                     HWQTWEGEDASFVPRHRWDALGKSIAEHGIFNSQFLAVMPTAGTSQVTGYAESVYPFF
                     ANISSKVTNKEEVLRPNVTFFKKVLPDDLRVVRQYGGDVSTFPKHHRERYRVFLTAFD
                     YCPFKLLDRARARAPFVDQSQSMSFFLKEDRVRNASYLRDLLLHGYRLGLKTLMYYCR
                     VQKQSSLTALQCLADPGSPPHSGMKQDGAWLPGPKNPEEESCAADPECLVCQ"
     misc_feature    complement(98075..99946)
                     /gene="ORF61"
                     /locus_tag="HHV8GK18_gp66"
                     /note="ribonucleoside-diphosphate reductase, alpha
                     subunit; Region: NrdE_NrdA; TIGR02506"
                     /db_xref="CDD:274170"
     misc_feature    complement(98081..99868)
                     /gene="ORF61"
                     /locus_tag="HHV8GK18_gp66"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl09939"
                     /db_xref="CDD:299130"
     CDS             complement(100305..101300)
                     /gene="ORF62"
                     /locus_tag="HHV8GK18_gp69"
                     /note="capsid triplex protein; herpesvirus core gene UL38
                     family"
                     /codon_start=1
                     /product="ORF62"
                     /protein_id="YP_001129419.1"
                     /db_xref="GeneID:4961461"
                     /translation="MKVQAENAARLGRQVLGLLPPPTHRVSLTRGPEFARGVRDLLSK
                     YAASTRPTVGSLHEALRQAPFRQPTYGDFLVYSQTFSPQEPLGTFLFSFKQEDNGSSM
                     DMLLTPTSLFMLSGMEAAKAPQTHKVAGVWYGSGSGLADFIPNLSELMDTGEFHTLLT
                     PVGPMVQSVHSTFVTKVTSAMKGVGLARDEPRAHVGLTLPCDMLVDLDESCPMVQRRE
                     PAGLNVTIYASLVYLRVNQRPSMALTFFQSGKGFAEVVAMIKDHFTDVIRTKYIQLRH
                     ELYINRLVFGAVCTLGTVPFDSHPVHQSLNVKGTSLPVLVFANFEAACGPWTVFL"
     misc_feature    complement(100308..101300)
                     /gene="ORF62"
                     /locus_tag="HHV8GK18_gp69"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03263"
                     /db_xref="CDD:223028"
     gene            101314..112013
                     /gene="ORF63"
                     /locus_tag="HHV8GK18_gp71"
                     /db_xref="GeneID:4961466"
     CDS             101314..104100
                     /gene="ORF63"
                     /locus_tag="HHV8GK18_gp71"
                     /note="tegument protein; herpesvirus core gene UL37
                     family"
                     /codon_start=1
                     /product="ORF63"
                     /protein_id="YP_001129420.1"
                     /db_xref="GeneID:4961466"
                     /translation="MDGTDALEKLTKGLSGGGGSLHQTKLLMEFQLRGLPVPALLNSS
                     TTEQFLNTVAQLPTDLSKFIRDYRVFALVRAAYFLEPPSSIDPLEAARALGRLVDILS
                     SQPPQNTAPAQPPTSDDTLNNCTLLKLLAHYADQIAGFKTPALPPVPPGIIGLFTCVE
                     QMYHACFQKYWAAALPPMWILTYDPPTSPLQDWLIVAYGNKEGLLLPSGIPSEEVLAK
                     TLVTEHHELFVSRSNSTETAVTMPVSKERALAIYRVFAKGEVVAENTPILAFTDVELS
                     TLKPHYLFIYDFIIEALCKSYTYSCTQARLESFLSRGIDFMTDLGQYLDTATSGKQQL
                     THSQIKEIKYRLLSCGLSASACDVFRTVIMTLPYRPTPNLANLSTFMGMVHQLTMFGH
                     YFYRCLGSYSPTGLAFTELQKILTRASAEQTERNPWRHPGISDIPLRWKISRALAFFV
                     PPAPINTLQRVYAALPSQLMRAIFEISVKTTWGGAVPANLARDIDTGPNTQHISSTPP
                     PTLKDVETYCQGLRVGDTEYDEDIVRSPLFADAFTKSHLLPILREVLENRLQKNRALF
                     QIRWLIIFAAEAATGLIPARRPLARAYFHIMDILEERHSQDALYNLLDCIQELFTHIR
                     QAVPDAQCPHAFLQSLFVFQFRPFVLKHQQGVTLFLDGLQTSLPPVISLANLGDKLCR
                     LEFEYDSEGDFVRVPVAPPEQPPHVHLSHFKKTIQTIEQATREATVAMTTIAKPIYPA
                     YIRLLQRLEYLNRLNHHILRIPFPQDALSELQETYLAAFARLTKLAADAANTCSYSLT
                     KYFGVLFQHQLVPTAIVKKLLHFDEAKDTTEAFLQSLAQPVVQGQRQGAAGGSGVLTQ
                     KELELLNKINPQFTDAQANIPPSIKRSYSNKYDVPEVSVDWETYSRSAFEAPDDELRF
                     VPLTLAGLRKLFVE"
     misc_feature    101332..104001
                     /gene="ORF63"
                     /locus_tag="HHV8GK18_gp71"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     gene            104106..112013
                     /gene="ORF64"
                     /locus_tag="HHV8GK18_gp72"
                     /db_xref="GeneID:4961441"
     CDS             104106..112013
                     /gene="ORF64"
                     /locus_tag="HHV8GK18_gp72"
                     /note="large tegument protein; herpesvirus core gene UL36
                     family"
                     /codon_start=1
                     /product="ORF64"
                     /protein_id="YP_001129421.1"
                     /db_xref="GeneID:4961441"
                     /translation="MAAQPLYMEGMASTHQANCIFGEHAGSQCLSNCVMYLASSYYNS
                     ETPLVDRASLDDVLEQGMRLDLLLRKSGMLGFRQYAQLHHIPGFLRTDDWATKIFQSP
                     EFYGLIGQDAAIREPFIESLRSVLSRNYAGTVQYLIIICQSKAGAIVVKDKTYYMFDP
                     HCIPNIPNSPAHVIKTNDVGVLLPYIATHDTEYTGCFLYFIPHDYISPEHYIANHYRT
                     IVFEELHGPRMDISRGVESCSITEITSPSVSPAPSEAPLRRDSTQSQDETRPRRPRVV
                     IPPYDPTDRPRPPHQDRPPEQAAGYGGNKGRGGNKGRGGKTGRGGNEGRGGHQPPDEH
                     QPPHITAEHMDQSDGQGADGDMDSTPANGETSVTETPGPEPNPPARPDREPPPTPPAT
                     PGATALLSDLTATRGQKRKFSSLKESYPIDSPPSDDDDVSQPSQQTAPDTEDIWIDDP
                     LTPLYPLTDTPSFDITADVTPDNTHPEKAADGDFTNKTTSTDADRYASASQESLGTLV
                     SPYDFTNLDTLLAELGRLGTAQPIPVIVDRLTSRPFREASALQAMDRILTHVVLEYGL
                     VSGYSTAAPSKCTHVLQFFILWGEKLGIPTEDAKTLLESALEIPAMCEIVQQGRLKEP
                     TFSRHIISKLNPCLESLHATSRQDFKSLIQAFNAEGIRIASRERETSMAELIETITAR
                     LKPNFNIVCARQDAQTIQDGVGLLRAEVNKRNAQIAQEAAYFENIITALSTFQPPPQS
                     QQTFEVLPDLKLRTLVEHLTLVEAQVTTQTVESLQAYLQSAATAEHHLTNVPNVHSIL
                     SNISNTLKVIDYVIPKFIINTDTLAPYKQQFSYLGGELASMFSLDWPHAPAEAVEPLP
                     VLTSLRGKIAEALTRQENKNAVDQILTDAEGLLKNITDPNGAHFHAQAVSIPVLENYV
                     HNAGVLLKGEKSERFSRLKTAIQNLVSSESFITVTLHSTNLGNLVTNVPKLGEAFTGG
                     PHLLTSPSVRQSLSTLCTTLLRDALDALEKKDPALLGEGTTLALETLLGYGSVQDYKE
                     TVQIISSLVGIQKLVRDQGADKWATAVTRLTDLKSTLATTAIETATKRKLYRLIQRDL
                     KEAQKHETNRAMEEWKQKVLALDNASPERVATLLQQAPTAKAREFAEKHFKILLPVPA
                     DAPVQASPTPMEYSASPLPDPKDIDRATSIHGEQAWKKIQQAFKDFNFAVLRPADWDA
                     LAAEYQRRGSPLPAAVGPALSGFLETILGTLNDIYMDKLRSFLPDAQPFQAPPFDWLT
                     PYQDQVSFFLRTIGLPLVRALADKISVQALRLSHALQSGDLQQATVGTPLELPATEYA
                     RIASNMKSVFNDHGLQVRSEVADYVEAQRADAHTPHVPRPKIQAPKTLIPHPDAIVAD
                     GLPAFLKTSLLQQEAKLLALQRADFESLESDMRAAEAQRKASREETQRKMAHAITQLL
                     QQAPSAISGRPLSLQDPVGFLEGIIYDKVLERESYETGLEGLSWLEQTIKSITVYAPV
                     EEKQRMHVLLDEVKKQRANTETALELEAAATHGDDARLLQRAVDELSPLRVKGGKAAV
                     ESWRQKIQTLKSLVQEAEQAGLLLATIDTVAGQAQETISPSTLQGLYQQGQEAMAAIK
                     RFRDSPQLAGLQEKLAELQQYVKYKKQYLEHFEATQSVVFTAFPLTQEVTIPALHYAG
                     PFDNLERLSRYLHIGQTQPAPGQWLLTLPTFDPTRPACVPAGGHEPPLHRQVVFSSFL
                     EAQIRLALSVAGPVPGRGLPGTPQIRRGVEAAACFLHQWDEISRLLPEVLDTFFHNAP
                     LPAESSSNAFLAMCVLTHLVYLAGRAVLGPREPEHAAPDAYPREVALAPRDLTYLLLA
                     MWPSWISAILKQPSHAEAAHACLVTLPTMLKAVPYLTLEASAGPLPADMRHFATPEAR
                     LFFPARWHHVNVQEKLWLRNDFMSLCHRSPGRARIAVLVWAVTCLDPEVIRQLWSTLR
                     PLTADESDTASGLLRVLVEMEFGPPPKTPRREAVAPGATLPPYPYGLATGERLVGQAQ
                     ERSGGAGKMPVSGFEIVLGALLFRAPLRIFSTASTHRISDFEGGFQILTPLLDCCPDR
                     EPFASLAAAPRRTVPLGDPCANIHTPEEIQIFARQAAWLQYTFANYQIPSTDNPIPIV
                     VLNANNNLENSYIPRDRKADPLRPFYVVPLKPQGRWPEIMTTATTPCRLPTSPEEAGS
                     QFARLLQSQVSATWSDIFSRVPERLAPNAPQKSSQTMSEIHEVAATPPLTITPNKPTG
                     TPHVSPEADPITERKRGQQPKIVADNMPSRILPSLPTPKPREPRITLPHALPVISPPA
                     HRPSPIPHLPAPQVTEPKGVLQSKRGTLVLRPAAVIDPRKPVSAPITRYERTALQPPR
                     TEGEGRRPPDTQPVTLTFRLPPTAPTPATAALETKTTPPSTPPHAIDISPPQTPPMST
                     SPHARDTSPPAEKRAAPVIRVMAPTQPSGEARVKRVEIEQGLSTRNEAPPLERSNHAV
                     PAVTPRRTVAREIRIPPEIKAGWDTAPDIPLPHSSPESSPPTSPQPIRVDDKSPLPNL
                     VERYARGFLDTPSVEVMSLENQDIAVDPGLLTRRIPSVVPMPHPIMWSPIVPISLQNT
                     DIDTAKITLISFIRRIKQKVAALSASLAETVDRIKKWYL"
     misc_feature    104142..104663
                     /gene="ORF64"
                     /locus_tag="HHV8GK18_gp72"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:398488"
     misc_feature    <108258..>109043
                     /gene="ORF64"
                     /locus_tag="HHV8GK18_gp72"
                     /note="exonuclease SbcC; Region: sbcc; TIGR00618"
                     /db_xref="CDD:129705"
     misc_feature    <110595..111557
                     /gene="ORF64"
                     /locus_tag="HHV8GK18_gp72"
                     /note="large tegument protein UL36; Provisional; Region:
                     PHA03247"
                     /db_xref="CDD:223021"
     gene            complement(111927..114911)
                     /gene="ORF67A"
                     /locus_tag="HHV8GK18_gp73"
                     /db_xref="GeneID:4961467"
     gene            complement(111927..114614)
                     /gene="ORF67"
                     /locus_tag="HHV8GK18_gp74"
                     /db_xref="GeneID:4961524"
     gene            complement(111927..113865)
                     /gene="ORF66"
                     /locus_tag="HHV8GK18_gp75"
                     /db_xref="GeneID:4961523"
     gene            complement(111927..112549)
                     /gene="ORF65"
                     /locus_tag="HHV8GK18_gp76"
                     /db_xref="GeneID:4961451"
     regulatory      complement(111927..111932)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF65, ORF66, ORF67, ORF67A"
     regulatory      111992..111997
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF63, ORF64"
     CDS             complement(112037..112549)
                     /gene="ORF65"
                     /locus_tag="HHV8GK18_gp76"
                     /note="small capsid protein on hexon tips; herpesvirus
                     core gene UL35 family"
                     /codon_start=1
                     /product="ORF65"
                     /protein_id="YP_001129422.1"
                     /db_xref="GeneID:4961451"
                     /translation="MSNFKVRDPVIQERLDHDYAHHPLVARMNTLDQGNMSQAEYLVQ
                     KRHYLVFLIAHHYYEAYLRRMGGIQRRDHLQTLRDQKPRERADRVSAASAYDAGTFTV
                     PSRPGPASGTTPGGQDSLGVSGSSITTLSSGPHSLSPASDILTTLSSTTETAAPAVAD
                     ARKPPSGKKK"
     misc_feature    complement(112043..112549)
                     /gene="ORF65"
                     /locus_tag="HHV8GK18_gp76"
                     /note="Gammaherpesvirus capsid protein; Region:
                     Herpes_capsid; pfam06112"
                     /db_xref="CDD:399248"
     CDS             complement(112576..113865)
                     /gene="ORF66"
                     /locus_tag="HHV8GK18_gp75"
                     /note="related to HHV-5 UL49"
                     /codon_start=1
                     /product="ORF66"
                     /protein_id="YP_001129423.1"
                     /db_xref="GeneID:4961523"
                     /translation="MALDQRWDRFLVSWFGLDEAQLTAHRVFEGENGVPVEEYVAFVI
                     FGERGFQGNMPSWARHLLDRPSLAQAIAVLRAGSDTVAKQAQICAAQQLLGAHVWVVV
                     TLSRAQAADHARAIPRHVWAKYLSLPFSKACAQLCKLLALCSRFPLVTCCSKPPPSLP
                     WLRKKWHGPLPRRPLLEVPSPTRRGVAATEDGNGLGIGAADTGLREALERVAPTVPCG
                     NPFDAMLGSLCFLSLIKSRHVVLPACEQEGPGLVRNLGRRLLAYNVLSPCVSIPVICS
                     RVARAALAKRARCARAVVCMECGHCLNFGRGKFHTVNFPPTNVFFSRDRKEKQFTICA
                     TTGRIYCSYCGSEHMRVYPLCDITGRGTLARVVIRAVLANNAALAIRDLDQTVSFVVP
                     CLGTPDCEAALLKHRDVRGLLQLTSQLLEFCCGKCSS"
     misc_feature    complement(112582..113268)
                     /gene="ORF66"
                     /locus_tag="HHV8GK18_gp75"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     CDS             complement(113799..114614)
                     /gene="ORF67"
                     /locus_tag="HHV8GK18_gp74"
                     /function="egress of capsids from nucleus"
                     /note="capsid docking protein on nuclear lamina;
                     herpesvirus core gene UL34 family"
                     /codon_start=1
                     /product="ORF67"
                     /protein_id="YP_001129424.1"
                     /db_xref="GeneID:4961524"
                     /translation="MSVVGKRVVDELCRVVSSYLGQSGQSLDLERCIDGAPVYAKGGA
                     TAICTVRMQHGCVYHLEFVYKFWAHLLEEMHYPFSPCFVISNNGLSTTLKCFLCRPSD
                     AVSQFGHVLPVESDVYLAKNTSVVLGQDDFTKFKASLVFSKNLGVYNSMVICRTYFTD
                     YRQVLQFLVVTPKSHKRLKSLLETVYCLAAPVADSAAQGGAGFPTNGRDARACTSDVT
                     AVYWAGQGGRTVRILGAFQWSLGRAVALVRRSWPWISAGIAFLCLGLVWMRPS"
     misc_feature    complement(114033..114602)
                     /gene="ORF67"
                     /locus_tag="HHV8GK18_gp74"
                     /note="Herpesvirus virion protein U34; Region: Herpes_U34;
                     pfam04541"
                     /db_xref="CDD:398302"
     CDS             complement(114669..114911)
                     /gene="ORF67A"
                     /locus_tag="HHV8GK18_gp73"
                     /function="DNA packaging"
                     /note="herpesvirus core gene UL33 family"
                     /codon_start=1
                     /product="ORF67A"
                     /protein_id="YP_001129425.1"
                     /db_xref="GeneID:4961467"
                     /translation="MEYASDQLLPRDMQILFPTIYCRLNAINYCQYLKTFLVQRAQPA
                     ACDHTLVLESKVDTVRQVLRKIVSTDAVFSEARARP"
     misc_feature    complement(114690..114902)
                     /gene="ORF67A"
                     /locus_tag="HHV8GK18_gp73"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     gene            115108..117514
                     /locus_tag="HHV8GK18_gp77"
                     /note="ORF68"
                     /db_xref="GeneID:4961470"
     CDS             115108..116511
                     /locus_tag="HHV8GK18_gp77"
                     /function="nuclear localization of capsids and DNA
                     packaging"
                     /note="herpesvirus core gene UL32 family"
                     /codon_start=1
                     /product="ORF68"
                     /protein_id="YP_001129426.1"
                     /db_xref="GeneID:4961470"
                     /translation="MFVPWQLGTITRHRDELQKLLAASLLPEHPEESLGNPIMTQIHQ
                     SLQPSSPCRVCQLLFSLVRDSSTPMGFFEDYACLCFFCLYAPHCWTSTMAAAADLCEI
                     MHLHFPEEEATYGLFGPGRLMGIDLQLHFFVQKCFKTTAAEKILGISNLQFLKSEFIR
                     GMLTGTITCNFCFKTSWPRTDKEEATGPTPCCQITDTTTAPASGIPELARATFCGASR
                     PTKPSLLPALIDIWSTSSELLDEPRPRLIASDMSELKSVVASHDPFFSPPLQADTSQG
                     PCLMHPTLGLRYKNGTASVCLLCECLAAHPEAPKALQTLQCEVMGHIENNVKLVDRIA
                     FVLDNPFAMPYVSDPLLRELIRGCTPQEIHKHLFCDPLCALNAKVVSEDVLFRLPREQ
                     EYKKLRASAAAGQLLDANTLFDCEVVQTLVFLFKGLQNARVGKTTSLDIIRELTAQLK
                     RHRLDLAHPSQTSHLYA"
     misc_feature    115258..116505
                     /locus_tag="HHV8GK18_gp77"
                     /note="Herpesvirus putative major envelope glycoprotein;
                     Region: Herpes_env; cl28122"
                     /db_xref="CDD:332943"
     misc_feature    115410..137969
                     /note="insert in cos83; contains copies of TR at right
                     end"
     gene            116544..117514
                     /locus_tag="HHV8GK18_gp78"
                     /note="ORF69"
                     /db_xref="GeneID:4961444"
     CDS             116544..117452
                     /locus_tag="HHV8GK18_gp78"
                     /function="egress of capsids from nucleus"
                     /note="herpesvirus core gene UL31 family"
                     /codon_start=1
                     /product="ORF69"
                     /protein_id="YP_001129427.1"
                     /db_xref="GeneID:4961444"
                     /translation="MPKSVSSHISLATSTGRSGPRDIRRCLSSRLRSVPPGARSASVS
                     SKHRNGLRKFISDKVFFSILSHRHELGVDFLREMETPICTSKTVMLPLDLSTVAPGRC
                     VSLSPFGHSSNMGFQCALCPSTENPTVAQGSRPQTMVGDALKKNNELCSVALAFYHHA
                     DKVIQHKTFYLSLLSHSMDVVRQSFLQPGLLYANLVLKTFGHDPLPIFTTNNGMLTMC
                     ILFKTRALHLGETALRLLMDNLPNYKISADCCRQSYVVKFVPTHPDTASIAVQVHTIC
                     EAVAALDCTDEMRDDIQKGTALVNAL"
     misc_feature    116655..117443
                     /locus_tag="HHV8GK18_gp78"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     pfam02718"
                     /db_xref="CDD:397022"
     regulatory      117509..117514
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF68, ORF69"
     gene            complement(117535..118233)
                     /locus_tag="HHV8GK18_gp79"
                     /note="K12; other proteins may be produced from this
                     region (kaposin B and C); kaposin B increases expression
                     of certain cytokines"
                     /db_xref="GeneID:4961446"
     misc_RNA        complement(117535..118233)
                     /locus_tag="HHV8GK18_gp79"
                     /product="T0.7"
                     /db_xref="GeneID:4961446"
     regulatory      complement(117548..117553)
                     /regulatory_class="polyA_signal_sequence"
                     /locus_tag="HHV8GK18_gp79"
     CDS             complement(118025..118207)
                     /locus_tag="HHV8GK18_gp79"
                     /function="possible role in transformation"
                     /note="kaposin A"
                     /codon_start=1
                     /product="K12"
                     /protein_id="YP_001129428.1"
                     /db_xref="GeneID:4961446"
                     /translation="MDRGLTVFVAVHVPDVLLNGWRWRLGAIPPLVCLLAISVVPPSG
                     QRGPVAFRTRVATGAH"
     misc_RNA        complement(118075..118097)
                     /product="miR-K10"
     repeat_region   118229..118490
                     /rpt_family="DR5"
                     /rpt_type=direct
     repeat_region   118491..118845
                     /rpt_family="DR6"
                     /rpt_type=direct
     repeat_region   118948..120125
                     /rpt_family="LIR1"
                     /rpt_type=inverted
     gene            complement(119586..119607)
                     /locus_tag="HHV8_gs02"
                     /db_xref="GeneID:4961463"
     misc_RNA        complement(119586..119607)
                     /locus_tag="HHV8_gs02"
                     /product="miR-K9"
                     /db_xref="GeneID:4961463"
     gene            complement(120234..120253)
                     /locus_tag="HHV8_gs03"
                     /db_xref="GeneID:4961520"
     misc_RNA        complement(120234..120253)
                     /locus_tag="HHV8_gs03"
                     /product="miR-K8"
                     /db_xref="GeneID:4961520"
     gene            complement(120605..120627)
                     /locus_tag="HHV8_gs04"
                     /db_xref="GeneID:4961517"
     misc_RNA        complement(120605..120627)
                     /locus_tag="HHV8_gs04"
                     /product="miR-K7"
                     /db_xref="GeneID:4961517"
     gene            complement(121044..121065)
                     /locus_tag="HHV8_gs05"
                     /db_xref="GeneID:4961518"
     misc_RNA        complement(121044..121065)
                     /locus_tag="HHV8_gs05"
                     /product="miR-K6"
                     /db_xref="GeneID:4961518"
     gene            complement(121514..121535)
                     /locus_tag="HHV8_gs06"
                     /db_xref="GeneID:4961522"
     misc_RNA        complement(121514..121535)
                     /locus_tag="HHV8_gs06"
                     /product="miR-K5"
                     /db_xref="GeneID:4961522"
     gene            complement(121703..121724)
                     /locus_tag="HHV8_gs07"
                     /db_xref="GeneID:4961519"
     misc_RNA        complement(121703..121724)
                     /locus_tag="HHV8_gs07"
                     /product="miR-K4"
                     /db_xref="GeneID:4961519"
     gene            complement(121834..121856)
                     /locus_tag="HHV8_gs08"
                     /db_xref="GeneID:4961516"
     misc_RNA        complement(121834..121856)
                     /locus_tag="HHV8_gs08"
                     /product="miR-K3"
                     /db_xref="GeneID:4961516"
     gene            complement(121977..121998)
                     /locus_tag="HHV8_gs09"
                     /db_xref="GeneID:4961515"
     misc_RNA        complement(121977..121998)
                     /locus_tag="HHV8_gs09"
                     /product="miR-K2"
                     /db_xref="GeneID:4961515"
     gene            complement(122137..122159)
                     /locus_tag="HHV8_gs10"
                     /db_xref="GeneID:4961453"
     misc_RNA        complement(122137..122159)
                     /locus_tag="HHV8_gs10"
                     /product="miR-K1"
                     /db_xref="GeneID:4961453"
     gene            complement(122337..122959)
                     /locus_tag="HHV8GK18_gp80"
                     /note="ORF71"
                     /db_xref="GeneID:4961494"
     regulatory      complement(122337..122342)
                     /regulatory_class="polyA_signal_sequence"
                     /locus_tag="HHV8GK18_gp80"
                     /note="ORF71"
     CDS             complement(122393..122959)
                     /locus_tag="HHV8GK18_gp80"
                     /note="FLIP-like inhibitor of apoptosis; contains two
                     death effector domains; ORF71; vFLIP"
                     /codon_start=1
                     /product="K13"
                     /protein_id="YP_001129429.1"
                     /db_xref="GeneID:4961494"
                     /translation="MATYEVLCEVARKLGTDDREVVLFLLNVFIPQPTLAQLIGALRA
                     LKEEGRLTFPLLAECLFRAGRRDLLRDLLHLDPRFLERHLAGTMSYFSPYQLTVLHVD
                     GELCARDIRSLIFLSKDTIGSRSTPQTFLHWVYCMENLDLLGPTDVDALMSMLRSLSR
                     VDLQRQVQTLMGLHLSGPSHSQHYRHTP"
     misc_feature    complement(122768..122953)
                     /locus_tag="HHV8GK18_gp80"
                     /note="Death effector domain, repeat 1, of initator
                     caspase-like proteins; Region: DED_Caspase-like_r1;
                     cd08776"
                     /db_xref="CDD:176754"
     misc_feature    complement(122450..122686)
                     /locus_tag="HHV8GK18_gp80"
                     /note="Death effector domain, repeat 2, of initator
                     caspase-like proteins; Region: DED_Caspase-like_r2;
                     cd08775"
                     /db_xref="CDD:176753"
     gene            complement(123010..127446)
                     /locus_tag="HHV8GK18_gp81"
                     /note="ORF73"
                     /db_xref="GeneID:4961527"
     gene            complement(123010..123815)
                     /locus_tag="HHV8GK18_gp82"
                     /note="ORF72"
                     /db_xref="GeneID:4961471"
     regulatory      complement(123010..123015)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF72, ORF73"
     CDS             complement(123042..123815)
                     /locus_tag="HHV8GK18_gp82"
                     /note="cyclin D-like protein; contains two cyclin-like
                     domains; vCyclin"
                     /codon_start=1
                     /product="ORF72"
                     /protein_id="YP_001129430.1"
                     /db_xref="GeneID:4961471"
                     /translation="MATANNPPSGLLDPTLCEDRIFYNILEIEPRFLTSDSVFGTFQQ
                     SLTSHMRKLLGTWMFSVCQEYNLEPNVVALALNLLDRLLLIKQVSKEHFQKTGSACLL
                     VASKLRSLTPISTSSLCYAAADSFSRQELIDQEKELLEKLAWRTEAVLATDVTSFLLL
                     KLLGGSQHLDFWHHEVNTLITKALVDPKTGSLPASIISAAGCALLVPANVIPQDTHSG
                     GVVPQLASILGCDVSVLQAAVEQILTSVSDFDLRILDSY"
     misc_feature    complement(123384..123680)
                     /locus_tag="HHV8GK18_gp82"
                     /note="Cyclin box fold superfamily; Region: CYCLIN_SF;
                     cl40454"
                     /db_xref="CDD:424085"
     misc_feature    complement(order(123384..123389,123399..123401,
                     123408..123413,123420..123422,123471..123476,
                     123480..123482,123486..123500,123612..123614))
                     /locus_tag="HHV8GK18_gp82"
                     /note="CDK interface [polypeptide binding]; other site"
                     /db_xref="CDD:410207"
     misc_feature    complement(123063..123374)
                     /locus_tag="HHV8GK18_gp82"
                     /note="K cyclin, C terminal; Region: K-cyclin_vir_C;
                     pfam09080"
                     /db_xref="CDD:401138"
     CDS             complement(124057..127446)
                     /locus_tag="HHV8GK18_gp81"
                     /function="maintenance of episomal genome"
                     /note="latent nuclear antigen; component of
                     latency-associated nuclear antigen; LANA; LNA; ORF73"
                     /codon_start=1
                     /product="LANA"
                     /protein_id="YP_001129431.1"
                     /db_xref="GeneID:4961527"
                     /translation="MAPPGMRLRSGRSTGAPLTRGSCRKRNRSPERCDLGDDLHLQPR
                     RKHVADSVDGRECGPHTLPIPGSPTVFTSGLPAFVSSPTLPVAPIPSPAPATPLPPPA
                     LLPPVTTSSSPIPPSHPVSPGTTDTHSPSPALPPTQSPESSQRPPLSSPTGRPDSSTP
                     MRPPPSQQTTPPHSPTTPPPEPPSKSSPDSLAPSTLRSLRKRRLSSPQGPSTLNPICQ
                     SPPVSPPRCDFANRSVYPPWATESPIYVGSSSDGDTPPRQPPTSPISIGSSSPSEGSW
                     GDDTAMLVLLAEIAEEASKNEKECSENNQAGEDNGDNEISKESQVDKDDNDNKDDEEE
                     QETDEEDEEDDEEDDEEDDEEDDEEDDEEDDEEDDEEEDEEEDEEEDEEEDEEEEEDE
                     EDDDDEDNEDEEDDEEEDKKEDEEDGGDGNKTLSIQSSQQQQEPQQQEPQQQEPQQQE
                     PQQQEPQQQEPQQQEPQQQEPQQREPQQREPQQREPQQREPQQREPQQREPQQREPQQ
                     REPQQREPQQREPQQREPQQREPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEPQQQEP
                     QQQEPQQQEPQQQEPQQQEPQQQEPQQQDEQQQDEQQQDEQQQDEQQQDEQQQDEQQQ
                     DEQQQDEQEQQDEQQQDEQQQQDEQEQQEEQEQQEEQQQDEQQQDEQQQDEQQQDEQE
                     QQDEQQQDEQQQQDEQEQQEEQEQQEEQEQQEEQEQQEEQEQELEEQEQELEEQEQEL
                     EEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEEQEQELEE
                     QEQELEEQEQELEEQEQELEEQEQEQELEEVEEQEQEQEEQELEEVEEQEQEQEEQEE
                     QELEEVEEQEEQELEEVEEQEEQELEEVEEQEQQGVEQQEQETVEEPIILHGSSSEDE
                     MEVDYPVVSTHEQIASSPPGDNTPDDDPQPGPSREYRYVLRTSPPHRPGVRMRRVPVT
                     HPKKPHPRYQQPPVPYRQIDDCPAKARPQHIFYRRFLGKDGRRDPKCQWKFAVIFWGN
                     DPYGLKKLSQAFQFGGVKAGPVSCLPHPGPDQSPITYCVYVYCQNKDTSKKVQMARLA
                     WEASHPLAGNLQSSIVKFKKPLPLTQPGENQGPGDSPQEMT"
     misc_feature    complement(124111..>124650)
                     /locus_tag="HHV8GK18_gp81"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03169"
                     /db_xref="CDD:223003"
     repeat_region   complement(124784..126456)
                     /locus_tag="HHV8GK18_gp81"
                     /note="complex array of repeats"
                     /rpt_family="DR7"
                     /rpt_type=direct
     gene            127966..130671
                     /locus_tag="HHV8GK18_gp83"
                     /note="K14"
                     /db_xref="GeneID:4961465"
     regulatory      127966..127971
                     /regulatory_class="TATA_box"
                     /locus_tag="HHV8GK18_gp83"
     mRNA            join(127997..129368,129517..130671)
                     /note="K14, ORF74; polyA_site not reported"
     CDS             128264..129079
                     /locus_tag="HHV8GK18_gp83"
                     /note="vOX2; contains two Ig domains"
                     /codon_start=1
                     /product="K14"
                     /protein_id="YP_001129432.1"
                     /db_xref="GeneID:4961465"
                     /translation="MSSLFISLPWVAFIWLALLGAVGGARVQGPMRGSAALTCAITPR
                     ADIVSVTWQKRQLPGPVNVATYSHSYGVVVQTQYRHKANITCPGLWNSTLVIHNLAVD
                     DEGCYLCIFNSFGGRQVSCTACLEVTSPPTGHVQVNSTEDADTVTCLATGRPPPNVTW
                     AAPWNNASSTQEQFTDSDGLTVAWRTVRLPRGDNTTPSEGICLITWGNESISIPASIQ
                     GPLAHDLPAAQGTLAGVAITLVGLFGIFALHHCRRKQGGASPTSDDMDPLSTQ"
     misc_feature    128360..128644
                     /locus_tag="HHV8GK18_gp83"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:416386"
     misc_feature    128360..128386
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    128384..128404
                     /locus_tag="HHV8GK18_gp83"
                     /note="CDR1 [structural motif]; Region: CDR1"
                     /db_xref="CDD:409353"
     misc_feature    128405..128434
                     /locus_tag="HHV8GK18_gp83"
                     /note="FR2 [structural motif]; Region: FR2"
                     /db_xref="CDD:409353"
     misc_feature    128408..128428
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    128435..128488
                     /locus_tag="HHV8GK18_gp83"
                     /note="CDR2 [structural motif]; Region: CDR2"
                     /db_xref="CDD:409353"
     misc_feature    128435..128461
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409353"
     misc_feature    128474..128488
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409353"
     misc_feature    128504..128596
                     /locus_tag="HHV8GK18_gp83"
                     /note="FR3 [structural motif]; Region: FR3"
                     /db_xref="CDD:409353"
     misc_feature    128504..128527
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409353"
     misc_feature    128534..128554
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    128576..128599
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand F [structural motif]; Region: Ig strand
                     F"
                     /db_xref="CDD:409353"
     misc_feature    128597..128617
                     /locus_tag="HHV8GK18_gp83"
                     /note="CDR3 [structural motif]; Region: CDR3"
                     /db_xref="CDD:409353"
     misc_feature    128615..128644
                     /locus_tag="HHV8GK18_gp83"
                     /note="Ig strand G [structural motif]; Region: Ig strand
                     G"
                     /db_xref="CDD:409353"
     misc_feature    128618..128644
                     /locus_tag="HHV8GK18_gp83"
                     /note="FR4 [structural motif]; Region: FR4"
                     /db_xref="CDD:409353"
     gene            129520..130671
                     /locus_tag="HHV8GK18_gp84"
                     /note="ORF74"
                     /db_xref="GeneID:4961460"
     CDS             129520..130548
                     /locus_tag="HHV8GK18_gp84"
                     /note="G protein-coupled receptor; similar to IL-8
                     receptor; transforming protein; vGPCR"
                     /codon_start=1
                     /product="ORF74"
                     /protein_id="YP_001129433.1"
                     /db_xref="GeneID:4961460"
                     /translation="MAAEDFLTIFLDDDESWNETLNMSGYDYSGNFSLEVSVCEMTTV
                     VPYTWNVGILSLIFLINVLGNGLVTYIFCKHRSRAGAIDILLLGICLNSLCLSISLLA
                     EVLMFLFPNIISTGLCRLEIFFYYLYVYLDIFSVVCVSLVRYLLVAYSTRSWPKKQSL
                     GWVLTSAALLIALVLSGDACRHRSRVVDPVSKQAMCYENAGNMTADWRLHVRTVSVTA
                     GFLLPLALLILFYALTWCVVRRTKLQARRKVRGVIVAVVLLFFVFCFPYHVLNLLDTL
                     LRRRWIRDSCYTRGLINVGLAVTSLLQALYSAVVPLIYSCLGSLFRQRMYGLFQSLRQ
                     SFMSGATT"
     misc_feature    129676..130494
                     /locus_tag="HHV8GK18_gp84"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:421689"
     misc_feature    129676..129744
                     /locus_tag="HHV8GK18_gp84"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:410628"
     misc_feature    order(129679..129681,129841..129843,129850..129852,
                     129883..129885,129892..129897,130105..130122,
                     130141..130143,130150..130155,130318..130320,
                     130339..130341,130348..130350,130384..130386,
                     130396..130398,130405..130410,130417..130419)
                     /locus_tag="HHV8GK18_gp84"
                     /note="putative chemokine binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:410628"
     misc_feature    129763..129855
                     /locus_tag="HHV8GK18_gp84"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:410628"
     misc_feature    129871..129963
                     /locus_tag="HHV8GK18_gp84"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410628"
     misc_feature    129994..130062
                     /locus_tag="HHV8GK18_gp84"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410628"
     misc_feature    130141..130227
                     /locus_tag="HHV8GK18_gp84"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410628"
     misc_feature    130249..130341
                     /locus_tag="HHV8GK18_gp84"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:410628"
     misc_feature    130396..130473
                     /locus_tag="HHV8GK18_gp84"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:410628"
     gene            complement(130655..136899)
                     /gene="K15"
                     /locus_tag="HHV8GK18_gp85"
                     /db_xref="GeneID:4961473"
     gene            complement(130655..134589)
                     /locus_tag="HHV8GK18_gp86"
                     /note="ORF75"
                     /db_xref="GeneID:4961476"
     regulatory      complement(130655..130660)
                     /regulatory_class="polyA_signal_sequence"
                     /note="ORF75, K15"
     regulatory      130666..130671
                     /regulatory_class="polyA_signal_sequence"
                     /note="K14, ORF74"
     CDS             complement(130699..134589)
                     /locus_tag="HHV8GK18_gp86"
                     /note="tegument protein; related to formylglycinamide
                     ribotide amidotransferase (FGARAT)"
                     /codon_start=1
                     /product="ORF75"
                     /protein_id="YP_001129434.1"
                     /db_xref="GeneID:4961476"
                     /translation="MAYDVTGLWLESDLTADEEAFVSFYTSRTGTLTLVPGGTGGYYL
                     LWITFRRPPTSREERERRDVEIQTVLAVLSPLLGYPHVIRRSPPRGSERVVSFGYGPN
                     INHRPTTLSTELGVLLRELGLQEWARVEVGRHLVSKITQTLLEPHPPQFIRAFTQNTD
                     LVPYEGLEVPEGPQPVARPHIEDDVIMQAVMISLGADLLPLAVQASTGDNYNVARYFV
                     IPGRCTMERWPWNCARQAFGIHGAYTHVHSSVQRGIRGLGNLLFHSTLFPGGQTQGAL
                     TGLYATEPALGPRAHSRFRRIFAKGVQQAEMLQGAGVPTLGGFLKTVRTIATTPGNAL
                     AVCSISTTTSKECISLRRMIPQQTVVCLGRFEPTDGPDTYPNLYRDSSDNAVRILETL
                     KLVQRLAKGPIFSGLNRSHDPAPVVRHLQALAPRTGLELFVSKLPDEVRAHLPADPAA
                     GPDAVEAAVAEHFLNVYCSLVFAVVAESGAVPGDLGETPLEVLQRAARLCACQITVLG
                     RTSEQPGIRIVDDLTGETTRVFSVDQPSSTPPSPWLALSDGVRVSGHPEDVDWGLFAT
                     GSTIHQLLRHATVGSKEFFTRHMDRCSNGLIAQQAGVGPLDIPVSDYHLVLHSSMLAE
                     RVAPRVPDTVEAITPSMANLLHKDFETWVKALPQELLPVPAWRGQAMAMGEQAYKMAT
                     NVSTGATYAITEALTNLMFSPVSKLQDVVLTGAVAWSPEDHQAGLLQECLFACKEFCR
                     ELGVALSISSAASSPTLSERHVRITQQQETVEVLPFNSVVFTSWAEVKGSRYRVTPDV
                     KVEGNALVYLAVNQSCLIAGSTFEHNFLASRHPIPPLNPSTVASLFMLVKYLMSKRLI
                     VSGHDIGDGGLLPSAIEMALAGCRGLQLSLPAHPNPLELMVSETPGALVEVPQVHLSE
                     VLRAARDYRCVAHPLGTVGPEGQGNNVTILQNETVVFQETLTSLQVSWTSFSDEMWNL
                     VTPPLHPLEDMHRKDLGRLEHHLGSLRAMCLGSQLRLFSCPTSPRRVAALVLPGSSAP
                     YALMAALQNTGFEVATVTVEELKRGQSLSGFSGLITCLRTGCQASYASARGWVLALCN
                     DPTCASTLTEFLNRPDTFSICCGEVGFQLLVALGVVGRSESSPYTYGPTPPQRWAVNL
                     ETNVSKLYDSHWLNIQIPQNTKSVFLRVLRGTVLPSWAQGEYLGVRYEQDALEYILRQ
                     RGEITLTYHGNAADETLPARHYPRNPTGNSTVAGLTSSDGRHAALIIDPSLMFHPWQW
                     QHVPPDLTPLSMSPWAMAFQSIYLWSVKKINDHH"
     misc_feature    complement(130720..134313)
                     /locus_tag="HHV8GK18_gp86"
                     /note="herpesvirus tegument protein/v-FGAM-synthase;
                     Region: tegu_FGAM_synt; TIGR01739"
                     /db_xref="CDD:273784"
     misc_feature    complement(133042..133875)
                     /locus_tag="HHV8GK18_gp86"
                     /note="dsDNA viral tegument protein; Region:
                     Tegument_dsDNA; pfam12818"
                     /db_xref="CDD:289579"
     misc_feature    complement(131794..132609)
                     /locus_tag="HHV8GK18_gp86"
                     /note="AIR (aminoimidazole ribonucleotide) synthase
                     related protein. This family includes Hydrogen
                     expression/formation protein HypE, AIR synthases, FGAM
                     (formylglycinamidine ribonucleotide) synthase and
                     Selenophosphate synthetase (SelD). The N-terminal
                     domain...; Region: PurM-like; cl10019"
                     /db_xref="CDD:299147"
     misc_feature    complement(order(132244..132246,132256..132258,
                     132265..132267,132439..132441,132448..132450,
                     132457..132459,132496..132498,132571..132573,
                     132577..132588))
                     /locus_tag="HHV8GK18_gp86"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100027"
     misc_feature    complement(130729..131538)
                     /locus_tag="HHV8GK18_gp86"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain; Region: GAT_1; cl00020"
                     /db_xref="CDD:294025"
     misc_feature    complement(131263..131265)
                     /locus_tag="HHV8GK18_gp86"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153222"
     CDS             complement(join(134824..135287,135373..135474,
                     135557..135664,135747..135899,135977..136066,
                     136155..136397,136481..136573,136683..136899))
                     /gene="K15"
                     /locus_tag="HHV8GK18_gp85"
                     /note="signal transducing membrane protein; LAMP"
                     /codon_start=1
                     /product="K15"
                     /protein_id="YP_001129435.1"
                     /db_xref="GeneID:4961473"
                     /translation="MKTLIFFWNLWLWALLVCFWCITLVCVTTNSIDTMASLLVMCIL
                     FVSAINKYTQAISSNNPKWPSSWHLGIIACIVLKLWNLSTTNSVTYACLITTAILSLV
                     TAFLTLIKHCTACKLQLEHGILFTSTFAVLMTNMLVHMSNTWQSSWIFFPISFTLSLP
                     FLYAFATVKTGNIKLVSSVSFICAGLVMGYPVSCCKTHTCTATAAGLSLSSIYLGFTG
                     IISTLHKSWAPPKRGILTFLLLQGGVLTTQTLTTELLAITSTTGNIKGHEILLLVCLI
                     FLWCLYVWQSFNKASLVTGMLHLIAAWSHTGGCVQLVMLLPSGLTRGILTMIICISTL
                     FSTLQGLLVFYLYKEKKVVAVNSYRQRRRRIYTRDQNLHHNDNHLGNNVISPPPLPPF
                     FRQPVRLPSHVTDRGRGSQLLNEVELQEVNRDPPNVFGYASILVSGAEESREPSPQPD
                     QSGMSILRVDGGSAFRIDTAQAATQPTDDLYEEVLFPRN"
     misc_feature    complement(join(134827..135287,135373..135474,
                     135557..135664,135747..135899,135977..136066,
                     136155..136397,136481..136573,136683..136896))
                     /gene="K15"
                     /locus_tag="HHV8GK18_gp85"
                     /note="Herpesvirus Latent membrane protein 2; Region:
                     Herpes_LAMP2; pfam06126"
                     /db_xref="CDD:147993"
     repeat_region   137169..137969
                     /note="terminal repeat (TR); variable copy numbers at
                     termini of genomic DNA"
     variation       137635..137673
                     /note="some copies of TR lack 39 bp"
                     /replace=""
ORIGIN      
        1 tactaatttt gaaaggcggg gttctgccag gcatagtctt tttttgtggc ggcccttgtg
       61 taaacctgtc tttcagacct tgttggacat cccgtacaat caagatgttc ctgtatgttg
      121 tttgcagtct ggcggtttgc tttcgaggac tattaagcct ttctctgcaa tcgtctccaa
      181 atctctgccc tggagtgatt tcaacgcctt acacgttgac ctgtccgtct aatacatcct
      241 tgccaacatc ctggtattgc aacgatactc ggcttttacg agtgacgcag ggaacattga
      301 ctgttgacac ccttatctgc aattttagtt gtgtgggaca atctgggcat cgatacagcc
      361 tttggattac atggtatgca caacctgtct tacaaacctt ctgtggacaa ccatcaaaca
      421 cagtcacttg tggtcagcat gttactttgt attgttctac ctctggaaat aatgttaccg
      481 tttggcatct accaaacgga caaaatgaaa ccgtgtcaca aactaaatac tataatttta
      541 cgctcatgaa ccaaactgag gggtgttatg cttgttctaa cgggctgtcg tctcgcctgt
      601 caaatcgtct atgtttttcg gcgcgttgtg ccaatataac tccagaaact catactgtat
      661 ctgtcagcag tactacaggc tttagaacat ttgcaaccgc acctactcta tttgtaatga
      721 aagaagtaaa atctacatat ctatatattc aagagcattt gcttgtattt atgacactcg
      781 tagctctgat aggaaccatg tgtggtatct taggaactat tatctttgcc cattgtcaaa
      841 aacaacgtga ctcaaacaaa acagtgccac aacaattgca ggattattat tccctacacg
      901 atttgtgcac ggaagactat acgcaaccag tggattggta ctgacattca ggtaagataa
      961 tctaaatatt ctctataaca taattgtaat gtgttttatg tttatagcta caaatgtttt
     1021 atgcaaaata cattttatga ggtcggatac ttattaaaag cattgtctta agtacattaa
     1081 aaggacattg tataaccgtg ctacttacag catggccttt ttaagacaaa cactgtggat
     1141 tttatggaca tttaccatgg tcattggcca ggacaatgaa aagtgttccc aaaaaacctt
     1201 aattggatat agacttaaaa tgtctcgtga cggtgacatt gcagttggag aaacagtgga
     1261 attacgttgt agatctggat acactactta tgcccgcaat ataacagcaa catgtttaca
     1321 aggtgggacg tggtctgaac caacggcaac atgtaacaaa aagtcctgtc caaacccagg
     1381 tgaaatacaa aatggaaagg ttatatttca tggtggacaa gatgccttaa aatatggggc
     1441 aaacatttca tatgtttgta atgaaggata ttttttggtt ggtcgagaat acgtgcgata
     1501 ttgtatgatt ggagcatctg gccaaatggc gtggtcatct tctcctcctt tttgtgaaaa
     1561 agaaaagtgt cacagaccga aaatcgaaaa tggagatttt aagcctgata aagattatta
     1621 tgagtataat gatgcagttc attttgaatg taatgaagga tatactctag ttggaccaca
     1681 ttccattgca tgtgcagtta ataacacgtg gacatctaac atgccaacct gtgaactcgc
     1741 aggctgtaaa tttccatcgg tgactcatgg ttatccaatc caaggttttt ctcttactta
     1801 taaacataag caaagtgtta cttttgcatg caatgatgga tttgttctca gaggatcccc
     1861 cacaattacg tgtaacgtta ctgaatggga cccaccactt cctaagtgtg ttttggaaga
     1921 tatagatgat ccaaacaatt caaatcctgg acgtttgcat ccaacaccca atgaaaaacc
     1981 aaatggtaat gtctttcaac gctcaaacta tacagaacct ccaacaaagc ctgaagacac
     2041 ccatacagca gctacttgtg ataccaactg tgaacagcca cctaaaatcc tgccaacatc
     2101 cgaaggtttt aatgagacta ccacatctaa tacaattaca aaacaattag aggatgagaa
     2161 aactacatcc cagccaaata cacatattac atctgcctta acatccatga aagcgaaagg
     2221 taactttacc aacaagacca ataactctac tgatctacat atagcgtcta cacccacttc
     2281 ccaagatgat gctacgcctt caatacctag tgtacagaca cccaattata atactaacgc
     2341 accgacacgt acactaacgt ctctccatat tgaagaaggc ccatccaatt ctactacttc
     2401 agaaaaggcc actgcctcta ctctctcaca caactcacac aaaaatgaca ccggaggcat
     2461 atacacaaca ttaaacaaaa caacacagtt gccatccact aataaaccta caaacagtca
     2521 agccaagagt tccactaagc cacgcgttga gacacacaat aaaacaacca gtaatcctgc
     2581 catttcttta acagattctg cagatgtgcc tcagagaccg cgagaaccaa cactccctcc
     2641 cattttcagg ccaccggcgt ctaaaaatcg ctatctggaa aagcaactag ttattggact
     2701 actaaccgct gtcgccctaa cgtgtggact gattacctta tttcactatc tgttctttcg
     2761 ttagcctaga cttgctccag tgttagacag ggctatgatt gcttctccac gctgtccacc
     2821 ttaacacttc ccaataacaa atccggtatg cagcagcgtg acactactaa tgtaacctaa
     2881 aaaatgtgca tgtggtatgt attgtactaa agataccgac caatacaaga caactaatat
     2941 taaccatagt gtgcgtttct ttgtataaaa tacgcgtgtg ggaaagcgac agaagggggc
     3001 ggcgtttcca tatgaggcca agtgcattgg ctattttagg ggcggtgacc acgcactata
     3061 gtgcgcggtg tggcagaaaa ttcacaccgt atataaacaa ggaaagggga ctctgcgcgc
     3121 ttaagcgcca agccattata cacacgggtt ttttgttgtc ttggccaatc gtgtctccat
     3181 ggcgctaaag ggaccacaaa ccctcgagga aaatattggg tctgcggccc ccactggtcc
     3241 ctgcgggtac ctctatgcct atgtgacaca caacttcccc ataggggaag cctccctgct
     3301 gggcaatggc tacccggagg caaaagtatt ttcactacct cttttgcacg ggctcacagt
     3361 ggaatccgat ttccccttaa atgtaaaggc ggtgcacaag aaaatcgatg caaccacagc
     3421 ttctgtgaaa ttaacttcat accacaggga ggccatcgtc tttcataata ctcacttatt
     3481 tcagccaatc tttcaaggaa agggactgga aaagttatgt cgagagagcc gagagctgtt
     3541 tggattttca acgtttgttg agcaacaaca caaagggacg ctctggagcc cagaggcatg
     3601 ccctcagcta ccctgcgcga atgagatttt tatggcggtc atagttacag agggattcaa
     3661 ggagagactg tacggcggca aactggtgcc cgtgccctct cagacaacgc ccgtacacat
     3721 tggggaacac caggcgttca agataccctt gtatgacgag gatctgtttg gtccaagtcg
     3781 cgcccaagaa ctatgtaggt tttacaaccc cgatatcagt agatacctac atgactccat
     3841 attcactgga atagcacagg ctctaagggt aaaggacgtt agcacggtca tccaagcctc
     3901 agaaaggcaa tttgtgcacg accaatacaa gataccaaag ctggtccaag ccaaggactt
     3961 cccccagtgt gcttccaggg gaaccgacgg gtctacccta atggtgatag acagtctggt
     4021 ggctgaactt ggtatgagtt atggtctgtc ctttattgag ggaccccagg atagctgcga
     4081 ggttctaaat tatgacacgt ggcccatctt tgaaaactgc gagacgccag atgcccgcct
     4141 tcgtgcacta gaagtttggc acgcagagca ggccttgcat attggcgccc agctgtttgc
     4201 ggccaactct gtgctctacc tgaccagagt ggcaaagctg cctcagaaga atcagagagg
     4261 agacgccaac atgtacaact cattctacct acagcatggc ctgggatacc tctcagaggc
     4321 aactgtaaag gaaaatggag cctctgcctt caagggcgtg ccagtgtctg cactggatgg
     4381 gtcatcttac accctccagc acctggccta cgcgtcctct ttctccccac atctcctggc
     4441 aaggatgtgt tactatctgc agttcttgcc ccaccataaa aacaccaaca gtcagtcata
     4501 caatgtggtg gactacgtgg gcaccgcggc acctagtcaa atgtgtgacc tgtgtcaggg
     4561 gcaatgtcca gctgtatgca tcaacacgct gttttacagg atgaaggaca ggttcccacc
     4621 tgttctgtca aacgttaaga gagacccata tgtgatcacg ggcacagcgg gaacgtacaa
     4681 tgacctagag attctcggaa actttgccac cttcagggag agagaggagg aggggaatcc
     4741 tgtggaagat gctccaaagt atacatattg gcaactatgc cagaatataa ccgagaagct
     4801 agcgtccatg ggcatctcgg agggcggcga tgccctaaga accctcattg tggacatccc
     4861 cagcttcgtc aaagtgttca aggggataga cagcacggta gaggcagagc tcctaaagtt
     4921 tattaactgc atgatcaaaa acaattacaa cttcagagag aacatcaaat ccgtccatca
     4981 catccttcag tttgcatgca acgtatactg gcaggcgccg tgcccggttt ttctgaccct
     5041 ttactacaag tcactgctga cggtcataca ggacatatgt ctgacgtcat gtatgatgta
     5101 cgagcaggac aacccggccg tgggaattgt accatccgag tggcttaaaa tgcactttca
     5161 gacaatgtgg accaacttca agggtgcctg cttcgacaaa ggagcaatca cgggcgggga
     5221 actaaaaata gtccaccagt ccatgttctg tgacctcttt gacaccgacg ctgccatagg
     5281 agggatgttt gcacccgctc ggatgcaggt caggatagcc agagcaatgc tcatggttcc
     5341 aaaaaccata aaaataaaaa acaggatcat cttttccaac tccaccggag cagagtcgat
     5401 ccaggcaggt tttatgaagc cggccagcca aagggattca tacatcgtcg gaggacccta
     5461 catgaaattc ctaaacgccc tgcacaaaac actttttcct tccacaaaaa cttctgccct
     5521 gtacttgtgg cataagattg gccagaccac aaaaaatccc atactaccag gtgtctcggg
     5581 ggaacaccta acggagttat gtaattatgt aaaggcaagt agccaggctt tcgaagagat
     5641 aaatgttttg gaccttgtgc cagacaccct gacctcatat gcgaaaataa aactaaacag
     5701 ttccattctc cgggcttgcg gacagacaca gttttatgca actactctct cttgcctttc
     5761 gccagtgact cagctggttc cggccgagga gtacccccac gtactggggc cagtggggtt
     5821 gtcatctcca gatgaataca gggtaaaagt cgccggcagg tctgtaacca ttgtacagtc
     5881 aacactgaag caagctgttt ccaccaacgg acgactccgg cctatcatta ccgtgccact
     5941 ggtggtcaac aaatatacag ggagcaacgg gaacacaaac gtctttcact gtgcaaacct
     6001 gggatacttc tcggggagag gggtggacag aaatctcagg ccagaaagcg tcccctttaa
     6061 aaagaataat gtcagctcta tgctaagaaa acgccacgtg attatgaccc ccctggtaga
     6121 caggctggta aagagaatag ttggcatcaa ctctggggaa ttcgaggcag aagcggttaa
     6181 gagaagtgtg cagaatgtcc tggaagacag agataaccca aacctgccga agacagttgt
     6241 attagagttg gttaagcacc tagggagctc ctgtgcaagt ctcacagagg aggacgtgat
     6301 ttactacctg ggcccttatg ccgtacttgg ggacgaggtc ctgtcattac tgagcacagt
     6361 gggccaggcg ggggtgccat ggacggccga gggtgtggcc tcggtcatcc aggacataat
     6421 agatgattgc gagttacagt ttgtgggccc agaagagcct tgccttatcc aaggacagtc
     6481 ggtagtggag gagctttttc cgtccccggg cgtcccaagc ctgacagtgg gtaaaaaacg
     6541 aaaaatcgca tccctgctct ctgacctgga tttgtagttg tgtacccgta acgatggcaa
     6601 aggaactggc ggcggtctat gccgatgtgt cagccctagc catggacctc tgtcttctta
     6661 gttacgcaga cccggcaaca ctggacacta aaagtctggc cctcactaca gggaagtttc
     6721 agagccttca cggcacacta ctccccctcc tcagacgaca aaacgcacac gaatgctcag
     6781 gtctgtcact agaattggag caccttttgg aaaacgtggc tgatgctctg accacgttgg
     6841 gagtgtgcac tagcagaaaa ctgtctccag aagagcattt ttccctcctg catttggaca
     6901 taacatgcaa caagcaccgg agcgttaggt ttaattttta cggaaattgg gccttggagt
     6961 taaagctgtc actaataaac gacgttgaaa ttttctttaa acgtcttagt agcgtttttt
     7021 attgtatagg atcgggcagt gctctggagg gtttggggga ggtattgcgt ttcgttggga
     7081 agctgagggg tatctcaccc gtacctgggc cggacctata tgtctcaaat ctgccctgcc
     7141 tagaatgcct tcaggaagtg tgtctgactc ccaaccaggg caccagtctg caggccatgc
     7201 tcccagacac ggcctgcagt cacatatgta cccccgcatg cggtgagcct gtccggggcc
     7261 tctttgagaa cgagctaaaa cagctcgggc ttcaaacccc tgagtccata cctactaccc
     7321 cctgtcagtc ccgggtaagg caagatgatg aaatcagaca gagctctcta atggcggtag
     7381 gagatcacca cattttcgga gaggtgacca gatctgtcct ggaaatctca aacctgatct
     7441 attggagctc tggccactcg gatgccacct gcgacggaga cagagactgc tctcacctgg
     7501 cctcgctgtt tactcacgag gctgacatgc ataaaaggcg cgtcgacctg gccggatgct
     7561 tgggcgaacg cggcacgccc aaacactttt ttgactgctt tcgcccagac tccctagaaa
     7621 cccttttctg tggtggtctt tttagctccg tggaggacac catagaaagt ctccaaaagg
     7681 actgctcttc tgccttctac caacaggtaa actacactac tgcactgcaa aaacagaacg
     7741 agttttacgt ccgactcagc aaactgctgg cagctggtca gctaaatttg ggcaaatgtt
     7801 ccactgaaag ttgcccatcc gaggcccgta ggcagctggt aggtggggac aaaccagagg
     7861 aagtgctgag ggatgcaaaa caccggcaag aactatacct tcagaaagtg gcacgcgacg
     7921 gttttaaaaa actctctgat tgtataagac accagggcca catcctgtct cagaccctgg
     7981 gtctaagact gtgggggtct gtcatctaca acgaggcatc tgccctacaa aaccactttt
     8041 tacacagagc acagttcata tccctcccct ggcaggacct gacggtcgac tgtccaacgc
     8101 ggtttgaaaa ttctaaatat atcaaaaatt ctctgtactg ccagcgtctg gggcgggaac
     8161 acgtagagat cctgacactg gagttctaca aacttatcac gggcccgctg tcaaagcgac
     8221 atactttatt tcccagtcct ccaaatgtga cgctggctca gtgcttcgag gctgcgggca
     8281 tgcttcccca tcaaaagatg atggtatcag agatgatctg gcccagcata gagccgaagg
     8341 actggataga gcccaacttc aaccagttct atagctttga gaatcaagac ataaaccatc
     8401 tgcaaaagag agcttgggaa tatatcagag agctggtatt atcggtttct ctgtacaaca
     8461 gaacttggga gagggagcta aaaatacttc tcacgcctca gggctcaccg gggtttaagg
     8521 aaccgaaacc cgcaggactc acaacggggc tgtacctaac atttgagaca tctgcgccct
     8581 tggtgttggt ggataaaaaa tatggctgga tatttaaaga cctgtacgcc cttctgtacc
     8641 accacctgca attgagcaac cacaatgact cccaggtcta gattggccac cctggggact
     8701 gtcatcctgt tggtctgctt ttgcgcaggc gcggcgcact cgaggggtga cacctttcag
     8761 acgtccagtt cccccacacc cccaggatct tcctctaagg cccccaccaa acctggtgag
     8821 gaagcatctg gtcctaagag tgtggacttt taccagttca gagtgtgtag tgcatcgatc
     8881 accggggagc tttttcggtt caacctggag cagacgtgcc cagacaccaa agacaagtac
     8941 caccaagaag gaattttact ggtgtacaaa aaaaacatag tgcctcatat ctttaaggtg
     9001 cggcgctata ggaaaattgc cacctctgtc acggtctaca ggggcttgac agagtccgcc
     9061 atcaccaaca agtatgaact cccgagaccc gtgccactct atgagataag ccacatggac
     9121 agcacctatc agtgctttag ttccatgaag gtaaatgtca acggggtaga aaacacattt
     9181 actgacagag acgatgttaa caccacagta ttcctccaac cagtagaggg gcttacggat
     9241 aacattcaaa ggtactttag ccagccggtc atctacgcgg aacccggctg gtttcccggc
     9301 atatacagag ttaggaccac cgtcaattgc gagatagtgg acatgatagc caggtctgct
     9361 gaaccataca attactttgt cacgtcactg ggtgacacgg tggaagtctc ccctttttgc
     9421 tataacgaat cctcatgcag cacaaccccc agcaacaaaa atggccttag cgtccaagta
     9481 gttctcaacc acactgtggt cacgtactct gacagaggaa ccagtcccac tccccaaaac
     9541 aggatctttg tggaaacggg agcgtacacg ctttcgtggg cctccgagag caagaccacg
     9601 gccgtgtgtc cgctggcact gtggaaaacc ttcccgcgct ccatccagac tacccacgag
     9661 gacagcttcc actttgtggc caacgagatc acggccacct tcacggctcc tctaacgcca
     9721 gtggccaact ttaccgacac gtactcttgt ctgacctcgg atatcaacac cacgctaaac
     9781 gccagcaagg ccaaactggc gagcactcac gtccctaacg ggacggtcca gtacttccac
     9841 acaacaggcg gactctattt ggtctggcag cccatgtccg cgattaacct gactcacgct
     9901 cagggcgaca gcgggaaccc cacgtcatcg ccgcccccct ccgcatcccc catgaccacc
     9961 tctgccagcc gcagaaagag acggtcagcc agtaccgctg ctgccggcgg cggggggtcc
    10021 acggacaacc tgtcttacac gcagctgcag tttgcctacg acaaactgcg ggatggcatt
    10081 aatcaggtgt tagaagaact ctccagggca tggtgtcgcg agcaggtcag ggacaaccta
    10141 atgtggtacg agctcagtaa aatcaacccc accagcgtta tgacagccat ctacggtcga
    10201 cctgtatccg ccaagttcgt aggagacgcc atttccgtga ccgagtgcat taacgtggac
    10261 cagagctccg taaacatcca caagagcctc agaaccaata gtaaggacgt gtgttacgcg
    10321 cgccccctgg tgacgtttaa gtttttgaac agttccaacc tattcaccgg ccagctgggc
    10381 gcgcgcaatg agataatact gaccaacaac caggtggaaa cctgcaaaga cacctgcgaa
    10441 cactacttca tcacccgcaa cgagactctg gtgtataagg actacgcgta cctgcgtact
    10501 ataaacacca ctgacatatc caccctgaac acttttatcg ccctgaatct atcctttatt
    10561 caaaacatag acttcaaggc catcgagctg tacagcagtg cagagaaacg actcgcgagt
    10621 agcgtgtttg acctggagac gatgttcagg gagtacaact actacacaca tcgtctcgcg
    10681 ggtttgcgcg aggatctgga caacaccata gatatgaaca aggagcgctt cgtaagggac
    10741 ttgtcggaga tagtggcgga cctgggtggc atcggaaaaa cggtggtgaa cgtggccagc
    10801 agcgtggtca ctctatgtgg ctcattggtt accggattca taaattttat taaacacccc
    10861 ctaggtggca tgctgatgat cattatcgtt atagcaatca tcctgatcat ttttatgctc
    10921 agtcgccgca ccaataccat agcccaggcg ccggtgaaga tgatctaccc cgacgtagat
    10981 cgcagggcac ctcctagcgg cggagcccca acacgggagg aaatcaaaaa catcctgctg
    11041 ggaatgcacc agctacaaca agaggagagg cagaaggcgg atgatctgaa aaaaagtaca
    11101 ccctcggtgt ttcagcgtac cgcaaacggc cttcgtcagc gtctgagagg atataaacct
    11161 ctgactcaat cgctagacat cagtccggaa acgggggagt gacagtggat tcgaggttat
    11221 tgtttgatgt aaatttagga aacacggccc gcctctgaag caccacatac agactgcagt
    11281 tatcaaccct actcgttgca cacagacaca aattaccgtc cgcagatcat ggattttttc
    11341 aatccattta tcgacccaac tcgcggaggc ccgagaaaca ctgtgaggca acccacgccg
    11401 tcacagtcgc caactgtccc ctcggagaca agagtatgca ggcttatacc ggcctgtttc
    11461 caaaccccgg ggcgacccgg cgtggttgcc gtggacacca catttccacc cacctacttc
    11521 cagggcccca agcggggaga agtattcgcg ggagagactg ggtctatctg gaaaacaagg
    11581 cgcggacagg cacgcaatgc tcctatgtcg cacctcatat tccacgtata cgacatcgtg
    11641 gagaccacct acacggccga ccgctgcgag gacgtgccat ttagcttcca gactgatatc
    11701 attcccagcg gcaccgtcct caagctgctc ggcagaacac tagatggcgc cagtgtctgc
    11761 gtgaacgttt tcaggcagcg ctgctacttc tacacactag caccccaggg ggtaaacctg
    11821 acccacgtcc tccagcaggc cctccaggct ggcttcggtc gcgcatcctg cggcttctcc
    11881 accgagccgg tcagaaaaaa aatcttgcgc gcgtacgaca cacaacaata tgctgtgcaa
    11941 aaaataaccc tgtcatccag tccgatgatg cgaacgctta gcgaccgcct aacaacctgt
    12001 gggtgcgagg tgtttgagtc caatgtggac gccattaggc gcttcgtgct ggaccacggg
    12061 ttctcgacat tcgggtggta cgagtgcagc aacccggccc cccgcaccca ggccagagac
    12121 tcttggacgg aactggagtt tgactgcagc tgggaggacc taaagtttat cccggagagg
    12181 acggagtggc ccccatacac aatcctatcc tttgatatag aatgtatggg cgagaagggt
    12241 tttcccaacg cgactcaaga cgaggacatg attatacaaa tctcgtgtgt tttacacaca
    12301 gtcggcaacg ataaaccgta cacccgcatg ctactgggcc tagggacatg cgaccccctt
    12361 cctggggtgg aggtctttga gtttccttcg gagtacgaca tgctggccgc cttcctcagc
    12421 atgctccgcg attacaatgt ggagtttata acggggtaca acatagcaaa ctttgacctt
    12481 ccatacatca tagcccgggc aactcaggtg tacgacttca agctgcagga cttcaccaaa
    12541 ataaaaactg ggtccgtgtt tgaggtccac caacccagag gcggttccga tgggggcaac
    12601 ttcatgaggt cccagtcaaa ggtcaaaata tcggggatcg tccccataga catgtaccag
    12661 gtttgcaggg aaaagctgag tctgtcagac tacaagctgg acacagtggc taagcaatgc
    12721 ctcggtcgac aaaaagatga catctcatac aaggacatac ccccgctttt taaatctgga
    12781 cctgatggtc gcgcaaaggt gggaaactac tgtgttattg actcggtcct ggttatggat
    12841 cttctgctac ggtttcagac ccacgttgag atctcggaaa tagccaagct ggccaagatc
    12901 cccacccgta gggtactgac ggacggccaa cagatcaggg tattttcctg cctcttggag
    12961 gctgctgcca cggaaggtta cattctcccc gtcccaaaag gagacgcggt tagcgggtat
    13021 cagggggcca ctgtaataag cccctctccg ggattctatg acgaccccgt actcgtggtg
    13081 gattttgcca gcttgtaccc cagtatcatc caagcgcaca acttgtgcta ctccacactg
    13141 atacccggcg attcgctcca cctgcaccca cacctctccc cggacgacta cgaaaccttt
    13201 gtcctcagcg gaggtccggt ccactttgta aaaaaacaca aaagggagtc ccttcttgcc
    13261 aagcttctga cggtatggct cgcgaagaga aaagaaataa gaaagaccct ggcatcatgc
    13321 acggaccccg cactgaaaac tattctagac aaacaacaac tggccatcaa ggttacctgc
    13381 aacgccgttt acggcttcac gggcgttgcc tctggcatac tgccttgcct aaacatagcg
    13441 gagaccgtga cactacaagg gcgaaagatg ctggagagat ctcaggcctt tgtagaggcc
    13501 atctcgccgg aacgcctagc gggtctcctg cggaggccag tagacgtctc acccgacgcc
    13561 cgattcaagg tcatatacgg cgacactgac tctcttttca tatgctgcat gggtttcaac
    13621 atggacagcg tgtcagactt cgcggaggag ctagcgtcaa tcaccaccaa cacgctgttt
    13681 cgtagcccca tcaagctgga ggctgaaaag atcttcaagt gccttctgct cctgactaaa
    13741 aagagatacg tgggggtact cagtgacgac aaggttctga tgaagggcgt agacctcatt
    13801 aggaaaacag cctgtcgttt tgtccaggaa aagagcagtc aggtcctgga cctcatactg
    13861 cgggagccga gcgtcaaggc cgcggccaag cttatttcgg ggcaggcgac agactgggtg
    13921 tacagggaag ggctcccaga ggggttcgtc aagataattc aagtgctcaa cgcgagccac
    13981 cgggaactgt gcgaacgcag cgtaccagta gacaaactga cgtttaccac cgagctaagc
    14041 cgcccgctgg cggactacaa gacgcaaaac ctcccgcacc tgaccgtgta ccaaaagcta
    14101 caagctagac aggaggagct tccccagata cacgacagaa tcccctacgt gttcgtcgac
    14161 gccccaggta gcctgcgctc cgagctggca gagcaccccg agtacgtcaa gcagcacgga
    14221 ctgcgcgtgg cggtggacct gtacttcgac aagctggtac acgcggtagc caacatcatc
    14281 caatgcctct tccagaacaa cacgtcggca accgtagcta tcttgtataa ctttttagac
    14341 attcccgtga cttttcccac gccctagtga ctcagacgcg gaaacagcgc ctagaaagtt
    14401 tcctcttgcg ctatgtggga caactagagt ccaacctggc aagcagtgga gcaagacgcc
    14461 agacagccga tctcgaaaaa aataatgcag acagaggcaa cgttcatcct aggtgactgg
    14521 gagataacgg tgtctaactg ccggtttact tgcagcagcc taacatgtgg ccccctttac
    14581 agatctagcg gcgactacac gcggctaaga atccccttct ctctggatcg actaatacgt
    14641 gaccatgcca tctttgggct agtgccaaat attgaggatc tgttaaccca tgggtcatgc
    14701 gtcgccgtag tggccgacgc aaacgccaca ggcggcaacg cgcgacgcat cgtcgcgcct
    14761 ggcgtgataa acaatttttc agaacccatc ggcatttggg tacgcggccc tccgccgcaa
    14821 acgcgcaagg aagctattaa gttctgcata ttttttgtca gtcccctgcc cccgcgggag
    14881 atgaccacat atgtgttcaa gggcggcgat ttgccccccg gagcagagga acccgaaaca
    14941 ctacactccg ccgaggcacc cctaccgtcg cgcgagacgc tggtaactgg acagctgcga
    15001 tccacctcgc cacgaacgta tacgggatac tttcacagtc ctgtcccgct ctcttttttg
    15061 gacctcctga cattcgagtc catggggtgt gaaaacgtgg aaggtgaccc cgagccattg
    15121 acacccaagt acttgacgtt cacgcagacg ggagaacgac tttacaaagt aaccgttcac
    15181 aacacccatt cgacagcatg caagaaggcc cgtattcgtt tcgtctacag accgacgccc
    15241 tccgcccgtc agcttgtcat gggtcaggct tcacccctca taacaacccc tctgggagcc
    15301 agggtattcg cagtctatcc agactgtgag aaaactatcc cacctcagga aaccaccacc
    15361 ctgaggattc aattgctgtt cgagcagcat ggtgccaacg ccggagaatg cgcctttgtc
    15421 atcatggggc tcgcccgtga aacaaagttt gtctcatttc ccgcagtact ccttccgggc
    15481 aagcacgaac accttactgt attcaaccca cagacacatc ctctgaccat tcaacgggac
    15541 acaatagtgg gcgtggcaat ggcttgctat atccaccccg gtaaggcagc cagccaggca
    15601 ccatacagct tctacgactg caaagaagag agctggcacg tggggctctt ccagatcaaa
    15661 cacggacctg gaggggtctg tacaccacct tgccacgtag cgattagggc cgaccgccac
    15721 gaggaaccca tgcaatcgtg actgtccgag cacatatggc gcaggagtca gagcagtgct
    15781 cccgtgcgtt tgcagtatgc agtagtaaac gacagctcgg gcgcggcgag cccgtatggg
    15841 attccgtcat tcaccctagc cacatcgtca tctctaatcg agtacccctc ttactaagag
    15901 aacagaacat atgtctccct tcgtgcccca gcgtcggcca gatcctccac agagcctacc
    15961 ccaactttac attcgacaac acgcaccgca agcagcaaac ggagacctac actgcattct
    16021 acgcttttgg ggaccaaaat aacaaggtta ggatcttgcc cactgttgtg gaaagctcct
    16081 cgagcgtgct gatttttaga ctacgcgcgt cggtctctgc gaacatcgcc gtgggagggc
    16141 tcaaaataat aatacttgct ctcaccctgg tgcatgccca aggagtgtac ctgcgttgcg
    16201 gtaaggacct ttctacacca cactgcgcac cggctattgt tcagcgtgag gtgctgagca
    16261 gcgggtttga gccgcagttt accgtaactg gcattccagt gacatcctcg aacttaaacc
    16321 aatgctactt tctggtaaga aagccaaaaa gccggctggc aaagccgttt gcacgcctgt
    16381 ccgcggagac gactgaggag tgtcgcgtca ggtctatccg cctcgggaag acacacctgc
    16441 ggatatcggt gactgcgcct gcgcaggaaa cgcccgtctg ggggctcgtg accacgagct
    16501 tcagccttac ccccaccgca ccgctggcct ttgatcgtaa cccgtacaat cacgagacat
    16561 ttgcctgtaa cgccaggcac tacatcccag taatctacag cggaccaaaa attacgctgg
    16621 ccccgcgcgg ccgccaggta gtctggcaca acaacagcta cacgtcctcc ctgccatgca
    16681 aagtcacagc catcgtgtca aaccactgct gtaactgtga catattttta gaggactcgg
    16741 aatggcgccc aaacaagcca gcacccctga aactggtgaa cacgagtgat catcccgtca
    16801 tattggagcc ggacacacac attggaaacg ccctcttcat catcgcaccc aaggcccgag
    16861 gtttacgcag actgactcgc ttaaccacaa aaaccattga acttcctggc ggggtaaaga
    16921 tagacagcag gaaattacaa acattcagaa aaatgtatgt tgccaccgga cgcagttagg
    16981 tgtccggttc ccacccacac atttgtcttt attgctttca aataaaacgg tgttctctca
    17041 acctcctacg ggctcactag tattgtgttc ccatacgcgc ctgtcgcccc aggatcaaca
    17101 cttcgtcccc tatccacccg aatacataac acacacaaag acatagtgac tgtagacagt
    17161 taatctttat tgtctagaca cgcaaagtat attagtgtta taagaaattt tatgtcacgt
    17221 cgctctttac ttatcgtgga cgtcaggagt cacgtctggg atagagttca aaacacgcac
    17281 cgcttgacct gcaaactttt ccattgcact cagaacataa aacgaagcaa agtgtctcac
    17341 ccaatactta agtccctgaa gcctccctaa tagaccgcgg tcaaatttgg gtggactgta
    17401 gtgcgtctta gtcagcttat tgagctcttc ctgtatgtcc catcctaagg tcttcgtcag
    17461 aagctccatg acgtccacgt ttatcactga ttttccaaac tccgtcgtta aaaacttaaa
    17521 caacacctcg aattcgaaaa agccatcggc gagcttttta aggcagctag tctcattaaa
    17581 tcctattaac ccgcagtgat cagtatcgtt gatggctggt agtttcagat gaaaaatagc
    17641 agcgggctct agaataccct tgcagatgcc ggtacggtaa cagaggtcgc ggaagcattc
    17701 atcgatcacc catagcatcc aattgagtct ctgaatgaga agatcctttt caaactcggg
    17761 ggcgtccggc aacttgcccc gcgttccaga taccagcagt gaaccgacca gcaagataga
    17821 ccacaacttg aaccagcgca tggctgctaa cgcggcatac actagccggt ggtgcccgag
    17881 cgggagttac gaagtctcac tgaagggcgg ggtcgcgggt cggggtcgct ccaaatcagg
    17941 caacgccgta tccgaactct gagtcacttt tatgtaggtc tcaaacatgt aaaagatacc
    18001 acgttcttga aaaaccctct cttgctcgcc aggcttgggg ttcacgcggg catacgcagc
    18061 caagctatca tgcgagagaa acacgtcaca ggcaaagtca tgtaaaaccc gggttaaaaa
    18121 tagcctaact ggccaggggc cagtgagcgc ctcccggtac aagttcccac ccccgatgac
    18181 ccaaaccttg tcaatttgct gtgctagctc tgggcttctc gccaacccaa gcgcggcatc
    18241 gagcgaactc gccaaaaagt gagcaccagg gggcggggtt tctaacgtgc gacttagaac
    18301 cacattgatt ctacccgcca atggtcgaca gcccgcggga atcgaaagcc atgtgcgccg
    18361 ccccataaca accatgtttt gttttccagg ggcacagtcg gtagtcagct gtcgaaaacg
    18421 cctcatgtct ccccgcaatg caggccacgg gagacatctg ttttttccga tcccgagttt
    18481 ggtatcaacc gcaactacac agtaaagtgt aggatccatg cagcgagggt ataggtaaac
    18541 accaccaacc acacagtgtg ctcttatata cttttaatga aacataaggg cagacgaaac
    18601 agccgaacgt ttcctaatca cgcccatgga accatagcca cccccaagca aaccctgtgg
    18661 aaggatatca actagagagg agggtccagc cttattatgg caggagacac tataagcccc
    18721 atcgcccgac tgggcaccaa cataaccgcc acagtaagtg gccctatacc gctcagcgcc
    18781 caagttgtta cagtcacacc caaccgcggt tggctctaca ttgtcatcac gtccatcatt
    18841 atgtgttggt tctcccgctt ccttgtaccc tgcagcttca tccacggatt cttctgagtc
    18901 gcgatgcaca ggagcgccat ccgcggggcc atcttggtcg cctggagctg cccccgcggg
    18961 cccctcctcg tcctggttat ccccacgggg aagaatttcc tgaagctcga tctcctctac
    19021 cgcacactct ggtgatgtcg gccgaggtct atatggaaac acttcaaccc gggtgtttac
    19081 agcagcgtat gcccgcccca cgtggcgcat catgtggaaa aacgcaccca acccaaaaac
    19141 gacaaacaat tggtaaaaca cgaaaaaaac gtagtacgcg gctgcagcga cgtgatctat
    19201 ctctgggtca tgaccgccca ctatatatag ccaaacccac gtcgcagcgg caaggccagc
    19261 ggcccccaat gtcatgatga aaataaaaac aatcagttcc agaccctcct ggtaagtcag
    19321 ccgaggcaat agcgtcattt cgcgcaaggg tcgccagacc acgcgcgtgt tgtatacgac
    19381 gccacatatc tgacaggccg tgtttctaga gatagtgagc caggtgctta aacaacttct
    19441 atggacgttc tcgagctctc ctgtgcatcc acaggctcta aatctctcat ttccgagctc
    19501 ctcgttgcaa atccagcaga caggaacatc ctcatcttcc atatcctgag agagaaccca
    19561 caataaaaca tggcattaac ccctgcaaca agtgaccgta ccagggcacg cgtccaggca
    19621 accggggtcc ccctcgttgg tctatacaat tccatgacta cctactggta atgctacagc
    19681 cactcactgt acaagccggt taactgggag gcgacgctgg cgtggtatcg gcaactgaaa
    19741 cacaccactc cactccaaac acttatgtac tttgtggctc ggctttattg taacagccaa
    19801 gaggggcgtt tgtggctcag ctttattgta acagccaaga gggacgtatg tggctatctc
    19861 acaaaaagtc accgattcat gtagacaacc cgctcccacg aattcggttt ttaaaaagcc
    19921 ctcacgtata cagacgggcc actaaacacg cacatgagcg ggcatcctgt ttccgccttg
    19981 acgcccacca ctctgaccgc acgctaaaca tcgccctacc tgctatactg ccatttccat
    20041 acgaatggta ggatgcgggc agtagtccac cagtctaaaa tcatcaggtg taaactcttc
    20101 catggaagaa acagaccgga gtatctccag gcgcggaaag ggacgtggag tgcgcgtcag
    20161 ctgcagccgt agtggctcta tatgcgtttt gtagatgtgg gcatctccca acgtgtgaat
    20221 aaactccccg ggtctaagac cagtaacatg agcaagcata taagttaaga gggaatagct
    20281 ggcaatgtta aaaggaactc ccaaacccat gtctcccgac ctctgataca gctgacagga
    20341 aagctcaccg tcagctacat aaaattgaca taacaagtga cagggcggaa gcgccatcaa
    20401 cgacaagtcc gccgggttcc acgcacacat aatgattctt ctatcgtgcg gattattttt
    20461 tattaaatcc acaatgtacg acaattggtc aaacccctgg cctgtatagt cagcatccgc
    20521 gtccacgtac gccgccccaa agtgcctcca ctggaaaccg taaacaggtc ccaaatcccc
    20581 ctcccttctg tgcgccaggc cgcgcccggc caggaactcc ctggagccat ttttgtccca
    20641 tatcttgact cctgttcttg aaagctccct ggagtcagta ctccccttca gaaaccaaag
    20701 cagctcttgc actacgcctc gccaaaacac ccgctttgtg gttagtaagg gaaagtggtc
    20761 ccgcagacta tacctggcct gcatgccaaa tagagagagg gtgcctatgc cggtgcggtc
    20821 gagtcgatcg ctgccacggc acaaaatttc cctcaactgc ctgagatact gaagttcctc
    20881 gtggggcgtc tcagccccag ttacctcatg ctgaatcgaa caagggtcaa cctcgggggc
    20941 caaagccaag acgccaggct tttgacagaa gcgaaacccc ctggcacgga ataacttttt
    21001 ggcgacatac aagcttaaag gtacaaacgg aaacatgata gatcctggaa gtttgtgaag
    21061 ccctgtgccc ggagagacac ccctcaactc gcagtgctcg gagacctaca tgtatactca
    21121 ggctcttcta taaaccctcc ccaaaagttt ataaaacacc gtacgtaata cacattactc
    21181 acagttccca cggtgacgcc caaacccatg cacacgggcg tgatcgatac cagaaaacat
    21241 cacaagaaca aaaagtgtgt gtctgacatt cacatttatt tttacaagac aattttgtgc
    21301 agtagagttg tgccttccga caccccgcgc cgttcgctgt tctcctgtaa ttgggagatc
    21361 ccactccttg gcaggcacgt ttcacgaaac gctcttgtct cgctggcctt agacttgtgg
    21421 acccaacatg ggtatcgtta gagatccgtc gcgtaaatgc gcagctggca aagcattctt
    21481 cagcgagcag tgactggtaa ttgctgcatc agcttcttca cccagtcttt cgatttgtcg
    21541 gcacacacct ggcgaccacg ctttgtcaaa aatatcacac ccggcttgct gcacagttgg
    21601 gaggtggggt accagctgga cagaagcacc tgtggtaatg gtcttttctg gtaaccgaga
    21661 cagcacttgt ccggtctatg ccaggacgct cccagcgtgt ccccagattg caaacaaagc
    21721 aaggcagtca gcacagcgac gagcaggatg cccttggtgt ccataactcc cctcgtgtgt
    21781 cctcgtgtaa atgcgaaacg gcgatgttag gtcaggcgcg gtaaacagct caactcggtt
    21841 caaaacacgt acgtgatgta gtgctggttc tacgacgcct acctgtaaac tccaggatcc
    21901 tgggctttta ttacgaaggc caacacccca aaaaatccac gcccccgtga ccgcaggggc
    21961 ggttactaac gacggttaca ggtccctccc gagccacgca cctgccatgt aacctgcaag
    22021 gtaaccagac aaacatctag gaagcgtaaa tatccccagg taggagaagt attgcatatg
    22081 tcacagactc aacacacacg ggccgttacg caacggctag gggcataacc ctttaccggc
    22141 gcgaagcgct acgcgcttcg cgagaggtat ctccgtgtgc ttctccatca gaagacgcgt
    22201 gcgccgcttc gcaggcgacc cgcatacttt ccgccccgag tgcgttacaa aaatgactgc
    22261 cttctggcga caatacacgg tggacgtcca gtaccacccg catatcagct tatccggtgg
    22321 caatctggca ctggacaggg aattctcgca acaatccgag gccatgatgg tggcaggacc
    22381 gctggccgca catagctcaa tcacggccac ccagaagagc agccccaaat gtgcgcgcaa
    22441 cacccagcac atgctccaca tacagttctg gcgccacaac gatgatgcgc aaaggggtgc
    22501 attaccctaa atcccagcct agttataaat tattgaagcc caggcgacca ggggtcgccg
    22561 cgcttttcct ccccaaacgc gacgataaag accagcgttg ccaaatgtaa cttatgtata
    22621 acccaaaata ttgcgcatcg ataaggtttg ccaaaacacc cgaaagtaca cacacaaaaa
    22681 aacagcaaca agacgctcac tagacattca ccccttcccc cacccccgaa aacaaaacaa
    22741 cttgacacag gggaaacacc aggggcggcg gaggttgtca atagtgtcca gtatttcgtt
    22801 agacgcgggt tcttggaccc gatgtcccag gtcattaaag tctcaaatgg gattaaagga
    22861 tcatagttcc caggtttaat actccaagct atcccagaac aggaccccgg cagaaccccg
    22921 ctaacagcac caaatccact tgcggtccca gaaaaggtcg ccgaggtggc aaggtgactg
    22981 aaaaggtcat agagaggaca ccggtcccat ttcccacggt ccaaaaatcc agcgcgcccc
    23041 accggctttc cgagaacttc ggcaaagcta atttgcatgc gctaatcctt ttatgtgcat
    23101 aaattatgta gatgaggagt cgcgcatgcg cagaaaaatt cagagcgccg ggtgcacggg
    23161 gtcacctcca ggtcacgccg ctaggtggga ccgtgagcga ctcgaaaaat tataattttt
    23221 ggccatttta tgggcgccgc catcttgaat ttgctaatcc cccgtaatcc tctgcccctc
    23281 tcccattggt ccgccggccc gtcaatcaaa gttttccgag ccgccattgg cccattcggc
    23341 cgaccaatcc cgttcgagct aggcgaccgc gccattccat tggacgcccc agccgtcaat
    23401 caaattcgga ggcctcccat tggcccctat ccctagaact cccaagctga ttggcccaca
    23461 gcgggaacca atcagcgatt agagttttgt tttgattttt cctatatata tatatataat
    23521 cctttaatcc tagcgcagct gagtcatcgc agcccctatt ccagtaggta tacccagctg
    23581 ggtaatccag taggtatacc caggtgggtg aacccagctg ggtataccca gctgcaattc
    23641 tataattaaa caaggtagaa accaacgggg tcctcaggtg gtatttccgg aagcattacc
    23701 aaataaggca acctcagctg ggaataccag cggactaccc ccaactgtat tcaaccctcc
    23761 tttgttttcc ggaagtatat ccatttatgg aaatcagctg ggtcactcta ctgggttatt
    23821 ctttataata gggcccgatg agtcatgggg ttgggatttt tctactaggt cgtttcggtg
    23881 gatgggtgcc aggattatag gggccctgtc cacggggttg ttcggtggcg gggggggggg
    23941 ggggggctag tgagtcacgg gcctggaatc tcgcctctgg gtggtttcgg tagatggggg
    24001 ccgggaggat ggggccccgc ccaccgctgg cgcgccccag aacatgggtg gctaacgcct
    24061 acatgggcag cttgtcctac ggttacgccc atttgagacg ggttaaccaa ctgttacacc
    24121 ccttcgccgg gaacgctata aaaacgaggg acagcagccc ccctcgcgca ctgcgcgcgc
    24181 ggcggcacgt gggacggatc tcttggattt acccgtaacg aggagcggcg caccccagga
    24241 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24301 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24361 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24421 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24481 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24541 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24601 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24661 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24721 gccccggcag caccccagga gccccggcag caccccagga gccccggcag caccccagga
    24781 gccccggcag caccccagga gccccggcgc gccccccccc cccccccgga gggggatccc
    24841 ggcgcgccac cctcccccgg agggggatcc cggcgcgcca ccctcccccg gagggggatc
    24901 ccggcgcgcc accctccccc ggagggggat cccggcgcgc caccctcccc cggaggggga
    24961 tcccggcgcg ccaccctccc ccggaggggg atcccggcgc gccaccctcc cccggagggg
    25021 gatcccggcg cgccaccctc cccggcaaca acctgttgcc atgtatggcg atttgtatca
    25081 gtcacaagca cacaacccct gctagtatta atggtgttta aaacgttcta cacgtacggc
    25141 ggaccgcatc cgtcgcaagc acgcgcatat aacccccaaa tgcaccatga tgagaagcac
    25201 agccacgcgt caaaaaactt taaaaacatc gttatccaat atcattaaaa accacaccga
    25261 aatttacaca ggtagcacgt caccgtgtta gtgtcaccca ctgtacacaa ggcgtgtcgt
    25321 atatgtagta taggtatttg atgaggcgga agcatatccc gcttccagcg aacggaaata
    25381 agaatcatcc attccagcat ttattcaaag ggggcacaga ggattcacat tgtttagaga
    25441 gagtttttct tagtcaccat tccatacttg ggcagtattg gcctacgatt tgggcgacgt
    25501 ttcaggctgg tctattctcc gtccactttt ccccggctat tctgtcccag cataggctct
    25561 tgaaataaac aatgtttacc gagtaaaagg ttccactcac cctcatttgt cgttgcaccc
    25621 atcccccctt tgcttaatca cccgaaaact agaggacacg gatggaaaac atatcgcacg
    25681 cgggttgttt gaaagtcaac agctacttgt ttttaatgag gacagatttg ggcacaggcc
    25741 agagggtaaa gccctacgtg tgcgcggggg gggggggggg gggggtgtat acgctgcgaa
    25801 aacctgcacg gtgcataaca cccagggcgt cacgtcacat atctctgtgc acccaagtgg
    25861 ttgttcaacc gttgtttttt ggatgatttt tccgcaccgg cttttttgtg ggcgcgcata
    25921 ggtcggtacg cgctgtcccc ctaagtcccg cacggtcgtt cgggcccccg tccggctcgt
    25981 ctccggatga accgtcacgt tctttgtctc cagaggcgac gtctccttca gatgactcgt
    26041 ccgtgggctc ctcgtccgtc ccgcccgcgg gtccgacaag gaccgtcaat tcgatgttat
    26101 cttcgttcgc ggttggccgg cgcggccgtc ggtatggcag tacggtcacc cgggtgttat
    26161 ttgccgcgta taatgccctc acagtgccac ttacgcggca tatgccgcca aatgcaaaca
    26221 caataaatat ttggtaaaac ccaaagaagc agagaaaacc gagcacggcc ccgggggaga
    26281 atgttcccgc aggagcagtt aggatgacca ggagcgtcca ggtgcacaac gccacgccga
    26341 caagcccagc caccaccaca gacatcagca aaaacagttc aaaaatttct tggcgctcca
    26401 tctccggcca caggttaagg cgactacgcc actgcgtgcg cgtgcggtat ataacgcgac
    26461 acatttgaca ggccgtgttt cgagacactg ttagccaagt gcttaaacac tgcgggtgga
    26521 cgacatccag ctctccggta caggcgcagg ggtgtatgcc ctcgttcccc acctcttccc
    26581 tacatatcca gcagatgggt ccctctacac cctcttctac gtccttggac gccatctctg
    26641 cagctggggt ggaagtctga aaaagggaaa ggggaggtga gcagagtgcc cagttagtct
    26701 ccgacccgcc gtccgcccta ctgtcgctat cccgccttga cagatgtcta acgtattcac
    26761 ggacgccaca tgtgtgtcta ttttcctaca tccaggcttt ccctggaaaa ctgtcacaac
    26821 ccaccctgct ttagctctac atctgtattt ttgtttacgc acaggatcaa cgcttcgtgc
    26881 ccgtccaccc ccgcgctctc cgcctgtgtt tggaggtttt atgagtggtt agttctaggc
    26941 agctccggac aagttgtcca aaacacggcg cgccccgccc ttccttccct ccggatccgc
    27001 ccacaccgga cctatgaaat aagggacacg cgtcatcact agttatgaga gaaaaaccac
    27061 aacagcttta ttggaaaaca cctgagtgga tcccccaccc cccgcgtacg acaggcgttt
    27121 ctgtggtgcg cttctgggaa aaacgttttt cccccatttc ttcctcgaca ggtcttctaa
    27181 ggtagataaa tcccccccct ttgcgcgtct cctagaatgg cctaggcgca cgatggcgtt
    27241 gtcgcctcga gcagttgggc cgcagtgata tcttcaactt tcgaccgtct aagctatggc
    27301 aggcagccgc tgcatcagct gcctaaccca gtttttggaa gggtctgcgc agatctgacg
    27361 ccctcgcttg gtcagcaaaa taactccggg ttttgggcac gctggggacg tgggatacca
    27421 ctcttttaga atttggacgg gcggtgggtg ctgctggaac ccgtagcagc agctattagg
    27481 cgtgtacgac acgagtgacc ccgcgctttc tgtgggcgtc aggtaaaacg tggcaagcag
    27541 tacgctaacg cagcataaaa cgtggacggg ggccatctgg aggtgccaag ttcgcaacag
    27601 tctaaagaaa accgtaaagg ctatttgggg tttctgttct gtcagatgta acgccgagtt
    27661 ccttatatgc ttacctgatt ctggtctcac ctgtttattt atagtggcgt atgctaaccg
    27721 ccagcttaca tgcgggataa gttggcctaa ctcaccaaaa acgggttgca gacaaaagtg
    27781 attgttgggg cgcttactta gaaggtgtga gggtttctaa gaaaccccgc caacgcccgg
    27841 aaaccgcatg cgttccagtc ggtgcggcct gcgccggcgt cgctgtggcg cctttgtggg
    27901 ctttgagttc tgtcattaag ccaggtttcc attgccaccc gggcgaaaac aagccgggta
    27961 gtttcagggg tcatctggcg atcagtgtac catattccca cgacccatca acaccgctgc
    28021 ttgaggcgtg tctctgtatg tgtcaccgga gactgcatgt atcgtgcata tctgtattgt
    28081 gcgcttgcgc ggagacaaca taccgacgac caagtcaggg gtcacctcca gtgcacgccg
    28141 ctaggtggga ccgtgggcga gccgaaataa ttatatattt ttttggcacg gttgtgagca
    28201 acgccatcgt gagttggtta ataccctcta aacgcatagt ctttttttat ttgtcaacca
    28261 accagtcaat cacctgtcat cgccgctcag aagcacacgt cttcggccaa tgccgtgttg
    28321 gcgggtttga ccacggttac tgataggtag acgagtccga caatcacaca cgtccgccag
    28381 cgatttgcag cgcagctaaa atcgcgtggc cgggttggta gaagcaaatt atccaatggt
    28441 cgtgtttggg tttgttttgg ggttatctac atattatatt ccttatcccg actggttgcg
    28501 gaagtattcg cagcttggct actctgctcg attaccccgt gaataactgg gcggggggtg
    28561 acccaacata gtgattcggt agatttgggg gactggatga acattaatga aagtttatta
    28621 atgttcatcc gtattgtgta tatgtaattt ggtttccata tttggtagga gtatggagtt
    28681 ttcttatgga ttattaaggg tcagcttgaa ggatgatgtt aatgacataa aggggcgtgg
    28741 cttccaaaaa tgggtggcta acctgtccaa aatatgggaa cactggagat aaaaggggcc
    28801 agcttgagtc agtttagcac tgggactgcc cagtcacctt ggctgccgct tcacctatgg
    28861 attttgtgct cgctgcttgc cttcttgccg cttctggttt tcattggtgc cgccgattgt
    28921 gggttgattg cgtcgctttt ggcaatatac ccatcctggc tttcggctag gttttccgtc
    28981 ctacttttcc cacattggcc tgagagctgt agtacaaaaa acaccgcgcg gtctggagct
    29041 ctccataagc ccgcagaaca aaagctgcga tttgcccaaa aaccttgcca tggcaactat
    29101 acagtcaccc cttgcgggtt attgcattgg attcaatctc caggccagtt gtagccccct
    29161 tttatgatat gcgaggatac ttaacgtgtc tgaatgtgga atataatgtg aaaggaaagc
    29221 agcgcccact ggtgtatcag aacagtggtg cactacctat ctgctcattc gttgtttcgg
    29281 ttctgtgttt gtctgattct tagatagtgt tgaggtaatt ctagaaagcg gattgagtgt
    29341 aaatcgggcc actttgccct aaatgtgaca atctggatgt gtatcttatt ggtgcgttgt
    29401 gaagcatttt aaaatgcgtt ttagattgta tcaggctagt gctgtaatgg tgtgtttatt
    29461 tttccagtgt aagcaagtcg atttgaatga cataggcgac aaagtgaggt ggcatttgtc
    29521 agaagtttca aagtcgtgta agaacattgg actaaagtgg tgtgcggcag ctgggagcgc
    29581 tctttcaatg ttaatgtttt aatgtgtatg ttgtgttgga agttccaggc taatatttga
    29641 tgttttgcta ggttgactaa cgatgttttc ttgtaggtga aagcgttgtg taacaatgat
    29701 aacggtgttt tggctgggtt tttccttgtt cgcaccggac acctccagtg accagacggc
    29761 aaggttttta tcccagtgta tattggaaaa acatgttata cttttgacaa tttaacgtgc
    29821 ctagagctca aattaaacta ataccataac gtaatgcaac ttacaacata aataaaggtc
    29881 aatgtttaat ccatatttcc tgacttgtgt cttgacttgc gtcgattggg atgggggtgt
    29941 gggatggggg tgtgggatgg gggtgtggga tgggggtgtg ggatgggggt gtgggatggg
    30001 ggtgtgggat gggggtgtgg gatgggggtg tgggatgggg gtgtgggatg ggggtaaatg
    30061 acaatggggc gcttggtgac acatttgccc caccgtcgcc tgcccggaac cagcttggtg
    30121 atgtgctgtc tggctctcag gtgcacttta tgcaaagcag ttgaggcgca ttagatatat
    30181 aaaacttggg tacacaccct tggtgctgtg cgcgtgctat gtgccctggt gaccgtccac
    30241 aatggacgag gacgttttgc ctggagaggt gttggccatt gaagggatat tcatggcctg
    30301 tggattaaac gaacctgagt acctgtacca tcctttgctc agccctatta agctatacat
    30361 cacaggctta atgcgagaca aggagtcttt attcgaggcc atgttggcta atgtgagatt
    30421 tcacagcacc accggtataa accagcttgg gttgagcatg ctgcaggtta gcggcgatgg
    30481 aaacatgaac tgggggcgag ccctggctat actgaccttt ggcagttttg tggcccagaa
    30541 gttatccaac gaacctcacc tgcgagactt tgctttggcc gttttacctg tatatgcgta
    30601 tgaagcaatc ggaccccagt ggtttcgcgc tcgcggaggc tggcgaggcc tgaaggcgta
    30661 ttgtacacag gtgcttacca gaagaagggg acggagaatg acagcgctat tgggaagcat
    30721 tgcattattg gccactatat tggcagcggt cgcgatgagc aggagataac gcgtaattcg
    30781 aggtccccgg aagagtagag ggttgcatgt tatacaaaca acataaacat taaatgaaca
    30841 ttgttcaaaa cgtatgttta tttttttttt caaacagggg agtagggtag gaagggtacg
    30901 tctaatacgt aactgttcgc tactgcttgt tcaggagctc ctcgcagaac atcttgcgaa
    30961 ttttagattt tggactagag cgactgctgg cttcaacgcg gttcgatgta gggttcggcg
    31021 taggagcgtc tttctccacc gccgcgcatg gtgtatgcgt ggtctccggt gcctgttgtt
    31081 ggatgctctg cgtgctggag gcgggggtgg gttcagcggg tggtgcgcca actaccgcga
    31141 gtcctgtaga gactggcggg tggctcacat gtggctgagc aaaaaggatg ggcgccgctt
    31201 gctggaactg accgtgtggc gcctgcacgt aaatgggtgg gtgtacgtag gttcctccgt
    31261 gctccttcat tgtcgggaat tgacacgggg ccgctgaatt ggcgtggggc ctgtagtgtg
    31321 gatctactgc ggctgctgct gcagaggagg acggcggtgg ccctgcgtgc caaccgttca
    31381 gtttcatctc tttgagttca gactgtattt ccgctatgtt ctttgacatg gacaagatat
    31441 ccttgtgata cgccggctcc tctcctggaa agaggtgtcc ttcgtcgtcc tctgcgccgc
    31501 gcttgcgctt ccccgtccta tatccaggca gctgtggcga gtaataccat ggatcgtatg
    31561 ggttcttgta agcgtagccg tatggtggcg ctgggtttga aacatacgaa ggtaggtgat
    31621 ggtcggtggg gaacatctgg cccccacacc ccattaggcc tggccctgaa agtgtatgtg
    31681 acatttttgc cgctgtggtc ttcattccat cgatgctgct ttgtagcatg ctcaggaagg
    31741 cggatttggg gatggatatg atatcctctt gaccagagct gttcatggct ggtctgggtg
    31801 gtgtgacggc ttggatgccg accgggaatt ggctggcctt taaatacgcc gggctcaata
    31861 tgctggccac acctctgtca gttttcaata ggtcgaggcg gtcccgtatg aagctggcat
    31921 ctatagcttt tgccattaag gtctccaggg gactgacgaa atttggtgtg gaaaggtcct
    31981 ccagcctgca gctacttacg tgctggagga tgtgggcgcg ctccgactta gatactgatg
    32041 agaatctgga aaccacccac tcggcgtcgt gtccgtacac ggccactgtg ccgcgtcggc
    32101 gccccagggc gcatagtgat acgtgttgaa acacgggacc gctgggagtc tgggataact
    32161 cgcggggatg tatagacgat aaagacagcc ccgggagcca cgtgtggagt atctccaaca
    32221 gtggttcctt agggagattt ttcacggggg ctctggccac gtgggaggtg tccgccagcc
    32281 tggatgccag ctctaggaag gctggcgacg tgatggctcc ggtgcagaaa ataccgtggg
    32341 acacttgaaa tagacccagt gtccagccca cttctgtctc tggtaggtgt tcgattgtta
    32401 ttggaagggg ttctgtgact gggagataat ccgtcacctg atccggatcg agatagagct
    32461 cttgctccag cttggggcag gacacaacat ctacaaaccc tccgacgtac aggccctgtg
    32521 ccatgctcgg aaaatacgtg tgtgagaccg agccgctgag cccggggctt aggaggctca
    32581 tgtggcgctt tttgcaaaat aagaatttaa atacattcca cgcccaagag ctgcgtttta
    32641 tccacttggt tctctgcaag atgtacaatt tcggtctaaa tgtgtacctg ttaagggagg
    32701 ctactgccaa tgccgggacc tacgacgagg tggtcctggg acgcaaggtt cctgcggagg
    32761 tgtggaagct cgtgtacgat gggctcgagg agatgggcgt gtccagcgag atgctgctgt
    32821 gtgaggcata ccgggacagc ctctggatgc acttgaacga taaggtgggg ctcttgaggg
    32881 gcctggcgaa ttatctgttt caccggctag gggtcaccca cgacgttcgc atcgccccgg
    32941 aaaacctggt ggacggaaac tttttgttta atctgggaag tgtgctcccc tgcaggctgc
    33001 tccttgcggc gggctactgt ctcgcctttt ggggcagcga tgaacacgaa cgctgggtgc
    33061 gcttcttcgc ccagaagctt ttcatttgct acctgatagt ctccgggcgt cttatgccac
    33121 agaggtctct gctagtttgg gccagcgaaa cgggctatcc cggtccggtg gaggcagtct
    33181 gtcgcgacat ccgctccatg tacggcatac gaacgtatgc ggtctcgggt tatcttccgg
    33241 ctccgtctga agcgcagctg gcctaccttg gtgcgtttaa caacaacgcg gtttaaacga
    33301 ccgcgaggac caccggcagg cagccaagaa ccataaagta cgctctatcg tagtcatcgc
    33361 cgccgccaaa ctgggacttg ataatctcct ggaggagggt gggtggggat gggtgtgaaa
    33421 gcaggacgtc caggccctct tctgttgcca ggcggagggc tgttctcgcc tggagcagcg
    33481 ccagtggatc tcggaatgta agctgctggt tcaggatttc gaatatctca ttaaacctac
    33541 tgcctgtcag atttacaaat ggtccgggtt gtttgtggga cacggtcgat cgcgcctcga
    33601 gggcggccag tattatgcca gggaagatga aggacacggg ggcgtttgga ttagcctgca
    33661 gtgtggggat tatgtagtgc tccgatatga acgaaaatag ttggcccctt ttcagcatgg
    33721 gggcgtttgg atccggtagg gcaccgggct gaaatttggg tcccagcagg gataccaggt
    33781 tcaagcggcg gttcgggtgc cctcgcgcga cttgcccaaa ctccagcaat ccatacgcga
    33841 ggataaacac ctccagcgca acaatccccg ctcgcaggtt ccactggtat gcggaaaatg
    33901 gtggtatatc ggacccaaac atggcgctcg taatggcgaa taccaagtcc atggcgggcg
    33961 ctgtccctgg cgcgcccgta cccttgttgt ggggaaataa tccagcctta gccatcattg
    34021 cgtgaagctt gtggcgctgg aagaaggctg tcggatagcg gctctcctta ttgagaggcg
    34081 ccagcgaggc gcgctcctgg gggtttgagt atgtgaagct gaagtcccca ggaccgcttt
    34141 cctgttttag ctgagtgatt agcaggtcta gcttttgagg caggtctgct aacaggtcat
    34201 cgggagtagc gggcagttgc ctggatgtct tttgacaaaa gtacgcgttg acgaggcaaa
    34261 gcgcggcctg ggtgtccgtg agatgcctgg cgtcggcgaa aaagtcagcg gtggtcgagg
    34321 cgaccgtcgt cagggtgtga gagatgagtt tgagcgatgt ggaattctga aagttaacag
    34381 tcccctttag ttctttaggg aagacgcgcc gctgcatggc gttgtccgtg aggctgatga
    34441 accacggccc aaaggatggc aaccactgat tctggttcat gtacagggtg ggcatgagct
    34501 cgccgcgcag gtccctgtca acggagaagt gagggtcccc ggggacgatc gccacggtga
    34561 agttacggtg gctggcctgc gggggggatg tcactaaggg aggctcatgg gaacggcttt
    34621 ggggcatgtc tatgttgtca gaccatgtca tgttgcctat catctgtttc accgcgtcga
    34681 tatctgcgtt aatgacgcgg acgcgtgagt catggacctg aacaagccgg tccagctcta
    34741 gggaaagcag gtgtgccttt gtctttcgtt ctcgatttcg cacgagttgg ctgcgcagtc
    34801 caagggcgac ccttcttgtt tcttccatgg tgggcttgtg aataaacagc acgttttccg
    34861 ggtgtggggc ccagaatctt cccgcctctg tccatcttcg gttttttggg taccttagat
    34921 aggacctttc tgatgtcagc attttctcta gcagtgagaa aggcgcacaa ttttccttcg
    34981 gtggtgtgca ccggcgtggg aaacgccccg ggtgattcag agtatactgt ctttagtgtt
    35041 ttctgattct taaatatcag caggggcgtg atagtccacg cctcggtacc cggaggggcc
    35101 gagtgagcga tgtaatggat cgagtcggag agttggcaca ggccttgagc tcgctgtgac
    35161 gttctcacgg tgttggttgg gatcagctgg tgactcagac aagtcttgag ctctacaacg
    35221 taacatacgg gctgatgccc acccgatacc agaattacgc agtcggcaat tctgtgccct
    35281 agagtcacct caaagaataa tctgtggtgt ccaaggggag ggttctgggg ccggctactt
    35341 agaaaccgcc atagatcggg cagggtggag tacttgagga gccggcggta ggtggccagg
    35401 tgggcccggt tacctgctct tttgcgtgct gctggaagcc tgctcaggga tttcttaacc
    35461 tcggcctcgg ttggacgtac catggcagaa ggcggttttg gagcggactc ggtggggcgc
    35521 ggcggagaaa aggcctctgt gactagggga ggcaggtggg acttggggag ctcggacgac
    35581 gaatcaagca cctccacaac cagcacggat atggacgacc tccctgagga gaggaaacca
    35641 ctaacgggaa agtctgtaaa aacctcgtac atatacgacg tgcccaccgt cccgaccagc
    35701 aagccgtggc atttaatgca cgacaactcc ctctacgcaa cgcctaggtt tccgcccaga
    35761 cctctcatac ggcacccttc cgaaaaaggc agcatttttg ccagtcggtt gtcagcgact
    35821 gacgacgact cgggagacta cgcgccaatg gatcgcttcg ccttccagag ccccagggtg
    35881 tgtggtcgcc ctccccttcc gcctccaaat cacccacctc cggcaactag gccggcagac
    35941 gcgtcaatgg gggacgtggg ctgggcggat ctgcagggac tcaagaggac cccaaaggga
    36001 tttttaaaaa catctaccaa ggggggcagt ctcaaagccc gtggacgcga tgtaggtgac
    36061 cgtctcaggg acggcggctt tgcctttagt cctaggggcg tgaaatctgc catagggcaa
    36121 aacattaaat catggttggg gatcggagaa tcatcggcga ctgctgttcc cgtcaccacg
    36181 cagcttatgg taccggtgca cctcattaga acgcctgtga ccgtggacta caggaatgtt
    36241 tatttgcttt acttagaggg ggtaatgggt gtgggcaaat caacgctggt caacgccgtg
    36301 tgcgggatct tgccccagga gagagtgaca agttttcccg agcccatggt gtactggacg
    36361 agggcattta cagattgtta caaggaaatt tcccacctga tgaagtctgg taaggcggga
    36421 gacccgctga cgtctgccaa aatatactca tgccaaaaca agttttcgct ccccttccgg
    36481 acgaacgcca ccgctatcct gcgaatgatg cagccctgga acgttggggg tgggtctggg
    36541 aggggcactc actggtgcgt ctttgatagg catctcctct ccccagcagt ggtgttccct
    36601 ctcatgcacc tgaagcacgg ccgcctatct tttgatcact tctttcaatt actttccatc
    36661 tttagagcca cagaaggcga cgtggtcgcc attctcaccc tctccagcgc cgagtcgttg
    36721 cggcgggtca gggcgagggg aagaaagaac gacgggacgg tggagcaaaa ctacatcaga
    36781 gaattggcgt gggcttatca cgccgtgtac tgttcatgga tcatgttgca gtacatcact
    36841 gtggagcaga tggtacaact atgcgtacaa accacaaata ttccggaaat ctgcttccgc
    36901 agcgtgcgcc tggcacacaa ggaggaaact ttgaaaaacc ttcacgagca gagcatgcta
    36961 cctatgatca ccggtgtact ggatcccgtg agacatcatc ccgtcgtgat cgagctttgc
    37021 ttttgtttct tcacagagct gagaaaatta caatttatcg tagccgacgc ggataagttc
    37081 cacgacgacg tatgcggcct gtggaccgaa atctacaggc agatcctgtc caatccggct
    37141 attaaaccca gggccatcaa ctggccagca ttagagagcc agtctaaagc agttaatcac
    37201 ctagaggaga catgcagggt ctagccttct tggcggccct tgcatgctgg cgatgcatat
    37261 cgttgacatg tggagccact ggcgcgttgc cgacaacggc gacgacaata acccgctccg
    37321 ccacgcagct catcaatggg agaaccaacc tctccataga actggaattc aacggcacta
    37381 gtttttttct aaattggcaa aatctgttga atgtgatcac ggagccggcc ctgacagagt
    37441 tgtggacctc cgccgaagtc gccgaggacc tcagggtaac tctgaaaaag aggcaaagtc
    37501 tttttttccc caacaagaca gttgtgatct ctggagacgg ccatcgctat acgtgcgagg
    37561 tgccgacgtc gtcgcaaact tataacatca ccaagggctt taactatagc gctctgcccg
    37621 ggcaccttgg cggatttggg atcaacgcgc gtctggtact gggtgatatc ttcgcatcaa
    37681 aatggtcgct attcgcgagg gacaccccag agtatcgggt gttttaccca atgaatgtca
    37741 tggccgtcaa gttttccata tccattggca acaacgagtc cggcgtagcg ctctatggag
    37801 tggtgtcgga agatttcgtg gtcgtcacgc tccacaacag gtccaaagag gctaacgaga
    37861 cggcgtccca tcttctgttc ggtctcccgg attcactgcc atctctgaag ggccatgcca
    37921 cctatgatga actcacgttc gcccgaaacg caaaatatgc gctagtggcg atcctgccta
    37981 aagattctta ccagacactc cttacagaga attacactcg catatttctg aacatgacgg
    38041 agtcgacgcc cctcgagttc acgcggacga tccagaccag gatcgtatca atcgaggcca
    38101 ggcgcgcctg cgcagctcaa gaggcggcgc cggacatatt cttggtgttg tttcagatgt
    38161 tggtggcaca ctttcttgtt gcgcggggca ttgccgagca ccgatttgtg gaggtggact
    38221 gcgtgtgtcg gcagtatgcg gaactgtatt ttctccgccg catctcgcgt ctgtgcatgc
    38281 ccacgttcac cactgtcggg tataaccaca ccacccttgg cgctgtggcc gccacacaaa
    38341 tagctcgcgt gtccgccacg aagttggcca gtttgccccg ctcttcccag gaaacagtgc
    38401 tggccatggt ccagcttggc gcccgtgatg gcgccgtccc ttcctccatt ctggagggca
    38461 ttgctatggt cgtcgaacat atgtataccg cctacactta tgtgtacaca ctcggcgata
    38521 ctgaaagaaa attaatgttg gacatacaca cggtcctcac cgacagctgc ccgcccaaag
    38581 actccggagt atcagaaaag ctactgagaa catatttgat gttcacatca atgtgtacca
    38641 acatagagct gggcgaaatg atcgcccgct tttccaaacc ggacagcctt aacatctata
    38701 gggcattctc cccctgcttt ctaggactaa ggtacgattt gcatccagcc aagttgcgcg
    38761 ccgaggcgcc gcagtcgtcc gctctgacgc ggactgccgt tgccagagga acatcgggat
    38821 tcgcagaatt gctccacgcg ctgcacctcg atagcttaaa tttaattccg gcgattaact
    38881 gttcaaagat tacagccgac aagataatag ctacggtacc cttgcctcac gtcacgtata
    38941 tcatcagttc cgaagcactc tcgaacgctg ttgtctacga ggtgtcggag atcttcctca
    39001 agagtgccat gtttatatct gctatcaaac ccgattgctc cggctttaac ttttctcaga
    39061 ttgataggca cattcccata gtctacaaca tcagcacacc aagaagaggt tgcccccttt
    39121 gtgactctgt aatcatgagc tacgatgaga gcgatggcct gcagtctctc atgtatgtca
    39181 ctaatgaaag ggtgcagacc aacctctttt tagataagtc acctttcttt gataataaca
    39241 acctacacat tcattatttg tggctgaggg acaacgggac cgtagtggag ataaggggca
    39301 tgtatagaag acgcgcagcc agtgctttgt ttctaattct ctcttttatt gggttctcgg
    39361 gggttatcta ctttctttac agactgtttt ccatccttta ttagacggtc aataaagcgt
    39421 agatttttaa aaggtttcct gtgcattctt tttgtatggg catatacttg gcaagaaatc
    39481 cgagcacctc agaaagtgga ttgccgtcac atatcagttc gaccacccct gcacctagcc
    39541 atgcggcgct ttgacggtct ttggggctac acatcataaa gtacttttcc atggcttcta
    39601 taagcacctt ggaacaatct gggggttggc gaatgggttc cctaaacggg aaatcctcta
    39661 tggtattcag gcagaagacc gcgtcctcca cccgacgttt gagtctttct agcagagcgc
    39721 cgaagaactc ccgctcgtgt gttttcgcag gggcaagttc tgcgccgtac agcgatgaga
    39781 aacacgacac gatgttttcc agccccatgc tgcgcagcaa cacgtgcttc aggaacaggt
    39841 gttgtagccg gttcagtttt agcttgggta gaaaagttat cgagttgtta gcacgctcca
    39901 tgatggtaac ggtgttgaag tcacagaccg ggctttctcc gagtctcggc cgcctgagtc
    39961 caatcatgta gaacatagac gcggcctcgt tgtctgtgtt aagtgacacg atatcccgtt
    40021 cgcaaacctg tgcgatgttg tgtttcagta tagatctggt ctgaccggca cggggtgtta
    40081 tggggtgacg cggtaaaggc gactctgggt caaacacctt tatgcggttg gcggcctcgt
    40141 cgatgacgac acgcttgttc gcggcgtgta tggggacgcg acggcatccc gctggcagat
    40201 ctataatctt aaagttggta taagactggt cgctcgttat ggccagccgg cactccggta
    40261 gtatctgcgt gtcctcgaat tcgtggccgc gtacgactgg cttggagtgc aggtaaacgc
    40321 caagagatgc ggtctcttcg cctacgcaca agtggcttct taacgcgtag gggtgcggtg
    40381 agagcatgat ccgtagcaac gatagttccg ggtgcctagc cgcgtagagt ggcagggtag
    40441 acgagtccgg agtcccaaac ttttcgaaca acagtggcat cgggacttca ggattagaga
    40501 ctcccaccat ggccgccacc gccggagagg tcaagacgtg aaacacgcgc tcgcctgtcg
    40561 acaggcgcgc cgcgccctct actagactag ccttcacgtc cggaactcgt aacatagctt
    40621 agaccagcgg acggacgcaa cgtacgcggg gatcggctgg cggtgtctgc tcgttggacg
    40681 cggccgttcg gtggcgccag tgcaggccta gtttgcgaat ggcgtgacgg acaatttgtg
    40741 gctttagagc ggcgaaccga tgacccgtgg tggcgacgaa cgaaatgaag tttgcattgc
    40801 ggcccaactc gtctagcctg gtcttcttgt ttcgggcata gattttcggg attaggttac
    40861 actttttata tcccagtact gcgcactcgt gtttgctttt agtgtgactg attatcttct
    40921 ttgagaagtc aaacaggccc cgggcggcgg ctcgcctaat gcaagccacg tcaagcctga
    40981 gaaacgaaca gcattccacc agacactcca ggaacctttt gtgtagcgtc tgtatttggg
    41041 aacggtttct gtgctcaagt agggagaata ttctattttt gtttccgtcg atgcgcgcgt
    41101 gctggtccgt gagaatgggc gccagctcgt ggcgaatctg ttccacaaga ggctgcccgt
    41161 acactttaga aatcgtggct gtcgcggcct taaaccagga cacgtttagc ccatccttgc
    41221 tggagaccac agatggaaag tttgtggtcc aaaatacgtt ttttcgcccc attctcacca
    41281 tgtactggtt ttccagtccg tgcaggtcca acgtggagtt ccaatttgct atcgatacag
    41341 gaaatatgtg cctgattggc agaaagcatt tcagcgtacc cattgcgaag agaaagtgca
    41401 gcatgtcccc actgatgttg atgtttattg cggtgccttg acacatgttg tcggaaaaaa
    41461 acacgcttat ggtaaaagaa ggttccttta cggagtactt tcgtataaca aaattgttgg
    41521 tcaatctggg gatgtttaaa atagtctttt gcagggtgtt aggaacgtgg cagcttatct
    41581 tagtgttaat caccatgttg gtgttgaata tggtgatctt gaagttttcc aaactgacgt
    41641 gttttgtggg ttccagcatg tctgacactg tggagctgcc cagagtccgc gcgtccgtgg
    41701 ccgcgtatcg ttggaagcac gcctgcaaat ttcctttcat ggctgctcgc cggtctttcg
    41761 gcgcgtaccg gattcttgaa agcgtcgccg ccaggagacg cggtgtctcg tgggtgccta
    41821 aaaagtttgc gcaggggtgc agtccgctgc acgagtggcc gatgcagtct gccactgcca
    41881 tacacatgac gagtctgtag atggccggtg tgcccggata cactagatag taggtacaat
    41941 ctggggtact gacgaccacc ctgtatggct ttggtccggg gtccttgcgt tggattttta
    42001 cgtgcagacg ggacacgagc tggtttagag ccagctgaaa gcccaccaga tcccgtccgt
    42061 taaccttgac gtcctggtgc ttactctgtt tcgacaggtt cttcagcacg gtgggcagtc
    42121 gctctacgtt gtgagcgatg gcacggcgca gcgagaccag ctctccgtgc cacccccacg
    42181 tggccatgaa gctgctgatg ttaaacttta aaaaatgtag ctgtgcatct ggggatgcgg
    42241 gtggcattat tgaaaacgag agatgcttca ggctctccag gagtgcaaaa taattttgat
    42301 agattgtggg ttgtagacta tggggcaaca ccgccagaaa cgcatgaaaa cactgttcga
    42361 actcccagaa ctccaggtac ctgcacacta tcctgaacat ggctttgtaa catatggtgc
    42421 acgttagtag cgcgggaaga tacagcgagc gtagctccct gaattcgcag ggtttatcac
    42481 aatcatcggt aagttcccat gatcccaccg caggtaggta gttgtcggtg tctatctgtc
    42541 cgcgcgtaaa cactccacca ccgtcaatta ttaaaccttc gccgctgtac cgtcgaccca
    42601 cttttcccaa aagagtccct tcttgatgta taaaagggtg gaggcgttcc cccaggagta
    42661 gtctgcgtat cgctctgcag gcgaaaaagg tgggctcggg ctgcatcatc ttatcaagac
    42721 cttctaaggt cagctctgcc tgcaggtgcg agttggtggc cagacagcag aatatttcca
    42781 gctgtgattc ccaagtcgct tgataacacg tggtctgcgg actcgtcgtc agggaggcgc
    42841 tcggtggcag tagtaggggg ccctcgagcg ctgccatgga ggcgaccttg gagcaacgac
    42901 ctttcccgta cctcgccacg gaggccaacc tcctaacgca gattaaggag tcggctgccg
    42961 acggactctt caagagcttt cagctattgc tcggcaagga cgccagagaa ggcagtgtcc
    43021 gtttcgaagc gctactgggc gtatatacca atgtggtgga gtttgttaag tttctggaga
    43081 ccgccctcgc cgccgcttgc gtcaataccg agttcaagga cctgcggaga atgatagatg
    43141 gaaaaataca gtttaaaatt tcaatgccca ctattgccca cggagacggg aggaggccca
    43201 acaagcagag acagtatatc gtcatgaagg cttgcaataa gcaccacatc ggtgcggaga
    43261 ttgagcttgc ggccgcagac atcgagcttc tcttcgccga gaaagagacg cccttggact
    43321 tcacagagta cgcgggtgcc atcaagacga ttacgtcggc tttgcagttt ggtatggacg
    43381 ccctagaacg ggggctagtg gacacggttc tcgcagttaa acttcggcac gctccacccg
    43441 tctttatttt aaagacgctg ggcgatcccg tctactctga gaggggcctc aaaaaggccg
    43501 tcaagtctga catggtatcc atgttcaagg cacacctcat agaacattca ttttttctag
    43561 ataaggccga gctcatgaca agggggaagc agtatgtcct aaccatgctc tccgacatgc
    43621 tggccgcggt gtgcgaggat accgtcttta agggtgtcag cacgtacacc acggcctctg
    43681 ggcagcaggt ggccggcgtc ctggagacga cggacagcgt catgagacgg ctgatgaacc
    43741 tgctggggca agtggaaagt gccatgtccg ggcccgcggc ctacgccagc tacgttgtca
    43801 ggggtgccaa cctcgtcacc gccgttagct acggaagggc gatgagaaac tttgaacagt
    43861 ttatggcacg catagtggac catcccaacg ctctgccgtc tgtggaaggt gacaaggccg
    43921 ctctggcgga cggacacgac gagattcaga gaacccgcat cgccgcctct ctcgtcaaga
    43981 taggggataa gtttgtggcc attgaaagtt tgcagcgcat gtacaacgag actcagtttc
    44041 cctgcccact gaaccggcgc atccagtaca cctatttctt ccctgttggc cttcaccttc
    44101 ccgtgccccg ctactcgaca tccgtctcag tcaggggcgt agaatccccg gccatccagt
    44161 cgaccgagac gtgggtggtt aataaaaaca acgtgcctct ttgcttcggt taccaaaacg
    44221 ccctcaaaag catatgccac cctcgaatgc acaaccccac ccagtcagcc caggcactaa
    44281 accaagcttt tcccgatccc gacgggggac atgggtacgg tctcaggtat gagcagacgc
    44341 caaacatgaa cctattcaga acgttccacc agtattacat ggggaaaaac gtggcatttg
    44401 ttcccgatgt ggcccaaaaa gcgctcgtaa ccacggagga tctactgcac ccaacctctc
    44461 accgtctcct cagattggag gtccacccct tctttgattt ttttgtgcac ccctgtcctg
    44521 gagcgagagg atcgtaccgc gccacccaca gaacaatggt tggaaatata ccacaaccgc
    44581 tcgctccaag ggagtttcag gaaagtagag gggcgcagtt cgacgctgtg acgaatatga
    44641 cacacgtcat agaccagcta actattgacg tcatacagga gacggcattt gaccccgcgt
    44701 atcccctgtt ctgctatgta atcgaagcaa tgattcacgg acaggaagaa aaattcgtga
    44761 tgaacatgcc cctcattgcc ctggtcattc aaacctactg ggtcaactcg ggaaaactgg
    44821 cgtttgtgaa cagttatcac atggttagat tcatctgtac gcatatgggg aatggaagca
    44881 tccctaagga ggcgcacggc cactaccgga aaatcttagg cgagctcatc gcccttgagc
    44941 aggcgcttct caagctcgcg ggacacgaga cggtgggtcg gacgccgatc acacatctgg
    45001 tttcggctct cctcgacccg catctgctgc ctccctttgc ctaccacgat gtctttacgg
    45061 atcttatgca gaagtcatcc agacaaccca taatcaagat cggggatcaa aactacgaca
    45121 accctcaaaa tagggcgaca ttcatcaacc tcaggggtcg catggaggac ctagtcaata
    45181 accttgttaa catttaccag acaagggtca atgaggacca tgacgagaga cacgtcctgg
    45241 acgtggcgcc cctggacgag aatgactaca acccggtcct cgagaagcta ttctactatg
    45301 ttttaatgcc ggtgtgcagt aacggccaca tgtgcggtat gggggtcgac tatcaaaacg
    45361 tggccctgac gctgacttac aacggccccg tctttgcgga cgtcgtgaac gcacaggatg
    45421 atattctact gcacctggag aacggaacct tgaaggacat tctgcaggca ggcgacatac
    45481 gcccgacggt ggacatgatc agggtgctgt gcacctcgtt tctgacgtgc cctttcgtca
    45541 cccaggccgc tcgcgtgatc acaaagcggg acccggccca gagttttgcc acgcacgaat
    45601 acgggaagga tgtggcgcag accgtgcttg ttaatggctt tggtgcgttc gcggtggcgg
    45661 accgctctcg cgaggcggcg gagactatgt tttatccggt accctttaac aagctctacg
    45721 ctgacccgtt ggtggctgcc acactgcatc cgctcctggc aaactatgtc accaggctcc
    45781 ccaaccagag aaacgcggtg gtctttaacg tgccatccaa tctcatggca gaatatgagg
    45841 aatggcacaa gtcgcccgtc gcggcgtatg ccgcgtcttg tcaggccacc ccgggcgcca
    45901 ttagcgccat ggtgagcatg caccaaaaac tatctgcccc cagtttcatt tgccaggcaa
    45961 aacaccgcat gcaccctggt tttgccatga cagtcgtcag gacggacgag gttctagcag
    46021 agcacatcct atactgctcc agggcgtcga catccatgtt tgtgggcttg ccttcggtgg
    46081 tacggcgcga ggtacgttcg gacgcggtga cttttgaaat tacccacgag atcgcttccc
    46141 tgcacaccgc acttggctac tcatcagtca tcgccccggc ccacgtggcc gccataacta
    46201 cagacatggg agtacattgt caggacctct ttatgatttt cccaggggac gcgtatcagg
    46261 accgccagct gcatgactat atcaaaatga aagcgggcgt gcaaaccggc tcaccgggaa
    46321 acagaatgga tcacgtggga tacactgctg gggttcctcg ctgcgagaac ctgcccggtt
    46381 tgagtcatgg tcagctggca acctgcgaga taattcccac gccggtcaca tctgacgttg
    46441 cctatttcca gacccccagc aacccccggg ggcgtgcggc gtgcgtggtg tcgtgtgatg
    46501 cttacagtaa cgaaagcgca gagcgtttgc tctacgacca ttcaatacca gaccccgcgt
    46561 acgaatgccg gtccaccaac aacccgtggg cttcgcagcg tggctccctc ggcgacgtgc
    46621 tatacaatat cacctttcgc cagactgcgc tgccgggcat gtacagtcct tgtcggcagt
    46681 tcttccacaa ggaagacatt atgcggtaca atagggggtt gtacactttg gttaatgagt
    46741 attctgccag gcttgctggg gcccccgcca ccagcactac agacctccag tacgtcgtgg
    46801 tcaacggtac agacgtgttt ttggaccagc cttgccatat gctgcaggag gcctatccca
    46861 cgctcgccgc cagccacaga gttatgcttg acgagtacat gtcaaacaag cagacacacg
    46921 ccccagtaca catgggccag tatctcattg aagaggtggc gccgatgaag agactattaa
    46981 agctcggaaa caaggtggtg tattagctaa cccttctagc gttggctagt catggcactc
    47041 gacaagagta tagtggttaa cttcacctcc agactcttcg ctgatgaact ggccgccctt
    47101 cagtcaaaaa tagggagcgt actgccgctc ggagattgcc accgtttaca aaatatacag
    47161 gcattgggcc tggggtgcgt atgctcacgt gagacatctc cggactacat ccaaattatg
    47221 cagtatctat ccaagtgcac actcgctgtc ctggaggagg ttcgcccgga cagcctgcgc
    47281 ctaacgcgga tggatccctc tgacaacctt cagataaaaa acgtatatgc cccctttttt
    47341 cagtgggaca gcaacaccca gctagcagtg ctacccccat tttttagccg aaaggattcc
    47401 accattgtgc tcgaatccaa cggatttgac ctcgtgttcc ccatggtcgt gccgcagcaa
    47461 ctggggcacg ctattctgca gcagctgttg gtgtaccaca tctactccaa aatatcggcc
    47521 ggggccccgg atgatgtaaa tatggcggaa cttgatctat ataccaccaa tgtgtcattt
    47581 atggggcgca catatcgtct ggacgtagac aacacggatc cacgtactgc cctgcgagtg
    47641 cttgacgatc tgtccatgta cctttgtatc ctatcagcct tggttcccag ggggtgtctc
    47701 cgtctgctca cggcgctcgt gcggcacgac aggcatcctc tgacagaggt gtttgagggg
    47761 gtggtgccag atgaggtgac caggatagat ctcgaccagt tgagcgtccc agatgacatc
    47821 accaggatgc gcgtcatgtt ctcctatctt cagagtctca gttctatatt taatcttggc
    47881 cccagactgc acgtgtatgc ctactcggca gagactttgg cggcctcctg ttggtattcc
    47941 ccacgctaac gatttgaagc gggggggggg gtatggcgtc atctgatatt ctgtcggttg
    48001 caaggacgga tgacggctcc gtctgtgaag tctccctgcg tggaggtagg aaaaaaacta
    48061 ccgtctacct gccggacact gaaccctggg tggtagagac cgacgccatc aaagacgcct
    48121 tcctcagcga cgggatcgtg gatatggctc gaaagcttca tcgtggtgcc ctgccctcaa
    48181 attctcacaa cggcttgagg atggtgcttt tttgttattg ttacttgcaa aattgtgtgt
    48241 acctagccct gtttctgtgc ccccttaatc cttacttggt aactccctca agcattgagt
    48301 ttgccgagcc cgttgtggca cctgaggtgc tcttcccaca cccggctgag atgtctcgcg
    48361 gttgcgatga cgcgattttc tgtaaactgc cctataccgt gcctataatc aacaccacgt
    48421 ttggacgcat ttacccgaac tctacacgcg agccggacgg caggcctacg gattactcca
    48481 tggcccttag aagggctttt gcagttatgg ttaacacgtc atgtgcagga gtgacattgt
    48541 gccgcggaga aactcagacc gcatcccgta accacactga gtgggaaaat ctgctggcta
    48601 tgttttctgt gattatctat gccttagatc acaactgtca cccggaagca ctgtctatcg
    48661 cgagcggcat ctttgacgag cgtgactatg gattattcat ctctcagccc cggagcgtgc
    48721 cctcgcctac cccttgcgac gtgtcgtggg aagatatcta caacgggact tacctagctc
    48781 ggcctggaaa ctgtgacccc tggcccaatc tatccacccc tcccttgatt ctaaatttta
    48841 aataaaggtg tgtcactggt tacaccacga ttaaaaacca ctcactgaga tgtcttttta
    48901 accgctaagg gattataccg ggatttaaaa ccgcccactg atttttttac gctaagagtt
    48961 gggtgcttgg ggggttttgc attgctctgt tgtaaactat atataagtta aaccaaaatt
    49021 cgcagggaga caaggtgacg gtggtgagaa ctcagttgag agtcagagaa tacagtgcta
    49081 atcagggtag atgagcatga cttccccgtc tccagtcacc ggaggaatgg tggacggctc
    49141 cgtcctggtg cgaatggcca ccaagcctcc cgtgattggt cttataacag tgctcttcct
    49201 cctagtcata ggcgcctgcg tctactgctg cattcgcgtg ttcctggcgg ctcgactgtg
    49261 gcgcgccacc ccactaggca gggccaccgt ggcgtatcag gtccttcgca ccctgggacc
    49321 gcaggccggg tcacatgcac cgccgacggt gggcatagct acccaggagc cctaccgtac
    49381 aatatacatg ccagattaga acggggtgtg tgctataatg gatggctatg ggggggctgt
    49441 agataattga gcgctgtgct tttattgtgg ggatatgggc ttgtacatgt gtctatcatc
    49501 ggtagccata aaatgggcca tgacaactgc cacaagtaag tcgtccgaca tgtgcttttg
    49561 cttggcgctg tatgactgcc ctccatccct aagcgggacg cacttgatcg cgcggacctg
    49621 ttctaccagg taggtcaccg ggtcaaatga tattttgatg gtgttggaca ccaccgtctg
    49681 gctggcgctc agggtgccgg agttcagagc gtagatgaat gtctcaaacg cggaggattt
    49741 ctcgcctccc aacatgtaaa ttggccactg cagggcgctg ctcttgtcag tatagtgtag
    49801 aaaatgtatg gggagcgggc atatttcgtt aaggacggtt gcaatggcca ccccagaatc
    49861 ttggctgctg ttgccttcga ccgccgcgtt cacgcgctca attgtggggt ggagcacagc
    49921 gatcgcctta atcatcgtgc atgcgcagga cgctatctcg taagcagctg cgccagtgag
    49981 gtcgcgcagg aagaaatgct ccatgcccaa tatgaggctt ctggtgggag tctgagtact
    50041 cgtgacaacg gcgcccacgc cagtaccgga cgcctccgtg ttgttcgtat acgcggggtc
    50101 gatgtaaaca aacagctgtt ttccaaggca cttctgaacc tgctgggcgg tggtgtctac
    50161 ccgacacatg tcaaactgtg tcagcgctgc gtcacccacc acgcggtaaa gcgtagcatt
    50221 tgacgacgct gctccctcgc ccattagttc ggtgtcgaat gccccctcca taaagaggtt
    50281 ggtggtggtt ttgatggatt cgtcgatggt gatgtacgtc ggaatgtgca gtctgtaaca
    50341 aggacaggac actagtgcgt cttgcaggtg gaaatcttcg cggtggtccg cacacacgta
    50401 actgaccaca ttcagcatct tttcctgggc gttcctgagg ttaagcagga aactcgtgga
    50461 gcggtctgac gagttcacgg atgatataaa tatcagcttg gcgtctttct gaagcatgaa
    50521 acccagaata gccggcagtg catccttttt aataaaattc gcctcgtcta cgtagagcag
    50581 gttaaaggtc tgtccccgaa tgctctgcag acacggaaag acacaaaaga ggggctcata
    50641 agcggctaac agtaaaggag aggaggcgaa cagtgcgtgg ctcttgttct tgggaataaa
    50701 agggggcgtg tgtgccgatc gtatgggtga gccagtggat cctggacatg tggtgaatga
    50761 gaaagatttt gaggagtgtg aacaattttt cagtcaaccc cttagggagc aagtggtcgc
    50821 gggggtcagg gcactcgacg gcctcggtct cgctgactct ctatgtcaca aaacagaaag
    50881 actctgcctg ctgatggacc tggtgggcac ggagtgcttt gcgagggtgt gccgcctaga
    50941 caccggtgcg aaatgaagag tgtggcgagt cccttatgtc agttccacgg cgtgttttgc
    51001 ctgtaccagt gtcgccagtg cctggcatac cacgtgtgtg atgggggcgc cgaatgcgtt
    51061 ctcctgcata cgccggagag cgtcatctgc gaactaacgg gtaactgcat gctcggcaac
    51121 attcaagagg gccagttttt agggccggta ccgtatcgga ctttggataa ccaggttgac
    51181 agggacgcat atcacgggat gctagcgtgt ctgaaacggg acattgtgcg gtatttgcag
    51241 acatggccgg acaccaccgt aatcgtgcag gaaatagccc tgggggacgg cgtcaccgac
    51301 accatctcgg ccattataga tgaaacattc ggtgagtgtc ttcccgtact gggggaggcc
    51361 caaggcgggt acgccctggt ctgtagcatg tatctgcacg ttatcgtctc catctattcg
    51421 acaaaaacgg tgtacaacag tatgctattt aaatgcacaa agaataaaaa gtacgactgc
    51481 attgccaagc gggtgcggac aaaatggatg cgcatgctat caacgaaaga tacgtaggtc
    51541 ctcgctgcca ccgtttggcc cacgtggtgc tgcctaggac ctttctgctg catcacgcca
    51601 tacccctgga gcccgagatc atcttttcca cctacacccg gtttagccgg tcgccagggt
    51661 catcccgccg gttggtggtg tgtgggaaac gtgtcctgcc aggggaggaa aaccaacttg
    51721 cgtcttcacc ttctggcttg gcgcttagcc tgcctctgtt ttcccacgat gggaactttc
    51781 atccatttga catctcggta ctgcgcattt cctgccctgg ttctaatctt agtcttactg
    51841 tcagatttct ctatctatct ctggtggtgg ctatgggggc gggacggaat aatgcgcgga
    51901 gtccgaccgt tgacggggta tcgccgccag agggcgccgt agcccaccct ttggaggaac
    51961 tgcagaggct ggcgcgtgct acgccggacc cggcactcac ccgtggaccg ttgcaggtcc
    52021 tgaccggcct tctccgcgca gggtcagacg gagaccgcgc cactcaccac atggcgctcg
    52081 aggctccggg aaccgtgcgt ggagaaagcc tagacccgcc tgtttcacag aaggggccag
    52141 cgcgcacacg ccacaggcca ccccccgtgc gactgagctt caaccccgtc aatgccgatg
    52201 tacccgctac ctggcgagac gccactaacg tgtactcggg tgctccctac tatgtgtgtg
    52261 tttacgaacg cggtggccgt caggaagacg actggctgcc gataccactg agcttcccag
    52321 aagagcccgt gcccccgcca ccgggcttag tgttcatgga cgacttgttc attaacacga
    52381 agcagtgcga ctttgtggac acgctagagg ccgcctgtcg cacgcaaggc tacacgttga
    52441 gacagcgcgt gcctgtcgcc attcctcgcg acgcggaaat cgcagacgca gttaaatcgc
    52501 actttttaga ggcgtgccta gtgttacggg ggctggcttc ggaggctagt gcctggataa
    52561 gagctgccac gtccccgccc cttggccgcc acgcctgctg gatggacgtg ttaggattat
    52621 gggaaagccg cccccacact ctaggtttgg agttacgcgg cgtaaactgt ggcggcacgg
    52681 acggtgactg gttagagatt ttaaaacagc ccgatgtgca aaagacagtc agcgggagtc
    52741 ttgtggcatg cgtgatcgtc acacccgcat tggaagcctg gcttgtgtta cctgggggtt
    52801 ttgctattaa aggccgctat agggcgtcga aggaggatct ggtgttcatt cgaggccgct
    52861 atggctagcc ggaggcgcaa acttcggaat ttcctaaaca aggaatgcat atggactgtt
    52921 aacccaatgt caggggacca tatcaaggtc tttaacgcct gcacctctat ctcgccggtg
    52981 tatgaccctg agctggtaac cagctacgca ctgagcgtgc ctgcttacaa tgtgtctgtg
    53041 gctatcttgc tgcataaagt catgggaccg tgtgtggctg tgggaattaa cggagaaatg
    53101 atcatgtacg tcgtaagcca gtgtgtttct gtgcggcccg tcccggggcg cgatggtatg
    53161 gcgctcatct actttggaca gtttctggag gaagcatccg gactgagatt tccctacatt
    53221 gctccgccgc cgtcgcgcga acacgtacct gacctgacca gacaagaatt agttcatacc
    53281 tcccaggtgg tgcgccgcgg cgacctgacc aattgcacta tgggtctcga attcaggaat
    53341 gtgaaccctt ttgtttggct cgggggcgga tcggtgtggc tgctgttctt gggcgtggac
    53401 tacatggcgt tctgtccggg tgtcgacgga atgccgtcgt tggcaagagt ggccgccctg
    53461 cttaccaggt gcgaccaccc agactgtgtc cactgccatg gactccgtgg acacgttaat
    53521 gtatttcgtg ggtactgttc tgcgcagtcg ccgggtctat ctaacatctg tccctgtatc
    53581 aaatcatgtg ggaccgggaa tggagtgact agggtcactg gaaacagaaa ttttctgggt
    53641 cttctgttcg atcccattgt ccagagcagg gtaacagctc tgaagataac tagccaccca
    53701 acccccacgc acgtcgagaa tgtgctaaca ggagtgctcg acgacggcac cttggtgccg
    53761 tcgtccaagg caccctgggt cctcttacga atgtctgact acttcagccg cttgctgata
    53821 tatgagtgta aaaaacttaa ggccctgggc ttacgttctt attgaagcat gttgcgcaca
    53881 tcagcgagct ggaccgtcct ccgggtcgcg tgtagattat ggttccgttc tccttcttga
    53941 tgtttaaatt tttggggggg aaccaccgac aaagcgtctt tatgatttcc gcgaacacgg
    54001 agttggctac gtgcttttgg tgggctacgt acccaatgtt aatgttctct acggatgcca
    54061 gtagcatgct gatgatcgcc accactatcc atgtctttcc gtgtctcctt ggtattagga
    54121 atacgcttgc cttttgctta aacgtctgta aaacactgtt tggagtttca aataaaccga
    54181 agtactgctt aaacaatcca aacaactggt gcgtcttttg tggggccttg attgaaacca
    54241 aaaagaaaaa agtgtgcatt actagctgct gttggaaggg ctccagccag tgcaccccgg
    54301 gaacgtaaca gccgttcaga aaggacgaaa ggttaaccag aaaagcctga agttcgcggt
    54361 agacagagca ggcgtgcagg gagtcgtgtg tttttctggc cgcctggtac tcgaccagtt
    54421 gatcggccgt ggagacgtgc gcgtcctcgc gcacacaccg catctgcaag tatgttgata
    54481 gggactccaa taggcgcggc tttgcgggga cgttgtcctc ggacggtctg ggggttccca
    54541 cgtcgggatt tgctgacgtg ggcgtggcgg gatggtgccg tgtgcagtat gtttccagga
    54601 ccgaactgta tgagtttatt ctgtgcacca cgccaataaa agggtgcgcc atccgtgccg
    54661 ttttgggaca gtgtcgcgtg aatgtcgggg cactcagttc ccacctctct ccggcgtctt
    54721 tggcggtctc ctgcaggttg gcggcaaggc gctccctgtg acggctgagc agcatgtttg
    54781 ctttgagctc gctcgtgtcc gagggtgacc cggaggtgac cagtaggtac gtcaagggcg
    54841 tacaacttgc cctggacctt agcgagaaca cacctggaca atttaagttg atagaaactc
    54901 ccctgaacag cttcctcttg gtttccaacg tgatgcccga ggtccagcca atctgcagtg
    54961 gcctgccggc cttgcggcca gactttagta atctccactt gcctagactg gagaagctcc
    55021 agagagtcct cgggcagggt ttcggggcgg cgggtgagga aatcgcactg gacccgtctc
    55081 acgtagaaac acacgaaaag ggccaggtgt tctacaacca ctatgctacc gaggagtgga
    55141 cgtgggcttt gactctgaat aaggatgcgc tccttcggga ggctgtagat ggcctgtgtg
    55201 accccggaac ttggaagggt cttcttcctg acgaccccct tccgttgcta tggctgctgt
    55261 tcaacggacc cgcctctttt tgtcgggccg actgttgcct gtacaagcag cactgcggtt
    55321 acccgggccc ggtgctactt ccaggtcaca tgtacgctcc caaacgggat cttttgtcgt
    55381 tcgttaatca tgccctgaag tacaccaagt ttctatacgg agatttttcc gggacatggg
    55441 cggcggcttg ccgcccgcca ttcgctactt ctcggataca aagggtagtg agtcagatga
    55501 aaatcataga tgcttccgac acttacattt cccacacctg cctcttgtgt cacatatatc
    55561 agcaaaatag cataattgcg ggtcagggga cccacgtggg tggaatccta ctgttgagtg
    55621 gaaaagggac ccagtatata acaggcaatg ttcagaccca aaggtgtcca actacgggcg
    55681 actatctaat catcccatcg tatgacatac cggcgatcat caccatgatc aaggagaatg
    55741 gactcaacca actctaaaag agagtttatt aagtcggctc tggaggccaa catcaacagg
    55801 agggcagctg tatcgctatt tgatcgtttt gggggtagca gcgccgtgtt tgagaagcag
    55861 tttcaggacg cacagcatgc cgtcagggcc cacggtgcac tgaagcgcga agccgagctc
    55921 gggactctgg tacgcaaggc gggccagagg tttgaggcgc tgaaaaggga acggtcaatt
    55981 ttgcgccagc cgcgcgacct cccacgggtc gccgacattg acgccctggt cgacgccgtc
    56041 gcggacctca aagaagaggt ggccgtgcgc ctagatgcgc tggaagagaa tggagaggag
    56101 acccccactc actcctcttc ggagatcaag gacacaatcg tcaggtggag gcttgacgat
    56161 ttgcccccgg tgtgccctga aactccctaa ggctacccgg atttcagaga gaccctgggc
    56221 gtccacatgg cagctgaatc agcatataca ggtgtccaag actaaaaagg ccaccgcgta
    56281 tcttaaagcg ccccgtgaat gggggcagtg cacgcaccag gatccagact ggtccaagcg
    56341 tctgggtcgt ggcgcctttg gcataatcgt ccctatctcc gaggatctgt gtgtgaagca
    56401 gtttgatagc cgccgggagt ttttctacga ggcaattgcc aacgacctga tgcaggccac
    56461 ccgagagagg taccccatgc attctggtgg atctagactg ctaggattcg tgcagccttg
    56521 cataccctgt agatcgattg tgtatcctag aatgaagtgc aacctgctgc agctggactg
    56581 gagtcaggtc aacctgagtg tcatggcggc ggagttcacc ggcctaatgg cggcggtgtc
    56641 ctttctaaac agatactgtg gcatggtgca ctgcgacgtt agtccagaca atattttggc
    56701 cacaggagac ctaacgccca tgaaccccgg gaggctggtc cttaccgatt tcggttccgt
    56761 tgcgctacac tctgggagca agtggactaa ccttgtggtg acctctaacc tggggtttaa
    56821 gcaacactgc tacgacttca gggtgccacc caaactcatt tgtaagcatc tctataagcc
    56881 gtcttgcgtc ctcttccagt gttacctatc cagtctcggt aagatgcacg cgcaggtatt
    56941 ggaccaaccg taccctatca gccctaacat gggactgacc atcgacatgt cctcgttggg
    57001 ctacactctg ctgacatgcc tggaactcta tctcgatctg ccgctaaaca accctctgaa
    57061 gttcttgggt tcagccacca gagacggacg ccccgaaccc atgtactact tgggcttcat
    57121 gattcccagg gtggtgatga ctcagatcct gtccgctgtg tggaccatga cgcttgacct
    57181 gggactagat tgcaccggca aagcccaggc gattcccatg cgacaggagc accagctggc
    57241 gtttcagaag cagtgctatt tatataaagc caaccaaaag gcagagtcgt tagcgaactg
    57301 ctccgataag ctaaactgcc ccatgttaaa gtctctcgtt agaaagctac tagagcgaga
    57361 ctttttcaac catggaggcc acccccacac ccgcggactt gttttctgaa gactatctgg
    57421 ttgacaccct ggatgggtta acagtggatg accaacaggc tgtcctcgca agcttgagct
    57481 tttcaaagtt tctaaagcac gccaaggttc gagactggtg cgcacaggcc aagatccaac
    57541 ccagcatgcc tgcgctgcgc atggcttaca actatttcct tttttcaaaa gtgggcgagt
    57601 ttattggtag tgaggatgtg tgtaactttt tcgtggaccg tgtgtttggt ggtgtcaggt
    57661 tactggacgt ggccagcgtg tacgccgcct gttcgcaaat gaacgcacat cagcggcacc
    57721 acatctgctg tctagtggag agggccacta gtagtcagag tctgaacccc gtgtgggacg
    57781 ccctgcgaga cggaattata tcttcatcca agtttcactg ggcagttaaa caacagaaca
    57841 cttcaaaaaa gatattcagc ccatggccta taacgaacaa ccactttgtc gcgggcccgc
    57901 ttgcctttgg gctgcggtgc gaggaggtgg tgaaaacgtt gctggccacc cttttgcacc
    57961 cggacgaggc aaattgtctc gattatgggt ttatgcagag tccgcaaaat ggaatatttg
    58021 gcgtgtcgct ggatttcgcg gcgaacgtca aaactgacac cgagggtcgt ctacagtttg
    58081 accctaactg taaagtgtat gaaataaaat gcaggttcaa gtacaccttt gcgaaaatgg
    58141 agtgtgaccc catatacgcc gcgtatcagc ggctgtacga ggcacccgga aagctggcac
    58201 tgaaggactt cttctatagc atttccaagc ctgcggttga gtacgtggga cttggaaaac
    58261 tgcccagtga atctgattac ttggtggctt atgatcagga atgggaggcg tgtcctcgca
    58321 aaaagaggaa attaacgccc cttcacaatc ttattaggga gtgtattttg cacaactcga
    58381 ccacggagtc tgacgtctac gtacttactg atcctcaaga tactcggggt caaatcagta
    58441 ttaaagcccg cttcaaagcc aacctcttcg tgaacgtccg tcacagctac ttttatcagg
    58501 tattgctgca gagttcgatc gtcgaggagt acattggcct agatagcggc attcctcgcc
    58561 tcggatcacc gaaatactac atcgccaccg gcttcttcag aaagcggggc tatcaggatc
    58621 ctgtcaactg taccatcggt ggcgatgctt tagacccgca cgtggagatt cctacgctgc
    58681 taatcgtaac ccccgtctac tttccccgag gcgcaaagca tcgtctgctt caccaagctg
    58741 ccaacttttg gtcaagaagt gcgaaggaca cctttccata tatcaaatgg gatttctcct
    58801 atctatctgc aaacgtccct cacagcccgt agacgtggac ggggaaccgc tcgacgtagt
    58861 cgtggactat gaccccattc gcgtttcaga aaagggcatg ttgcttgagc aatcgcaatc
    58921 cccatatccc gcattaaaaa agaagaaaaa aaataaagaa gcaatttatt aagcaaacag
    58981 tatggttttc tgtacgtatt ttattccgtg gtgggtgaaa aataacgggg gatggaggaa
    59041 gagggatggg tttataatgc caatatatca gctaaatgaa tatcatttgc gtttcgtcga
    59101 tttcactgtc actttcatgg tcggactggt attgggtcct cggggcgggc gtcgatatgt
    59161 ccttcacttt ggcgcgggct ctggtctttg ctgggagggg cggcggtttc tggtgaacag
    59221 tcggagttct atcgaccgtc ggcgccgacg tcgccagagg catgtatgcc gcactcggcg
    59281 tacagagtcc ccagtcgctc cttataacgc gtataacgat ggctaggatg cacagtatag
    59341 ggatacagga gatattgata gccactatgt agtggagatt agcctgcacg aacgcgtttt
    59401 catacctgat gacaggcagc agtagaatca gataacccac gaatactccc acgtaaaagc
    59461 ctacctgccg tctcataaac tttaccagga aaaattccgt gtttatgtac cacacgaccg
    59521 tcaaggctag gaacatgttc accgcaccaa aaatggcgtc tgacacgagc acgtaaaagc
    59581 tgttgccaac ggccatcatg gtgctcaatg aaaacagcag catttccaag gcggttgttg
    59641 ataggtacag gttgacgcag accggtttcc accgagtcag cagtgactcc atcatggtat
    59701 tatcaggtac gtgctgttcc aggagaggta tttcccactg ggcggagtta catgttatca
    59761 gtgactggat gtgggcaaag gatatgcaaa aatgaatgca gtagacaaag gctgccataa
    59821 gtacgtgttt atatgacaga acatggataa acagttgcat gctccacatc cttaagatgg
    59881 cgacataaag cacgctatgt gatccaagta gcgctatcca ggattgcatg ctcatcatgg
    59941 tagtggcgtg aacatgcttg gcccgatata cggccaccgc cgcgagacag tagtatacta
    60001 tggcaatgcc gtccacgata aaagtccaaa atatgtacac cagcatctct ggtttctcta
    60061 aaaacagggt cggggtgagg tgcttcgctg agttgcgcac cgtgaggttt agcgcgctgt
    60121 agtttaccag attgttgaag tagcagggga aaccaaggcc ctcgtacgtg gcggccatgg
    60181 gcacgactgc agagcaaatg tacataatta cagccacaaa caacagcttg acccaggagg
    60241 acatgagaaa acggtcgctc tttgaagcgc gcatgtttct cggtcttttt aactttcgcc
    60301 aggcggcgct gcggcgggag agccaatctg atgccactgc ctatcgcggt tgacttttaa
    60361 atacgcgccc cgggcagaag ccagaggtag tcgactcatt gactcaatgg caacgagcga
    60421 agaaacggcg gccggttatg tcatcggtgt ctactttcac agcgttcacg tccactgccg
    60481 cattattgtc tggcaggtta attttctacc cctggaccca aacgacgggg agactgaatg
    60541 ctactttgtg gtggacacgc tgacgaaaga ggcgatggag cgcatgcccg aaatccagga
    60601 atgcgtcccg tctattactg aacacgcccg tgacctggcg atctgggagt tggcgctgcg
    60661 actgcagaat cagacgatcg tcaaggccgt ccggacagcg tcgcttccgg tggttctaat
    60721 tatgactgtg ggtcgcatag tgaatgatgt gattccctgc cccaacgtca gaacacccag
    60781 accactagcc tgtgcttacc tacactgtga ggcgacggtg acctttgagg tcccactaac
    60841 cgggcccgcg gcgtccaccg gaacgtggca cagctctatc tatagggaat gtgcgatctc
    60901 ggctatcgag atatgcttga agaccagtcg aggcatatac tcctgccagt cgaacgaggc
    60961 ccctgaggcc aagagggaaa agcgaggttt agacatatca gatgtgtttg tctgtctcac
    61021 gtatgatatc cctatcgcag ggcgggtcct ttctctgctg gtgccccacg cgcccgcttt
    61081 tcacgtctta tggatcaatg aggacagcaa gtggaacggg gcagccgtcg aatttttcag
    61141 agccctacac cataagctgt tcagtgaacg caatggtata ccccctctgt ggttgtacgt
    61201 gttcccggga gctgtggaag agggcacagc ctttgcgcca ttacttcccg cattcccttg
    61261 catacctttg cggtatgggt cgcctacctc tctggacagg gcgtccgtgc agtgggacct
    61321 atttgaaccg cacatcctga cccactttga cgggataaag cgaacttctt tggcagatac
    61381 agtgtttggg tacgactccc tggccatttc aagggaatgt gaagatcagt atgtgtggcc
    61441 cacgcctgtc actgacatta atattaattt gtgcacggat agtgacacta tggccatcgt
    61501 tagagaacca tccggtctgg tggccgtgaa tctagaagcc ctgttgcgca ccgactccgt
    61561 attatcgcgg gtctcgtcca ttgtctcact cgatacgctc ttggaccttt ccaccccgga
    61621 gtgccgtagg agcgtggagc ttagatacaa ctcacttttg tcgactgtat tatcatggtc
    61681 cacctctagg ggtcacaaat gggccgcaat cgtgaagtgg aagttatttt tcctcgtcca
    61741 agctttggag cctgaggtga gacctactgt ccctgcttga agcggagagg gggtggtgcg
    61801 agttggcagt tgacgggttt gtgatagctg gagtgctgac cacggcacag gacccattaa
    61861 ctttcctatg tgtttatttt tagcaatggt ctccagaatt caaggatctc aaaagggcct
    61921 gccagatggc cgggtttact ctgaaggggg ggacttcggg ggatcttgta ttctcatcgc
    61981 atgcgaactt gctcttttca acctcgatgg gatatttcct ccatgcaggc agtccaaggt
    62041 cgacagcggg gacggggggt gagcctaacc cacgtcacat caccggacca gacactgagg
    62101 gaaatgggga acacagaaac tcccccaacc tctgcggctt tgttacctgg ctgcaaagct
    62161 taaccacatg cattgaacga gccctaaaca tgcctcccga cacttcctgg ctgcagctga
    62221 tagaggaagt gatacccctg tattttcata ggcgaagaca aacatcattc tggctcatcc
    62281 ccctatcgca ctgtgaaggg atcccagtat gccccccttt accatttgac tgcctagcac
    62341 caaggctgtt tatagtaaca aagtccggac ccatgtgtta ccgggcaggc ttttcgcttc
    62401 ctgtggatgt taattacctg ttctatttag agcagactct gaaagctgtc cggcaagtta
    62461 gcccacagga acacaacccc caagacgcaa aggaaatgac tctacagcta gaggcctgga
    62521 ccaggctttt atctttattt tgaaaaaagg gaaacaatgg ggggtttgaa aagggtgcac
    62581 attttcagat attttaaaac ttcattgttc tccaggtgct tggtaaagat ggtatcacaa
    62641 taaaaaatgt ttactgggtc cgcgcaggtt tgtttgtcat cttcattctc tccactagac
    62701 tccagtttaa aagactctag ataaatgggt ttcattagtc cccccatggg ggttgaagcg
    62761 tcgcctatcg ccttatgaag cttaaacata acgagtgggg tggccctgaa atgatcgtcc
    62821 acggacagct cgtaaacaaa ggcggccgtg gcagtcaacg tctctatacc gtgcatgacg
    62881 aaggccgcgt ccatccccgg cgtcctctca tgtgtctttc tggcgcgaca aataatagat
    62941 ctcaaaaacg ttggtgacat gtctcgacag ttctcgagca tcgataacag gcagcagagc
    63001 tcggttatgc cgggagatgt aggtctaagg aggcacactc gctcttggaa cacgtgaggg
    63061 tgtaggtcta tgtgggtcac catgtcttcg tgctccacca ggcacaccac cgtaaatccc
    63121 acaaagttgg gcgaggacag gcgagatttc acgtgctccc tgagacacgc tatatctaag
    63181 tggcccatca cggacatttt gggggtattg cttccaacca gtgcgttgtt tttcctatgc
    63241 acttccagga caaggcgggg caccacaggg tgggggtata cgggacaggc ctcttctgac
    63301 tcgcgagtct tcggggcatg agtactcatt ggcactccag tcagtctcgc cagggccctt
    63361 tccagggaca ttctcgaagg gtggtgtaac tagacagtat ttctgtccca cgtcggttat
    63421 atacacaaag agtctgctag tctgatataa ataggccgcg atgtcctgca agctggagga
    63481 tacgaaggag tgactaatga gctccatctg aagcaggtcc gcgatcacat acgtgaatgg
    63541 accaagcagg atggatatgg tgtcctgaga ataggtgacg ctgagccgct gcccttggtt
    63601 gtcaacaacg ggagccagct tgtaggtttg aaacatctcg ctttcccaca ggttcgtgag
    63661 atctttcatg ctttctctca ctgggggtat gtaagaagag aaaaagctat ttagcacggc
    63721 actgcccgat gggatatggg aagacgttag ctgcagagag gggtcctgta aacgtcccag
    63781 agattgaaat gtgttggcgg tcagcagatt cacactcccg ggaccctttg cgtcaccggg
    63841 ctgttggtgt gacagctgtg tctcaataca ttttagcctc ttcatgcaga gctccctctc
    63901 cttttcaagt tgagttattg tgtcaaattg ttcgtttatc tggttggtga gacacttgaa
    63961 aacgctgttg gacacctggc gcctgagccc ctgagtggtc gtctcttggc ctgtgccgaa
    64021 tagtttattc ttgtctacta tgttttggga cacgtcggtg acaaagtcct ccacgacgtc
    64081 ggtgacaccg ctcactgtct tgttttctgc cagtttcatg agcaggttga ggagctctcg
    64141 cttggggtct gttctctgag aggcctgctc caggtgggtc atgatgtctt tgtacacatt
    64201 gttacaggcg cttccaacga gggccttggt gggggctgtg ttcaggagct ggcaaagttt
    64261 tgcgtgctct gccgtccggt gacagctcat aatgctggta tacatcctct gaatggggct
    64321 gtcaaagatc acccgcccag ccaagatggc gggcatagta atcacctcca catgaaccct
    64381 tttctgctta tacaatccca cgaaagtgtt tttaacacag tcatagtcta tgctcacctc
    64441 tgagtagccc ggaatataga gggcgcttaa actagacacc aggttgctaa tctcctgagt
    64501 cacgctggtg agtatccggc ctatggtttt ttcaccagag gccagacgct ggcaatcttt
    64561 catcagctgt tcctggatag agttaaccag cttgtggtcg ggtgtgtgct tgacgactgg
    64621 taccattcct accgtgacca cccagtctac gtatctctca tacgagagct gtgtcttggc
    64681 gtagaggacc cggttgatgg cattgagaag caggtggtct aatgtcatgc gcatagtctg
    64741 ggcccaggag tcgaaggttg accttctgta agacccccac tgtgcttcct tttctggcca
    64801 cctggttttt gctgaggact cgtatgtcct ccagtcggac aagacgtggt cgtagctaca
    64861 gttggccaat gcattcttgt acaggtggat aaatagctgt ctgaaaaaaa cacccgggtt
    64921 tcgcaggctg cagtgtagag tctgacctct gacataagaa tacttgcctt gcaggatctc
    64981 aaagagggag atggacagct cggaagggtg cactgatatg gacgagccca gccccgggtt
    65041 catcctcaac atgacatcgg atgccaaagt caggagcgta gtggaacaga ttgacaggtt
    65101 gtcaaatatc actacctcgc ccccggagat gggctggtat gacctagagt tcgatccact
    65161 ggaagacgaa ggcccctttc tgccgttttc ggcatacgta ataacgggga ctgcaggagc
    65221 ggggaaaagc accagcgtat ccgccctaca tcagaatctc aactgcctaa ttacgggggc
    65281 tacagtggta gcggcacaga atctttccag ggctttaaag tcctactgtc ccactatata
    65341 ccacgccttc ggattcaaga gcagacacat taatatctgc cagaggaaag tgcccaaggt
    65401 aactcagtcc tccatcgagc aactccagag atacgagctg gctaggtact ggccaactgt
    65461 caccgatatt attcgagaat ttatgcgcaa gaaacaaaag gggcagtata gctccctctc
    65521 tcaaagcgct ttcagactcc tttgccgtat gggtggagcc aatttgtgga cgagtaacat
    65581 tatcgtgata gacgaagctg gaaccctctc gtcccatatt ttgacggccg tggtgttctt
    65641 ctattggttt tacaacagtt ggctggacac cccgctatac agaaatggtg ccgtgccttg
    65701 catagtctgc gtggggtctc ccacccagac ggacgccttt cagtcggtct tcaaccacac
    65761 gcagcagaga aacgagatat ctgcctgtga taatgtgctc accttcctat tgggaaaacg
    65821 tgaggttgca gattatatta ggctggacga gaattgggcc ctatttataa acaataagcg
    65881 ctgtacggat ccccagtttg gtcacttgct gaagacctta gaatataatc tagacatatc
    65941 accagagtta atggactata tagataggtt tgtggttccg aagagtaaga ttctggaccc
    66001 gctcgagtat gcagggtgga caagactctt catctcacac caggaggtga agtcttttct
    66061 ggcaacgctg cacacctgcc tgtcgagtaa taaggatgct gtgtccacaa agcttttcac
    66121 ctgcccagtg gtctgtgagg tgtttacaga gccatttgag gagtacaaac gggcggtagg
    66181 cctcacacac atgactccca tagaatgggt aacaaaaaat cttttcaggc taagtaacta
    66241 ctcgcagttt gctgatcagg acatggctgt ggttgggacc tatatcacag acgcgtccac
    66301 acagatcacc ttcgccacta aatttgtcaa aaacagctat gctaccctta ctggaaagac
    66361 caaaaaatgt atatgcgggt ttcacgggtc ataccaaaga ttcaagtcca tcctagacgg
    66421 ggagctattt atcgaaagtc attcgcacga taaccccgct tatgtgtaca gtttccttag
    66481 taccctgcta tataatgcca tgtactcatt ttacgcgcac ggggtgaagc aggggcatga
    66541 agaattcctc agggacctca gggaactgcc ggtgtctcaa gagctgatct ctgagatgag
    66601 ctccgaggac gttctggggc aggaggggga cacagatgcc ttctacctca ccgccagcct
    66661 cccaccatcc cccacccacg cggctcttcc aacactggtg gcctattact ccggggccaa
    66721 ggaactattc tgcaacaggc tggccctggc acgccgacac tttggtgacg agttcctcca
    66781 ctccgatttt tcaacgttta cggtgaacat cgtggtgcga gatggcgtgg actttgtgtc
    66841 cacttccccc gggctccacg gtctagtggc atacgcatcc actatagaca cctatataat
    66901 ccagggatat acgttcctcc cagtgagatt cggccgtcca ggaggacagc gcctcagcga
    66961 ggacctgcgc agaaagatgc cctccatagt tgtccaggac tcatcggggt tcattgcctg
    67021 cctggaaaat aacgtcacca agatgacaga gaccctcgaa ggtggcgacg tgtttaacat
    67081 atgttgtgca ggggactacg gtatcagttc taatctggct atgaccatag tgaaggcaca
    67141 gggggtttca ctaagtaggg tggccatatc gttcggcaac caccgcaata tcagagccag
    67201 tctagtgtat gtgggtgtat ccagggccat cgacgctcgt tacctggtaa tggacagtaa
    67261 tccccttaag ctaatggacc gcggcgacgc ccagtcccca tcctcaaagt acatcatcaa
    67321 agccctatgc aaccccaaga ctactctgat ctactgaccc gtacccctct cttaggacac
    67381 tgatgtgttt gggaataaag catgagactt gacacctata atggtctgta ttgacaccat
    67441 tcttttattt atcagtccag ccacggccag ttatatgcac cgtttccaca caggggtggc
    67501 gtggaggcca ggatgcgggt tgggtcgctg cacctggacc ccgcggtagt tgtgcttcct
    67561 gatgaaatcg agtgggcgga agtactggga gattgggttg ggaggtgacc ctttgtgctc
    67621 gacggagaca cgatcacgct cacggcggac gagggctcct cgtctgtgtc actccccgag
    67681 gatataatta tcacagacgc cactgctttg cggcttaagt ttggttgtct ctggcagcgc
    67741 accacatcct cgctaccaga ggaggcggta gactgccttt tgcgcttctg gcccacgtcc
    67801 atgagcccga ttctctgact caatacttcc ccttggtctt ctccgtcctc ctcggacgag
    67861 ggtggctggt gggaaaaatg gcgcgcgtcg gtaaacgcgg cctcattgtt cacgtccgga
    67921 gagttggaac tgtcatcgct atcagagtcc gatgtcaggt cgacgatcgc ggtgggtgcg
    67981 gcgcgcaggg ggcgccacga gggcccttca tcagggtcgc tgtatggtga actttgtgtt
    68041 ccaggtacac tatttctgga agcaggtgaa agtccgtatg ccccggtccc agtgtatgcc
    68101 gccatcggtt ccaggatagc aaccccctcg tcgtctgaag gtgagagccc agcaggggaa
    68161 aatccgtcat cctgactaac ccatcccatg gacgcctcgg actccgccgt gtccgttgaa
    68221 ctgcgcacgc ggcccgctac cactgctacc ggtttgggcg tatgggcccg tctggccaga
    68281 ggcctcgggc gcaagtgaga taaaggttga aaaaagtctg cagggtaccc ctctggctcg
    68341 tcttcctcct gaacatcgtc attttcttct tcatcttcat cttcctcatc ctcgtcatat
    68401 tcagattcgc cgctcgactg atccggggat atctgtagat ccagaggggt tgctggcggc
    68461 gatggcgtgt cctcggcgaa gacgtcgtct ggggcagaca tatctatcac cgtgggtcca
    68521 gcatagccgc gcggcctgcc aaatcctgga agtgatgaaa gaggtggagg tgggaatatg
    68581 aacttcacgg ggggtcgtct gcgaggcgct ccttcaattg gaagcattct ctcttcatcg
    68641 tgtgtgctag acgaggtcct cacaaacatc gccatggcct tgtacggggt tgaccgctag
    68701 gggcggaaat ttacaaagca cacgagttat tgcctttact gctccaacag gccccagtcc
    68761 acagtctcac gccggtggcg agtcaaatag tcgttggcta ggttaaagtg attacagccc
    68821 tggaaccgag gccatcgcga gtgtcggcca ccaagagagg ccagcggaga tggatgctgg
    68881 gccgtaagca ccaggtgttt ctgtgcgttt atgagcggag ttctgtcaat ggccttgcgc
    68941 ccccacagga gaaaaacgca atgttctaac tttgaggata tgctactgat gatgaaactc
    69001 gtgaaccaat cccagccaag tccctcgtgt gagccggccc tccccttctc caccgtcaaa
    69061 actgtgttta gtagcaacac accctggcga gcccagctgt cgaggcaccc gtgggaagga
    69121 gtactgaaat tggggacgga agcctctagc tctctaaaga tgcttctcaa actgggtgga
    69181 acctgacatt gcggatccac actaaacgcc aggccagtag cttggccctt gtggtacggg
    69241 tcctggccta agatcaccac tttaatatcc tctggatcgc agcagtggga ccaccacatc
    69301 agcttgtcct gtgggggata cactgtggtg gttagcctaa gttcccgaat ctgtctgagc
    69361 agcgagagca gtttctgttt cagaaatgat gagaggctca gaaaggaaat ccacttaggt
    69421 gccagtaaca gatcccggtc gtccaccccc tgactgatgg atagggtgcc cctaaagacc
    69481 gtctgttgca accatgcgtc catgttgaac ttattttccc ttttgacctg cgtgcgctct
    69541 ccggctgctg cttttagccc gagtctgact tccgctaaca gaacctgtcc ggttcatggc
    69601 ctttcccacg cttattataa ttatgtttac gttgtgaata gagctatctg cagtggtcgc
    69661 gttaaaacct acagtatagg ccgtcaaact tcgttgtaaa taccacaaca acctcaggtt
    69721 ttcctgcgac gcccaggacc ccaatcttcg aacgaccgcg actaaaaatg acctcagatt
    69781 aaacccattc acgcatgttt ccacggtaat gtcgcctgtt ttgcttcgca gcttggctat
    69841 acagaccccg ttgcagtgat tcggatcggc gaagtggata gagtggaccg caaagaacaa
    69901 cggcagggta gaggctgccg atgcctgaat tgcgcaacat ggtaaggcga cgtatgcgtg
    69961 agatgtgacc aatagggtgg tccacaggac ggcaaatagc gcaaagatcc ccatggggca
    70021 aatccgggtt tcacccttgt gttgcctggt tcggtgctcc ccagggagcc cccttccgta
    70081 atatctgttt tatatagtga gggttcacgc atgcgcgagt cccgactaat gaggacaatt
    70141 actgaaattg accttttcgc gacacggggg tgaggtctat ttcccacgac atacttccgc
    70201 ggaaaaatac ccacgctcct taatttccgt gggaagacga tgggggaaat gtggcattac
    70261 ctgacacggt ttcaatcata ctcatcgtcg gagctgtcac acgtctggct gagattttct
    70321 aaaaagtcat ccaatgaatc atcggaatca tcagcacact ctagaactac tccatatgcc
    70381 ggggtgcgcg ggggtcccga gtagtgcacg tcgccatcgg gagacacaga tgatgggttt
    70441 gaaatgtcca tacgggccgt gtgcacaagg gtcacgtccc catccccaac acaaggacct
    70501 ttagataccc tctcccggca tgtgcgcgta tccgggcaag caagctggtg ttctggattc
    70561 caaacgtgcc cagcggtacc caaaatcgcc agggcgtgtt ttattatttc cacaggaacc
    70621 ggtttctcta attgcatcac cagggtatcc aaaagccggg cttccacgtt gatccggctt
    70681 accgacagtt ctttccaggg tttcctggtg gggcgcggca gctgactcaa aaaggtcact
    70741 gcctctgccc atgggcgggt gggtgacagt ccgccatact cttccaggac actggccatg
    70801 catgactcca accgtctcac gtccgaggta atgtgctcta tgaagatgtg gtagagccag
    70861 cagacgttca aacacgatga aatcaagcta agctcccgcc ggaactccac atccacaaag
    70921 gggtattgct ccggtgtctg tattaggtct ggaatagaaa actcagaaaa agacactgac
    70981 ccaccaagga gaacctggcg tcttgcaaag ttgatgagcc ccgcagaaag aatgtgtctc
    71041 ccgtgggaca aagagcttgg gggggcagag atggcgctac agtgggtgat ttcttctacc
    71101 acggtcatac attggtggca cccacaggcc tgttccagta tcagcataaa tctatctttg
    71161 cagtcatccc agatcaaagt catgtcagat gctgttgcct ggcattttgc ccgcatgtac
    71221 atttcctgtc ccacatattt taacatctgt aatactggaa gtagattcag tctggtgttg
    71281 agcccccccg gggaagccag cgtatgcttc aggaccacca gggacgctaa gaaccccggg
    71341 tgtccgcgct ccggaaacag acctctgaga atacgctcgg tcttgacgaa acccgatgtg
    71401 gtaccgaatg ccacaatctg tgccctccag ctctcacaat tttcatctcc aatacccgga
    71461 attgggatac acacctccat gttcagtcac atgtacgcta gggtctcccc acccaacccc
    71521 cataggaccc agctacagct tatcctccac taaataccag gcagctaccg gcgactcatt
    71581 aagccccgcc cagaaaccag tagctgggtg gcaatgacac gtccccttta aaaagtcaac
    71641 cttactccgc aaggggtagt ctgttgtgag aatactgtcc aggcagccac aaaaatggcg
    71701 caagatgaca aggtaaagat cgaccttttt attgtatact gaacaatgcg tgtttacaat
    71761 ggtgtaggtg ggagcagagt tcgccaagct ctacgtccga acagtcgggt gtcagggctc
    71821 ttattaagtg ttcggtgtac ttgaccaaag ccgcggaacc taggttgggt ctgtacaggt
    71881 cgtaccaggc aaaaaaggat cgggcggtgc ttttcaggag agttagggac gtgctgatta
    71941 tgtggacaag cttctgctcg taaatgcacc gctggtacat ctgaacgaca gctgtccaaa
    72001 aaaaacaaag gttcagctgc acgttaaaat ctgtatcctg aaagtcctcg taaatgacag
    72061 tttctaccaa gaaaaacttt tttaccacgc tggccatcca ctgaaaggag ggagcacacg
    72121 tcccgttgtg cgttgttagg atatccctaa cttcggagcg gagacggccg gacgctccca
    72181 caaaatggga gaggcaccac tctgtgcagt ccgcggtcgg gggttctgat tccaggggcg
    72241 ccgtgtgggg gtattggaga gtcaaaactc tgggcagtcc cttaatgagc tctctctcaa
    72301 aacctatgca gccagcgtcc actagtggca gcatgccgtt aataacaccc cttatcttgt
    72361 cgttgccaag tttgtacaac tgctgcaggg aataagccaa attcgcccta gccgcgggaa
    72421 ccaggtacgg ctcgctttgt cggtgctgga ccaatatctg aatggtcttt gcaaggtata
    72481 gggtcttctc aacgtttaga gcgggtacgt ggcagtctgg attgagggtg gcgacggaca
    72541 gggtatctaa ctcctgaagt atctgatccc aggacgggta atgataccta aacagatggt
    72601 tgaacaggtg atctttaagg ggccttctcg atgtcattgt aaaaactatg acacgccact
    72661 ctctccttag ggtaagaagc ttcggcggtc ctgtgtggaa agcttcgtcg gcctctcgga
    72721 cgaactgaag gcccaactct accagtgtgt gctccttata aatgacgcat acgaaacaat
    72781 ctacgatccc agtgacctaa atagagtggt ggaagatgtg tgcattcgga ttatgaaaga
    72841 atgttccaag cttggtgcgc tatgtggtct gtttacagac attaacatgt ttaacctttt
    72901 ctgctttttt cgtgcctctc gaatgaggac caaaggcgcg gccgggtaca acgtgccatg
    72961 cgcagaggca tcccaaggca ttattcggat cctcacggag aggatcttat tctgcacaga
    73021 aaaggcattt ctgacagccg catgcagcgg ggtgagcctg cctccagcca tatgtaagct
    73081 actacacgaa atatacactg aaatgaaggc caaatgcctg ggggcctgga ggcgactcgt
    73141 ctgcaatcgg aggcccatta tgatattaac ctcttcccta ctgaagctct acaacacgta
    73201 cgataccgcc gggctgctct ctgagcagtc cagggccctc tgccttttgg ttttccaacc
    73261 ggtctacctt ccgaggatta tggcgccgct ggagatcatg accaagggtc agctcgcccc
    73321 tgaaaacttt tacagcatca ccggttctgc tgagaaacgc cggccaatta ccaccggcaa
    73381 ggtcactgga ctgtcctatc caggaagcgg tctcatgcca gaatctttaa ttttgccaat
    73441 cctggagcca ggactgttgc cggcttccat ggtagacctc agcgatgtgc tggcaaaacc
    73501 cgccgttatt ctgagcgccc ctgccctgag ccagtttgtc attagcaaac cccatcccaa
    73561 catgccgcac accgtcagca tcatcccctt taacccatcg ggtacagacc cggcgtttat
    73621 tagtacgtgg caggccgcgt cacagaatat ggtgtacaac acatccaccg cgcccttaaa
    73681 accggccacc ggtagttcac agacggtgtc agtcaaggcg gttgctcaag gggccgtgat
    73741 tactgcgaca acggtgccgc aggcaatgcc agcgcggggt accggagggg agttgcctgt
    73801 aatgtcagcg tccactcctg caagagatca ggtcgctgca tgttttgtcg cagagaacac
    73861 cggagattct cccgacaacc cgagctcttt cctgacgtca tgtcaccctt gcgatccgaa
    73921 cacggttata gtggcccagc aatttcaacc accgcaatgc gttacgttgt tgcaggttac
    73981 ctgtgccccc tcttcgacac caccccccga ttcaacagtc cgggccccgg tggtgcagtt
    74041 gccaacagta gtccctctgc cggccagcgc gttcctcccg gcgctcgccc aaccagaagc
    74101 ctcgggcgaa gagcttccgg gcggtcatga cggagaccaa ggtgtgccgt gtagagattc
    74161 aacggcggcg gctacggcgg cagaggcgac aacacccaaa cgaaagcaga gaagcaaaga
    74221 gaggagctca aagaagcgta aggctttgac cgtgccagaa gccgacacca cgccatcgac
    74281 cacgacacct ggtacctctt tgggatcaat taccaccccc caggatgtgc acgccacgga
    74341 tgtcgccacg tctgagggac catcggaggc acaacccccg ctactgtcgt tacccccgcc
    74401 actggacgta gatcagagtc tattcgccct gttagacgaa gcgggccctg aaacatggga
    74461 tgtcgggtcg cctctctccc ccactgacga cgcgctgttg tccagtattc tgcaaggact
    74521 gtaccagctg gacacgccac cgcctctgcg gtcaccctcc cccgcttcct tcggcccgga
    74581 gtctccggcg gatataccgt caccttctgg tggagagtat acgcaactgc aaccggtcag
    74641 ggcgacctcg gcgacgcccg ctaacgaggt acaggagtcc ggcacactgt accagctgca
    74701 ccaatggcgt aattacttcc gagactgaag tgttcgcaag ggcgtctgtg cctgcgttaa
    74761 cttcccaggc agtttatttt taacagtttg gtgcaaagtg gagttaacct acagattcta
    74821 cttaaaatag ctcattttct cacgaatctg gttgattgtg actatttgtg aaacaataat
    74881 gattaaaggg ggtggtattt cctccgttgt cgactataac ctggcgtgta aacgtgtaac
    74941 cctgccaaat gcccagaatg aaggacatac ctactaagag ttccccggga acggacaatt
    75001 ctgagaaaga tgaagctgtc attgaggaag atctaagcct caacgggcaa ccatttttta
    75061 cggacaatac tgacggtggg gaaaacgaag tctcttggac aagctcgctg ttgtcaacct
    75121 acgtaggttg ccagcccccg gccataccgg tctgtgaaac ggtcattgac cttacagcgc
    75181 cttcccaaag tggcgcgccc ggtgacgaac atctgccatg ctcactgaat gcagaaacta
    75241 aattccacat ccccgatcct tcctggacgc tctctcacac accaccaaga ggaccacaca
    75301 tttcgcaaca gcttccaact cgcagatcca agaggcgact acatagaaag tttgaagagg
    75361 aacgcttatg cactaaggcc aaacagggcg caggtcgccc cgtgcctgcg tctgtagtta
    75421 aggtagggaa catcaccccc cattatgggg aagaactgac aaggggtgac gccgtcccag
    75481 ccgcccctat aacacccccc tacccgcgcg ttcaacgccc agcacagccc acacatgtcc
    75541 tgttttctcc tgtttttgtc tctttaaagg ccgaagtatg tgatcagtca cattctccca
    75601 cgcgaaagca aggcagatac ggccgcgtgt catcgaaagc atacacaaga cagctgcagc
    75661 aggtatagac gggaaacagg tgtctatctt ggccggctgg ttactcaaat gggaacaatg
    75721 gcgccacctt gctgtctttg taggcattag aagaaaagga tgcacaacta tgtttcctag
    75781 cggcgagatt ggaggcacat aaggaacaga ttattttcct tcgcgacatg ctgatgcgaa
    75841 tgtgccagca gccagcgtcg ccaacggacg cgccactccc accatgttga agcttggttg
    75901 tgccgtcgtc cgggagaacc atgccagact ttgtgtggta agaaggaatt gttatccggc
    75961 agcaatatta aagggaccga agttaatccc ttaatcctct gggattaata accatgagtt
    76021 ccacacagat tcgcacagaa atccctgtgg cgctcctaat cctatgcctt tgtctggtgg
    76081 cgtgccatgc caattgtccc acgtatcgtt cgcatttggg attctggcaa gagggttgga
    76141 gtggacaggt ttatcaggac tggctaggca ggatgaactg ttcctacgag aatatgacgg
    76201 ccctagaggc cgtctcccta aacgggacca gactagcagc tggatctccg tcgagtgagt
    76261 atccaaatgt ctccgtatct gttgaagata cgtctgcctc tgggtctgga gaagatgcaa
    76321 tagatgaatc ggggtcgggg gaggaagagc gtcccgtgac ctcccacgtg acttttatga
    76381 cacaaagcgt ccaggccacc acagaactga ccgatgcctt aatatcagcc ttttcaggtg
    76441 tattacacgt ttcaactgta atccctcgca attgggtaaa ccgtcggtgt gtagggataa
    76501 agcgtaacct tacgttctgt ctcatctaca ggatcatatt catctgggga accatccagg
    76561 accacgcgaa ttcgcgtatc accggtcgca gaaaacggca gaaatagtgg tgctagtaac
    76621 cgtgtgccat tttctgccac cactacaacg actagaggaa gagacgcgca ctacaatgca
    76681 gaaatacgga cccatcttta catactatgg gctgtgggtt tattgctggg acttgtcctt
    76741 atactttacc tgtgcgttcc acgatgccgg cgtaagaaac cctacatagt gtaacacaaa
    76801 accataaaag taaataaacg tgtttattgt tcacatgata aagagtggta ctctttactg
    76861 gtttgggggt tgggttgtgg cgtggtggct ggtccgcggt tcagtcatca acccccgccc
    76921 gtgttgtcga ggctcctctt cgtcgcctgt tattggcacc aggaggcggt ttagcggtgc
    76981 ccccgtctga catgcagacg tcgattctaa gcgaaagtcc cttcagggca tcgtccactt
    77041 gcttttgtgt tacaaccttg ctgaatattg tcctgaccct ggcttcgatt ttcttagcgg
    77101 ccgccgcact cagtgcaccc acagtagcgg taagctgcgc ttccttctcg gtggccgtca
    77161 gaggccgatc tctcggatcg gcagtggatc ccagtgcttt ccgaagctcc cgattctcca
    77221 cagtcaattg gcttatcttt gcggttaggt cttccatcgt aaggtccttt ttgggtctgc
    77281 ccctgggcgc ggccatgtca ggtacgcgta gatgtacgtg ttggtgatgc tcacaacaaa
    77341 agcccaaatc cctcctttat acccagcttt aaatacttta ttgaaaaccc atagctttcg
    77401 tcagcgcttg tgcgagtaat cacatgccag tctatgcatg gaccacctcg tccacaaact
    77461 tgaaaaaaca aagatatacc agatagaaaa atgtggccac gacgactagt aacgcgttaa
    77521 tcaaggccca gacgctagaa aagctagaaa gggaggggct aaaactatcc gcggaacaag
    77581 caacgtcata gaatcctggg gtagtgactg atgtgggacc gggcgaaggc ctggcgctga
    77641 gcccagccgt actgggacta gaacgctctg tagatgatgc gacacctgtc gagttggccg
    77701 taacccagca gtgacctagt atcgaggcca caaataaagc cagggccacc gtggacgctg
    77761 tcattatgaa caaccgccga ggctccaagc cgtctatcca acgttccgcg ttcgcctctt
    77821 atatacactc tgcaatgcag tccgactctg cccctctacc cagggtggaa tatgtgttcg
    77881 aaacaagcaa atttagaatg acgtcgagag caaatgaagc cagactcaga ctgacaaatg
    77941 agtgtccgat actggtgaga ccccacgagc cgttcatcat gcccaccgga atacacttca
    78001 cgcgaacccc tagctgcgct ttcatcctga ccggagagac cgacaaggat gtattttgcc
    78061 acacgggcct aatcgacgga ggctaccgcg gggagataca ggttatttta ctcaacaaga
    78121 ggaagtaccc tgtgacgctg tatcgcgggg agctcaacat ctgcctgtct gctttcaatt
    78181 acgtgctacc tccgttgagg gacgtatcat tcttaacccc ccctatgtat gcaaacgacg
    78241 ccggatttga cgtgatggtg atgcactcta tggttatccc tcctactact gaccaaccgt
    78301 tcatgatata cctaggagtg gagaccccag gcccccctga accccacgtg gctctagcat
    78361 tggggcgatc cggtctagca tctaggggta tagttataga cgttagtgag tggggaccgc
    78421 gaggattgca gctgaagttt tataactact cggggcagcc gtggctggcg cagcccggta
    78481 gccgcatatg ccagattgtg tttgtggaac gcagacacat cctcaagggc ttcaaaaagt
    78541 gcttgcgcca taggaagcta gctcctggcg tccgtttccg ggaggctcga gtgcattttc
    78601 gcgaggatac aaatagcgtc cgaaaacata cccacgaaga caaccccgtc cacgaaccca
    78661 acgtagccac cgcttccgct gacattcgtg gaaccaaggg gctggggtcg tctgggtttt
    78721 agagccgccg ccaaatgcgg ccagtttatt agggcgattc gatcccgcaa cccacagcat
    78781 cccccaaata aaaaaacgag tgtacacagc caatgttttt attattgttc gattcattac
    78841 tggtaccaga gaataaagcc aacctatgtc gaacctatcg cgctttctgt cgtctcttcc
    78901 agggttgacg aaggccgggg agggattgac gaatgcatcg cggaaacgga cgggtcttcg
    78961 gtgggtggct tgggtaaagt tgcctccggc tggcgcgtaa cggcaggcgt gagaggcaat
    79021 acagaagtgg gttccgacaa ggagtggctg atctcagagg cccatattac cgagtcgtct
    79081 gacgccatag cagtcgccag tttttccatc tccatgagcg aaacgcattc cccggccctt
    79141 ttgtttaaga gggactggag cgcactgtcg tccacggtaa tctcgccgac cgccaaggcc
    79201 agcattgtgt tccacacgac gttctgaata gactgcagtt ttttcacctg ggttttcacg
    79261 gtctcctggc agcccgccgg aattttagcc acgtcaaaac gcttcaggta gtctgtgatc
    79321 ttgtttgact gtacagccag aaggtaggtc tggtgcagcg ccgtcgtgcc aaggttcgac
    79381 tggacaacgt cacccagaca cactccgggg gggaggccca aatctatctc ttgccgccag
    79441 cgctctggac agccttccag agggtcaccg aggcgcttgt aagcgtggtt gccgcgtcca
    79501 aaaaggttta taccgcaaca cgtccaggtg taccatggag acgacatacc gccgcgaggc
    79561 gctgacagta agggttattt tttgtacgag tggcgacagc gccgagacga tcgccgacgt
    79621 ccttacgggg gccccaacgt cagcgtcctt cttttctgta ctccacgacc ttttttattc
    79681 ccagatactc gcccccaggg taaccctaaa attgtgcctc cccgcacggc gtcctggcaa
    79741 cggcacaagg tgttcgcccg tgttggtcct acgtactgac gcatcagtgg cctcggggtt
    79801 ccttggcggc cggccactgg aggcgtccga cattaaatat atgctgctca gcgaccagac
    79861 cgcggggttg ttcaagccgc tgttggagat aatcggtggc gcgcgcgcac caccaaatca
    79921 ggacgcgtgc actttccaga gccaggtggc ctggctcaga acgaaatttg ttaccgcatt
    79981 gagaaaactt tacaagatga ctccctcacc ctactggatg ctgtctgcat ttggcgctca
    80041 ggaagcccag ttcgtcctga ccagctcatt ctattttttt gaacacactg tggtctgtac
    80101 cacagagaca gtttctcacc tgtctagact gttttcgcct caacagggac agacgctggt
    80161 ttccgttacc agccacgagg agctggggca gctatacggc acttcccctt tcaggcggcg
    80221 cgtccccgcg ttcgtcgctt atgtaaaaga gaaattagcg agagacagtc tggagacgga
    80281 ggccatcgac cgcaccatag accagatcag gggcaaactc atgctgtcta accaggacct
    80341 ggtccatttc atatatatct ccttttatca gtgcctcaac aaacgggcgt tcctgcgcta
    80401 ctctagacag acgtcctctt caagtgctct aagggagctg ggggaagacc ctcaattgtg
    80461 tggcgcccta cacggggagt ttcgtgacca cgtccagtcc tactaccaca aaaaaaccta
    80521 cctatccact tacatagaca ttcggtacgt gggtggcgta ttaccagacg gctattttgg
    80581 cgggagtctt gtaggcgagc ggtgcgttta ttggtgcggg cagtcaaagg acacggccag
    80641 cctgttggcc accattagcc aacaggtgcc gcacctgagg ttgcaaaacg agttcgctgg
    80701 catgctagac gtggccgcac tgcgaggttc cgatgacggt cagtttaaag agggcctttt
    80761 ctcccacagt caagccctac ccctgtacag gtgcgagttt ctgggcaagc agtttttcac
    80821 aatgcttcag gaagacggcc tagagcgata ctgggagcaa agtgtgatat ttccaggcga
    80881 ccaggactgg gatatgttat ctgacaaaga cctcacctac cgaatttttt accatgacct
    80941 cagcctatcg ctgccaacac tgaaggaaca gctccttgtt tcaagacacg aatacttcaa
    81001 ccctcgcttg ccagtgtata gatgggtatt agactttgac ctgcccgtct gccgcgacat
    81061 tgacaggaca ttcgaggagg tgcactctct ctgttgttcc ctgcgtgagg ccatactcga
    81121 catcattcaa ctccttggac cagtggatcc tcgaacacac ccagtatatt ttttcaaatc
    81181 agcctgtcca ccggacgagt ggcgcggcga agacgtcgcc agcaccagct tctgtcggtg
    81241 tcatgacaaa ctgggtatgc gtattatcgt cccgttccca gaaggagtat gcgtcgttgg
    81301 gtcggagccc atggtggcac tcactggcat tctaaacagg acgataaagc ttgatccgga
    81361 gctggtccac agattcccgt caatacaaaa aaaggggggc cctttcgact gtggcatata
    81421 cggccgagga cgaagcgtcc ggcttcccca ctgttacaag gtgggcttag tgggggaact
    81481 ctgccgccta ctgaagatac tagtctgtca ccccgccccc aacggcaagg cgcagtacgt
    81541 gcggcgcgcc tttacgcttc gcgaactgct ccatcactcc ccgggccaca gcgccggtca
    81601 tgtcggccga atcatctata gcatcatgga tcgcaatgag aattttttag aaaacaagac
    81661 cattagctat ctgccggcca aaatacctca catctttcag cggatagaga ccctatccgg
    81721 tcgttcaata gaggactggc tacactcggc cgtttgggat aaagcatacg acactatatg
    81781 taaatttttc ccagatgaaa aagcacaaca gttttctcac gttgcattta cgcaacaagg
    81841 ggaaaacatc atccagttaa gaccccgtca gggaagacac ttcctctgca tcaaccataa
    81901 tcataaaaac aagtcaaaaa cagtccgtgt attccttacc cttcattcca ttagggtgag
    81961 cgaagtcacg gtaacactta tgagtcagtg ttttgccagc aagtgtaaca ataatgttcc
    82021 cacggcccat ttttcgtttg tggtaccagt gggactggcc agttaatccc actatataac
    82081 ctggctgcca ggttcccaaa atagcccgcg gcatacggct cacttccccc cacattcccc
    82141 cccgtgcaca atataagaac caaaggacat ggtacaagca atgatagaca tggacattat
    82201 gaagggcatc ctagagggta agtcctcgtc tacaacagac ttttcccatt tctaacgtat
    82261 cgtgctatct tcgtcgcccg gcggaccatc cccccacccc tcatttatcg cgtttgatat
    82321 tacagactct gtgtcctcct ctgagtttga cgaatcgagg gacgacgaga cggacgcacc
    82381 gacactggaa gacgagcaat tgtccgaacc cgccgagcct ccggcagacg agcgcatccg
    82441 tggtacccag tcggcccagg gaatcccacc ccccctgggc cgcatcccaa aaaaatctca
    82501 aggtcgttct caactgcgca gtgagatcca gttttgctcc ccactgtctc gacccaggtc
    82561 cccctcacca gtaaacaggt acggtaaaaa aatcaagttt ggaaccgccg gtcaaaacac
    82621 acgtcctccc cctgaaaagc gtcctcggcg cagaccacgc gaccgcctac aatacggcag
    82681 aacaacacgg ggcggacagt gtcgcgctgc accgaagcga gcgacccgcc gtccgcaggt
    82741 caattgccag cggcaggatg acgacgtcag acagggtgtg tctgacgccg taaagaaact
    82801 cagactccct gcgagcatga taattgacgg tgagagcccc cgcttcgacg actcgatcat
    82861 cccccgccac catggcgcat gtttcaatgt cttcattccc gccccaccat cccacgtccc
    82921 ggaggtgttt acggacaggg atatcaccgc tctcataaga gcagggggca aagacgacga
    82981 actcataaac aaaaaaatca gcgcaaaaaa gattgaccac ctccacagac agatgctgtc
    83041 ttttgtgacc agccgccaca atcaagcgta ctgggtgagt tgccgtcgag aaaccgcagc
    83101 cgccggaggc ctgcaaacgc ttggggcttt cgtggaggaa caaatgacgt gggcccagac
    83161 ggttgtgcgc cacggggggt ggtttgatga gaaggacata gatataattt tggacaccgc
    83221 aatatttgtc tgcaatgcgt ttgttaccag atttagatta cttcatcttt cctgcgtttt
    83281 tgacaagcag agcgagctag cactgatcaa acaggtggca tatttggtag cgatgggaaa
    83341 ccgcttagta gaggcatgta accttcttgg cgaggtcaag cttaacttca ggggagggct
    83401 gctcttggcc tttgtcctaa ctatcccagg catgcagagt cgcagaagta tttctgcgcg
    83461 cggacaggag ctgtttagaa cacttctgga atactacagg ccaggggatg tgatggggct
    83521 actaaacgtg atagtaatgg aacatcacag cttgtgcaga aacagtgaat gtgcagcggc
    83581 aacccgggcc gcaatggggt cggccaaatt taacaagggt ttattctttt atccactttc
    83641 ttaaggattg ccaaacccca tggcagagtg tctcccgtat tccatgtaac tcacgtagcc
    83701 tttctctaat aaacaagcta cctgcaaact atacacaaat gaaatgagtc aggcgtggtc
    83761 tcttctctac cgtgaatcgc accttaaaca caacaccaga ccgccaccag gtggcaccca
    83821 acatccatta tggaaaaacc ccgcgccacc ttccgccacg tggagccaac aaacaagaca
    83881 cacccgccaa tgttttggtc tctttattga tatgatatac tccctcccat aacaatacgg
    83941 tgtaggcatt ttgtattatt tattgcatgg catcccataa cggcttcggc attatttcga
    84001 gtacgacgca ggcgtctgag aaattactgc acctcgccgc aaagtctcgc ggggacgggg
    84061 cgtggggctc taacttgcca accgccaccg gtttccccag ccacagcttc accaaaggac
    84121 acgtcacgtg agagggtgct ggtaacggtg aatttgccaa ccccaccaga aatgtattcg
    84181 ggttaaatat cctcgtcggt tttccctggg gcagcaagag ggggccggag tcaggcggaa
    84241 cggtatttcc aataaagtgc acgggcccgt tatgataaca tacgcaaaat atgccattac
    84301 aagagctagt cagcagaatg ccttttgcac atgcgtccag cgtatcgcat agctcccgct
    84361 tggctatctc gcaggccagg tttggcacat tgggtagcca tacctggccc ggagacccca
    84421 ctgcacagta atgaactgcg gggtccctac gcaaggccga tgagattcga cagcccgact
    84481 ggcttgtcgt cagtaactca tgaacctgtt cgccattata atacatcctg ataaacaacc
    84541 gaccccagtc aatgacggcc tcctgaccct ctgccgtcgt acaagatggc acgggcgtta
    84601 caatctcgcc tggcaagcac tgccccgggg aaaaaaatcc ctcttgcaag agacgtgcca
    84661 tattgttaaa atcgtggacg gctccggcca cgactccaca ttccacgcat tgttcttcct
    84721 ccggtttacg tactctaaag accagaaaat ggtgtccatc ctgagaaatg cctttgccaa
    84781 tctcttgtaa accccgcgtc ctgcgtagcg cggcaagcat tcgcctgcgc cccctggtgc
    84841 ctttaaacga ggcgtccacg ggcatgttac ccctttcgcg gatatacaca acacccaatt
    84901 ccccgtctct gcgccattca aaacaggggt ccgcgagggg cgtaactggt atacggaagc
    84961 gggtgcgctc ttcgtcttcc cactctactc cgggaaattt tccactgttg acttgacata
    85021 ctatccaatc cttgattgac gctttcccct cactggcacc ggtagatatt cttagttgtc
    85081 gtgtccggct ccactccgtt atcgcagcca ccacagcctg ccgtgtaata tcgcctgcgg
    85141 ctgcagaacc cccggtcccg gagggtcctt ctcccggtga ctccgacctg gatggttcat
    85201 cgcaaggagc cccggagcca gatgttcccg gtgacccttg tgacaaacaa ggttttttgg
    85261 gtatcgcccc aggcgcccca aaagggttcg gtctttggcc tgggtccatt gtcccgcaac
    85321 cagactagct cgcgccgcaa tgtccagtgg taagcacagc tatgccgggg agccaccggc
    85381 catcagatat agagaggcga caggctctct atatatcacg gctaggtggc tgacatatta
    85441 gtgggcctag ccgcagaatt gcctgggtag tcaaaaacca gcgtttctca aattaaccga
    85501 aactacattt ttctatttta agtacgggat acaaagcagg gtctgaggca atctgccgcc
    85561 ctccaccccc acccaccata cccaaaaaag atatgtcaga aagagcactc tacctattaa
    85621 ctcgtggaga aacatcatac aaaatctgta cattattttt aatactttaa tttgtgcagg
    85681 tttcttcacc ccacacctgc tttttgtctg gtacaaaaaa ccactgcagg gtcccgccta
    85741 tagccaactc ctaagcgggt tttttgctaa agcacttttt tagactgtcc cagaaaccac
    85801 atagcttcct tttcactcat ttgaaaaaca gccccgccca actgcctgga gaattttcca
    85861 ccccctctac catttcgcgc ctttaccgct ggtgcgaaat ctagccatcc tatcaccgcg
    85921 gatccgctgg accaatatac cacgcccact tttcgtaatc agcaaccctc tacgcctaca
    85981 cccctatgac tgaatataac ccccaacaag gctatgaaat catgaatggt aactgtctgg
    86041 acaccaatct tccgcggggt ggcggcagtg cgacgcaagt atccacaata aatggtgcaa
    86101 taattggcga aatgtcgtgt ctggtttatt tggactacaa gattacatcc ggttttataa
    86161 ttcacatata tgatcaatgt agactatccc aaatggagcc tataaaaatt ttaacagtca
    86221 agggtacatt ttggaaattt tctgtagatg ccggggatgc gccgaaaaat accgtcccgc
    86281 acgtcactgg gttgacgctc agcggtgtct gtgggattgc ggctgtggtt gccaggtatc
    86341 gcgcggtgtt gaacagctgc tgcggaactc tggggctaaa gcttcggagg atgcgttcat
    86401 agcgggaatt tggattacca aaccaccagc cttccacttg agtggcgttt ctggagtata
    86461 ttccagacat cgagcaaaat attgggaatc cgtggccaag gccttcaaaa actcggttca
    86521 aaatctccat ttgctcgggt gaggggactg taagacgcgg tatgcgaagc agttctggta
    86581 cgaaactctg acataggtgc cccaacgtat ccccaacagg ccagctacat aacattgcct
    86641 cgcccgcgtc accttcgcgt ctcagagttc cacgaaggtt cccatacaca aagatttcca
    86701 caacaaaaga cacccgctga ctatcagggg gatcaaaaaa catctttgaa ggtggctttt
    86761 cgggaccgga gtggctaacg ggcgtacgcc gcccgtgcgg ggacctggac ctcgggcgcc
    86821 gcctatccgt ggcctgtctg gttgaggagc tcggttcctc ctgcagctca gacaaaatgt
    86881 tacccaaccc ttcttcccac gtacatatat cctctccttg aaggttcgag agcgtaagag
    86941 ggagacccaa aggcggcggc actaaagatt gttctggtcc ataacccccc actgcatatc
    87001 tatctccagc atatgtacta acaagtggaa ctctgggcct ttcgccacta cccgggcaca
    87061 cacactcccg ccgctccagc tctgtcggta aatgcgaaac ctcggggttc acagcgggct
    87121 ccggtgcaga ataaagcacc gtaggttgga aaacgcgcgg cccactgaca ggtaggggcg
    87181 tggatgctac agtggtagat ggggtatcgg aatccccagt gaggtcaata atctccactt
    87241 cgagggcacc agaactagtt gtcacgcgtc tgtatccagt cgccatgttg tccccctggc
    87301 agacgtacgg tattccagac gaggatggct cctgtcgctc tgccacctct ggggtgggtg
    87361 gtgcgccggc ggagggcgtg gccgacgcgc caccctgcgt gtgggaaaga ccctggtttg
    87421 gagcgcctcc actagaccac ggaatccaaa gcggtgtgcg aacttccggc accacggcgt
    87481 gaccaactgg tgggtgccaa acaggcgcgc gtatgggtcg cgtagctggc ggttctgcca
    87541 atggactcca attgtaacat gatggtttcg catacccggg cgcgggggcg ctgggcggtt
    87601 gaggttcgaa gggatacacc cgctcactcg cagcaccctg aggagcccgg ccttctgtag
    87661 atgccccgca agcgccttcg gcaccggttt cccggcgggg aagccacgcg ctagcacatt
    87721 ggccgctttg ggggagcaat ccctgtggcg ccagaggtgc accctggctg aactcaccga
    87781 caaatgttcc cgcttgggcg tgcggcggaa tccaactggg ggcagcagga ttcagctggc
    87841 tgctaggaat ccccgtatat gtccaacggg gggaaagggg atcaaattgg cccgtggttg
    87901 gcggatgcac tttctccggg agaccagacg cgccctgagg ccaccatccc gtgacaggaa
    87961 gatctcccca tggaaaacac gcaggtatcc acggggacgt agatggcagc ctagacccat
    88021 cgcgcatggg aggggctagt tgccccgtat cccccggcgt ctgtgcgacg ccggagaccc
    88081 ctgacacagt accggcaagc cgtgtttcgt gctgcggctt gggcggcgcc gtgcccggta
    88141 ggcctgcacc agatgagtga gggtctgaag ggccggtcag cgttgatgga gcaggcggat
    88201 ctccgggaac ccgccacgta aaggacgagg cctgcgtaac ttgtcgcgtc ccagaggacc
    88261 ccatacctga ggtagatgcg ccctcattca ctggtatcca cacggagcag gcagccttct
    88321 gttcagtcgt tatatcgcca acattgtaat agcggttcga tttccgaggg cgacccctca
    88381 gccccgatgg cgccttaggg ggagcaggtg ctgcagcccc tgcctcctcg tagctttgtt
    88441 ctctaagtaa aaggcacgag agttaacgtg gttagggtac ctaaagtatt tcccgccgac
    88501 accaacgcat caaacctcac acccccttcc ccgagttaca tacctagtgt cactgcgtcg
    88561 cgtagccgtg gtttgcattg ggggggacaa cagacactga ataaatcgct gcagtttttc
    88621 aggaccatac gcggccccat agcaatacgt acagttttta aacggcgttc gcaccaactg
    88681 ccatactacg tagctaccac caaatgtgtc gctgtaccgt aaatcgttcc gcacgacggc
    88741 cctcctggtt ccacgcaaca gtctcccaaa acgtccatac accgtctgtc ccacgacagg
    88801 cgatggtccg tagactctat cacactcctc atcaaatgca tggtacaccg aataccagcc
    88861 aggcgggata tcgctgccgg caggcagggg cgcgggggct gcaaaaagaa ggttgttcct
    88921 atcaaaccag gaaaaatagg gaaacttatt gttttcaagg gcatcaataa tccataacgt
    88981 ggcccattct gagccaccgg ctttaggcat ggtccgacac agaaaccgat cggcgttcgt
    89041 ctttgaggca cagtcccgac tgagccttat agtgcccccc ttcttgctat gaaaaaaacc
    89101 cacgaccgtt acgcaaattt gaggagctac tcacctaaaa gtagctcctt tgacaaatgt
    89161 cctggtttta taccaattgt tcacaatgac atattgtgct ggcggaaaca ggtgtcccga
    89221 tgtatcctcg gcaagtaagc accattacca tgtgccatca tattgtgtgg cacaaaaaaa
    89281 gcaacttttc acgcacgcag cataagaccc gagccagtcg cgccctccat cgcgcctgcg
    89341 aattttccca ccacccaata ttgtggcaga tctttcttat gtatatgtgg ttacaaacac
    89401 cacgcccctt aagctgtcct ctctcccaag gggactagat tataacagtg acatacgaaa
    89461 ccgagacgct ctcaaatgct ttctatttta tttatcgatt ccgggttaac ataagcacag
    89521 gtagctataa aatccccatc ctcttgacct ggtaaccctg gcttgaggtt tcctctgtta
    89581 tcaaacaaac ctgaccacaa ctgtacagag aaaagtgggt gaaatgtagt gtttatttta
    89641 tcctcacact ttcacttaac cacagcccgt caaaccacag ggaccctgtt ggctgactat
    89701 tagtcatcac atgtaactga acgcaatctg agcttgatga cgagggggac catatcgaac
    89761 tgttctgccg acgttgggtc acctccgatg aacacagttg tttttttaat gtgctcatgt
    89821 ccctgtatgc gatattgtgc cacattaaaa acatccagaa cagccctaga tgacagtccg
    89881 cagatcacac caaacttctt tggaggatta tttccatgat ataatacggt agacttgcac
    89941 aaattcttaa cataaatgcc agatcggaga gaaactatca caagacccga agcaaacgag
    90001 cgcagcacgg ccgccagcag gttaacgtct cctggccctg tgttattgtc gtcaggtttg
    90061 ggcaacaaaa ctcttaaccc tttgcgcgaa tgcaagcaag agtggctaat gtctgccagt
    90121 gggttctggg aacatagaat aaacaccttt cgttccactt ccaaagacat tgcagggcgg
    90181 ccaaaataaa acacttccac accaagccta tcggttatca ttactggcgg ccgtgccact
    90241 ctataatatg cggatctaag cttcctgtgg cgaatgcgcc tcgtggtagg cctctcgtgt
    90301 ctccgtggcc catcatccca taaaaattcg ccaacaactg gccggcgtct ggacgccggc
    90361 ggcagtccag caccatcatc gacttcttcg tcacttatct ccaacacata ttcccctgct
    90421 acattctggg cctcgagtgc cccagctaag tacacatcct ctacacccgc cccgacagcc
    90481 gaggcggcga ttgagccctc tgttaccacg ccgcttgcat ccgtgtcgcc tccgggctgt
    90541 gatgttgcga taacatcctc tgggatgcca agcagatcaa agaggtcttc atcgcacatc
    90601 gccctcatta gcatgtccat ctcctgtccc acgtggtaca tcaatgcaca tgcagattct
    90661 ttatcaagca gtgtgaggtc atcttcaacg ttgtctgtgt gcaccgttgt ttcatcggcc
    90721 ggggggggct gcgagtcgct atgacgcgtc gagggtcctt cgtctccaga gccaggagag
    90781 tcggcattgg catcatcaac tggctgaacc ccagacgcac tatggcgcgt cgatggtccc
    90841 tcgtctccag agtcctcaga ttccgcgccc gtctgcgtga ccggcacatc gcaaaaggct
    90901 gggtgatcct cctcactgga atccgagttt tcacccacaa atggcctaca ggaaaaaaaa
    90961 aacaaatatg tcaaccggac tagggtggcc aaaccatttg ccccacccct ccccactctt
    91021 tccccagggg acacatctta ccttggtctt ctccgatgct tctcgagccg tacactgtgt
    91081 tgatacaaaa tttcccatag tgatgaccca ctgtgtaggt gagtcctggc atgaacgcac
    91141 caccagcatt cctttacctc ggcacacagg aggcgccacc ttctacaatt aattccctgt
    91201 acgacctcgt actcttcacc tggcaagcgt ctaaggcgcc gcgacgtggt acatattttc
    91261 ccaaaagccg taatcggcga gcccagtaaa tctctgggat gcaggccctt cgataggcat
    91321 tccctcttaa aatcaatgaa aaactgtagg ctatccagag gaattacgtc attacgggca
    91381 gccggagcaa gaaatgttcc agtagatcta tctagccact tgaccaaagg atatttatca
    91441 gagtccaaag cacctacaat aaactcagaa atccaggtaa gcctgcgtcc cgccatgttg
    91501 acctgtcaga atggtctgcc tccgagcatt accccacctc aacagaagta atctactacg
    91561 caaaccacaa catgcttcct gcagctttaa ccttcagtca cgggtcaaaa agcattgcct
    91621 gtattagaca catgtgtttc tcactatgaa tcgtgttctc cagcgctggc aagaacatct
    91681 ggggtgatgc tgccccggac cagctttgaa acagggtatt gcatgcataa tgaagcccac
    91741 atgtttgtct tactttacta acctcattac cttgcattgc aggggacacc cccttgcctt
    91801 ggcagctgag tgaatcccaa ccgcctagga aaaaaataac cactcagact ttattttgca
    91861 gccacacggt ggcgctaacc tttaatgatg tcccactcag tgagtttggc cactcccaag
    91921 cccacatggg cctactataa caggaaacat agaagttgcg gatagagcct ggtttctaac
    91981 ggcaatgata tttatagtgc aaaacggagg gcggtaagac aaagggaggt acccggacag
    92041 agtgacaaga agacttgtca aaattttagt ctctgtggta aaatggggca aggtaaatgt
    92101 gcaaaatgac tggatagtga tcccagtcat attcaggcga cggccggcgg cccagaaaca
    92161 gggacgcgta ccgggaccct tcaggttctc gattatgtcg ctccacgtca aaagcttgtt
    92221 ggatctcgtg gcggtgggac aggggcctac atttgcctat tcttcttcgc gatgcatttc
    92281 caacaaagta tgctgggtat tccaataatc ccttcagaaa aatgcccatg tttgtaccga
    92341 tggccacaac tcccatggaa aacctgtcca gcgtctgttc caaagttcgg tttgcgtcca
    92401 cactacagtg ggccgttctg ggaagtaagc atttatacgg gggtaccgtc tgacatatgt
    92461 gttcagggga ggcctctggg acttgggagc aaataacgat gccccccgtt aaatcaaagt
    92521 gggtcttcac cttttctccg aaataataca cttccaccac taggggcaca agcttgtcac
    92581 ccactttgta aatagcctgt ttcttactca ggtatgctgc cacggattgg gtggcggtta
    92641 agaccttggg cctcatgtcg cttccatacc agtaaaatgt ctggtcagct ttctcttggt
    92701 cctcgacgtc ccggtcatca cgacacaacg gtggaataca atcaataaaa tcatccacat
    92761 tgtcggaagc ttggaaagat gaacccatga cagaggcccc aggtgccgaa ctctcaaggg
    92821 gatgcgtggc gggaagtact gagacactct ccgtggaccc ctcctcacct ccctccgact
    92881 gcatcgggcc ctgagggctc gcagtttcac acagaagttc actcaggtcg cctaagtcag
    92941 gaagctcctg gcctgaaccc atgacagagg ccccaggtgc cgaactctca aggggatgcg
    93001 tggcgggaag tactgagaca ctctccgtgg acccctcctc acctccctcc gactgcatcg
    93061 ggccctgagg gctcgcagtt tcacacagaa gttcacccag gtcgcctaag tcaggaagct
    93121 cctggccaac atctgacaag agatctaaca aacacccctc aatgtgatcc accatcggta
    93181 ggcaatcatc cagcccactg acatgactgg ggacggggcc ttctggggaa aatggggttt
    93241 gcgactgtcc agcaggcggc gctaataagc cttgtgtctc atgtggaaaa ataacaggag
    93301 aaggtaaacc ccccgttggc aaacatagat ccgtcggggt gtgcacgtgt aatgggccct
    93361 gcacctggct cgtggaggga cgcggggaat ccggagctaa taagctcgat gactgaccag
    93421 atgacccaaa ccccgacggt tctggctctt caaaaaacaa actgtgcata tccctcccta
    93481 caaaaccctg agcccccacc caaagttcgt tttcgctgtc actcgattcc gtatcttcgc
    93541 tctgtgaccg tgatgaaact tcagctgcgg aggatgttgt gggcgtggcg actgccgccg
    93601 cctgtttcct ggcggcctcc ctaaacaaaa gttaattaca caaaggtaag tctgagtgac
    93661 atctccaatt tcccgtgatg cccgctgcac gtacatcccg ccgcccacac aacccaccgc
    93721 ccagtacatc aaccatccta cctctgggct ttttttctaa ggctccttct aagtgccttt
    93781 tctctgtgtt tgtcatcatg gggatagatc ccaaacaatg cttttagcat gtttttcatg
    93841 gctggttcct gcgtcaagta cacaagacat ccttcacatc ccttgtatgg cctaggtgtc
    93901 ataatccagc ggttgagttt catttttccc ttatagatgg taaagggcct ctcctgtctg
    93961 gctcgattgg cggtccttaa tagccgtcca aagcagccca ggccagtctc agtctccggg
    94021 atttctggca gcccgtgcct acgtcgctcc tccaaaaatg cctcatagaa gtcatcgaag
    94081 ccttctggca ttctctcccg ccggtttcga cccggcacgg tgaatattct cttttgttca
    94141 tccaaccacc ctacccccca gaagcgtcca ctgtctaaag catctataat aaagtccgtg
    94201 agccattccg actccgtgta gcgaggcatc tttttaggca aaagccacga cacaaaacac
    94261 cttttccgtg ggcgactttc tcgccacaac tagctggacc ccaaccccac tggcacgtag
    94321 actctgtgcc atctaacaac aaaactcaat atatgcagct caacaccgcc cccccccccc
    94381 agccggttgt cgggctgcgg aaacttgtgg ttagaactca ctacggaaaa gggaaccaat
    94441 gcagttgaac tactggcaca cacccataac ccgggacagc acccaggcac tgtccaccct
    94501 ctaatacaag cggcctttgg acgcgaggga ggggtgtcat ggtcaacaaa ccaagaaaaa
    94561 cacatgtatt attcaattag ccaacaactt tatttattac cgacaggaga catgagatac
    94621 ataaatttcc aaccgtgcat agggccaata ccatctgtgg agcgttaagt gccctgtgga
    94681 gttttcgcct aattagctga atctcgaccc ccattgcggc cagcatgctc acgaggaata
    94741 ggcagcagag gcaggaccta actaggagca tatccggacc tgatccaagt atgtgcacca
    94801 aggtgagcaa cactgccgcc aaaggcagga gaacaaatag cgctcgtcgg gaggcgacgg
    94861 atacgcccac gcatgacagt aacccaacat aaaatagcgt catatactta tccaggccaa
    94921 tcaggaccgg agtcagcagg ccgatcgagg ccgtcgatat cagggtggcc agcagtaagg
    94981 tcacaaacac gacaacctcg cgcctacagt aggcccaggc ctggaacact gaataggtga
    95041 tgtacttccc gggcatgatg aatatggccc tcctcctttg cattccggcc ctgatgtaca
    95101 catgctgttc caggtgccta aatgccaaaa gtcccccgac caagaagaca atgaagggca
    95161 gccagaaaac gccggacaca aagaccttct taaacaacag aaggtagtac accataaatg
    95221 ctccgcagaa gcccagctca tagtacctgt gtactattgg cggcgcctga tacaccgccg
    95281 ttgcggtggc tagcggataa ggtaacagca gtaaacagtt aagtacgcac agacccggta
    95341 tgaagggcac acgagaaaat gtaaacccag aaaaggccgc gcaaactaca gcagcaaaca
    95401 ctgctgacgc gcagatccat tccagcctcc ggtccagctg tttttgcgcc gcagggcaca
    95461 gacacatgca tatcagggcc aagtgcgtga ctggcagcga ccagaaaaac acggccgtga
    95521 tctctgtggt aaagagtgtg aacgagtaca gggccttgaa gataaaacac cacagaaagg
    95581 gggtcgccgc caacgtcccg ctcagataac tgaagagcga cagagcgcgc tcactgtcca
    95641 ggcggcacat ggtgtcaaat cagggggtta aatgtggttt tgggcacctt cccacgatcc
    95701 ctggactggc tcgagtctga gcgcctcttg tgaggcctct ttgtgctgtc cttagttggc
    95761 gccgctgggg ggcagctggt gacagaggca gcgtcctcag aggcgtcctc cagcggccca
    95821 aagggaccaa ctggtgtgag agggggagaa tccggagact ccaattccgg ctgcctcctg
    95881 gagtccggta tagaatcggg aaccttttgc gaagactcgc ctccctcggc agacacagat
    95941 cggtttacct ctaaaagtag gacacttaac tttacgtcac ctgattggca gccagtgggc
    96001 acaccttcca cttctaatat ttcgttggag tgccaaatca gcccgggggt aaaccaaccc
    96061 gggactttac acagtctcag ggcggcgatt aaggactcca ggctaacccg gctcagggcg
    96121 tcggtgtgca ccacgcccac atccaccgac ttcttcccct tcagaccatc ccagccagaa
    96181 acgggtttgg tttctggctt gaaatcaatg atcttgctca cgccaccaag agaaaatgtc
    96241 acgatcgaca gcgtctcgct gacagacaca gtcaccgttt ggtcctcttt tgttttttgc
    96301 tgccttagcc acttaagtag gaatgcaccc gttttgccac agaggagaag cctggtggtc
    96361 ctaccaccgg cttccatccg atcgtggaaa ggtaggatac ccttttggtc caccacgctt
    96421 ttgtgcacgg tggaggtgag gttgtccccg taggaaatgg tggtcctgac gaactgcggt
    96481 tgggcccccg tatcgcatgc ctcccccttt cgataaaagg ctatgccagc gtcgagtaca
    96541 ttcgcaccga atagctcacg cgtgtgcgtg aagccgctac cgacggacgt attcctgaag
    96601 ctgaagctaa cgtctccact gccttccgtg tgtcccacca ggggcgtaag ggcattcttt
    96661 attcttaacc ccagaacgcc agctgtcccc acgctggaca gcacactgag ggttggcgtg
    96721 caagccgatc cgtgcacttg cactactccg gttttagtgg cactcttaat gtgttcattg
    96781 accctcctga ttttagacag gagggtcacg tccaccctga ccccatagtg aaaatccaca
    96841 ggcatgattg cggccgtaga cgcacagaga aatcacagga aagctgcgcg cacactgggt
    96901 gttctggaga cgatagactg ccttaaatag aacttttagg ggaggtggaa gtgtgcgaca
    96961 tggacaggtt aaccttcaca aatcgtcagt cacacacgtg gtgtaatcag aattgtctcg
    97021 ctcaaaaaaa ttcacagcct tgaaactgcc ggtgtatgag agggggcacg cttctggcgg
    97081 aggcgtgcca aatatgggag gaacgaaaat atcacgcaga atcctgtcag cggtggcttc
    97141 caggaacctc cggatgtcca ccacgttaac aagcgtcacc ccggccgcct tggcctggat
    97201 aaaccgaatc tcaatattca ctgcctccct gaacagcgcc tggacctctg cgtgactggg
    97261 tttttcctgt atctccacca tagtgttgta caacatactg gcggccttgg tgtgcagcag
    97321 ctcgtccctg gaaatgtaat cgttggcaag gcacaccccg ggcatgatgc ctcgcaccct
    97381 gcacaaactg atagagtaga aggagctaat aaagtatatc ccctccacaa tcaaaaacat
    97441 cagaatcttc tgagctttgg tggtcgcctt acgcaccctg gagtgaagcc actccagctt
    97501 ctcgcaaagg gcggggtcca aaatgatctt ggcagcatat gctagaagtt cgcctcgact
    97561 gttgttgaaa aatatcttca agatattggc atacacgaca ccgtggatat tctccatggc
    97621 aacctgttcg gcataatagt gggccacgtc gtggctgtta aaatttgtga caaggtcctc
    97681 aatgttaaag ttaactaggc gttcggccat tcccaaaaac gtaaacaaaa atctataaaa
    97741 gtccttgtcg gcatcgctga gctggtgcac gtgggaaaca tcaaggtgca ggggtatctg
    97801 gctaggaaac catcggttct gccaagtctc gcgcgttagc gccaaaaatc cgtcgtgatc
    97861 gcttgtatac agaaatcgat caactgaatc cattggcctc acccggcttg cagagaccta
    97921 cctactgaca gaccaggcac tcggggtctg ccgcgcagga ctcctcctcc gggtttttag
    97981 gtccgggtaa ccacgcccca tcttgtttca tcccagagtg aggcggtgac cctggatctg
    98041 ccaggcactg aagagccgtc agactagatt gcttctgaac cctacagtag tacatgaggg
    98101 tttttagacc aagcctgtat ccatgtagca gcaggtccct aagatagctc gcattcctga
    98161 ctctgtcctc cttgaggaag aagctcatgg actggctctg gtctacaaac ggcgccctgg
    98221 cacgagccct atccagtagc ttaaatggac agtaatcaaa ggctgttagg aataccctat
    98281 atctttccct gtgatgcttg gggaacgtgg aaacgtcccc accatactgt ctaaccaccc
    98341 gaaggtcgtc ggggagaacc ttcttaaaaa aagtcacatt gggcctcaac acctcttctt
    98401 tattggtgac cttggaagat atattagcaa aaaaggggta cacggactcg gcatagccag
    98461 ttacttgcga ggtcccagcc gtcggcatca ccgccagaaa ctgagaattg aatatgccat
    98521 gctcggcaat gctctttccc aacgcgtccc agcgatggcg tggtacaaac gaagcatcct
    98581 ccccctccca tgtttgccaa tgaaacctgc ccttggcgaa gttactgacc tcccagccat
    98641 gaaatgggac accctggccc tccaaaacaa ggttgtgact agtctccacc gcggtgtagt
    98701 acatagactg gaatatattc ttgtctaact cagcgctctc agcatcgagg tacccgtacc
    98761 ccaattccgc aaacacatcc gccaacccct gaacaccaat ccccatagac ctctcctttt
    98821 gacctcgctc gacccccggt gttggatggg aaccacccag aatgcaggcg ttgatgacga
    98881 ggactgccac ccttactgcg tcgcccaagg cctcaaaaca aaaaaacggc ctgttggcgt
    98941 ccgtggtgcc aaccctcgcg ctttcaacag ttctcagaca ctttggaagg cagatatttg
    99001 ccaggttgca caccgaagtg tttcttcctg gcagttggac tatctctgca cacaagtttg
    99061 agcagttaat ggccatgccc tgagtgtcgg tccagtggtg ttcattgagc gcttctttta
    99121 aaagcacgta cggtgagcct gtctttatga tggtgtggat aagagtgaac atcatagact
    99181 tcaacggcat gcaactaacg tactttccag cccgcaccag gcgctcgtat tcgttatcga
    99241 acgcagcacc gtatagctta atcaaattgg gggcggtggc tggatcgaac aaataccata
    99301 acttggatgg gtccttttca tacatcctga aaaacaatgt tgggatgcac acgccctgaa
    99361 agagactgtg acatctgtcg ggattctccg gtagtttggc gttcaaaaaa tcacagattt
    99421 gactgtgcca gagttccatg tatgcgctcg cgccaacggg cctgatgtta ttgtcattga
    99481 aataatgaac ctgggcatcc accagtttga ggcaactggc tatgttcttt tggtgggaga
    99541 atgacgtaac atccagaccc acgcctgact tactggccag caacggactc atatcgtggt
    99601 acagggcgtc caaagtaccc ggctcattca tcatggaggg ctgcagaata aaacagctgg
    99661 cgagttgtcc gccttcgact ccagctgagc gcagtattgg cgtggcgcag cacacgtgct
    99721 gcgcagcgag gtagccaaaa acgtactcca ctatagccat ctcagataca gacttagcgt
    99781 cctcaataag gtcccgcgcc aaccaataca ggcattcatg ctctaagcac tgacaggcaa
    99841 caaacacgga aaccctcata aacatttgcg ccacgctttc atagacaggc tctgtcccca
    99901 tggtccttag gacgtaagta tcatacaacc tcacggccga taggtagcca cagttaagtg
    99961 tgtcctcgta agctttggac cgtctgtagg cgcacaacat atcttccaag gcatcaatgt
   100021 tcttttgaat aaacgattcc acccgatgtc ccaacacgcc tcgaaaaatc ccaagatact
   100081 gcttgagagt cgctgggcac ctagcctcca taatttggtg ccacagccgc cccgccatgg
   100141 cattggcccg cacgtcccac ccgaccctaa cctttagaaa gtctatgaga gattgggcac
   100201 acatatcaaa atccgacaat tgtcccgcag acacctgaga cccgcgtcgc tctggtggga
   100261 cagctcccaa gtgaacctga caaaatgtcc ggacagacat gaccttacag aaacacagtc
   100321 caggggccac acgcggcctc aaagttcgca aacaccagta caggcaagga cgtgcccttc
   100381 acgttcagac tttggtgcac cggatgagaa tcaaagggaa ctgtgcccag cgtacaaacc
   100441 gccccaaaaa caagccgatt tatatacagc tcgtgcctca gctgaatata cttggtccgg
   100501 attacatccg taaagtgatc ctttatcatg gccacaacct ccgcaaagcc cttcccagac
   100561 tggaaaaacg tcagcgccat agatggtctc tggttcacac ggagataaac caacgaggca
   100621 taaatagtaa cgtttaggcc tgccggttcc cggcgctgga ccatgggaca tgactcatcc
   100681 aaatcaacta gcatatcaca agggagggtc aagcctacgt gtgcacgggg ctcgtcccgg
   100741 gccaacccaa ctcccttcat ggcggaggtg accttggtca cgaaggtact gtggacactc
   100801 tggaccattg gacctactgg ggtaaggagg gtatgaaact ccccagtgtc catgagttca
   100861 ctcaagttag ggatgaaatc cgccaggccg gatccacttc cgtaccacac accggccact
   100921 ttgtgagtct gtggcgcttt tgccgcttcc attccagaga gcataaacag ggacgtgggt
   100981 gttagcagca tatccataga cgagccgttg tcctcctgct tgaatgaaaa taaaaaggtt
   101041 cccagaggct cctggggact aaaggtctgt gaatacacga ggaaatctcc ataggtcggc
   101101 tgcctaaacg gcgcctgccg caaggcctca tgcagcgagc caaccgtggg tcgtgtggac
   101161 gccgcatatt tagagagtaa atcccgcacc cccctggcaa actccggtcc tctagtgagg
   101221 gatacccggt gagttggtgg aggtaaaaga cccaacactt gcctacccag gcgagccgca
   101281 ttttcagcct gcaccttcat atccacgccg gcaatggacg gcacagacgc tcttgaaaag
   101341 cttaccaaag gcctgagtgg gggaggcggg agccttcacc agacaaagct gttgatggaa
   101401 tttcaactcc gaggactgcc ggtgcctgcc ctcttaaaca gcagcacaac agagcagttt
   101461 ttaaatactg ttgcccaact gccgacggac ctatcaaaat ttatacgcga ctatcgcgtg
   101521 ttcgcactgg ttcgcgcggc gtatttttta gaaccccctt ctagcatcga cccccttgag
   101581 gcagcgcgcg ctcttggacg cctggttgat atattatcat cacaaccacc gcagaacacc
   101641 gcaccggcgc agccacccac ctccgacgac accctgaata actgtacatt gctcaaacta
   101701 ctagcccact acgcggatca gatagcaggt ttcaaaaccc ccgctctccc tcccgtgcca
   101761 cctggaatca tcggcctgtt cacatgcgtg gaacagatgt accacgcatg ttttcagaaa
   101821 tactgggcag ctgcactacc cccaatgtgg atactgacat acgaccctcc cacttctccg
   101881 ttacaggact ggcttatagt cgcctatggt aacaaggaag gactgctact cccctctggc
   101941 ataccctcgg aggaggtgtt agccaaaaca ttagtaacag aacaccacga gttgttcgta
   102001 tcgcggtcga attcgaccga gaccgccgtc accatgcccg tatccaaaga acgcgccctc
   102061 gccatctacc gggtgttcgc caagggtgag gtggtggcgg aaaatactcc cattcttgcc
   102121 ttcaccgacg tggaactatc cacactcaaa ccccactatc tgttcatcta tgattttatc
   102181 atagaggcat tatgcaagag ctacacatac tcatgcaccc aggcccgcct ggaatccttt
   102241 ttgagccgag gtatagactt catgactgac ctaggtcagt acctagatac cgctactagc
   102301 ggcaagcagc agctgacgca cagccaaata aaggaaatca aatacaggct gctaagctgc
   102361 ggtctctcgg cttccgcgtg tgatgttttc agaactgtga tcatgaccct cccatatcga
   102421 ccgaccccca acctcgctaa cctgtccacg tttatgggga tggttcacca actgaccatg
   102481 ttcggacact atttctaccg gtgcctgggc agctacagtc ccaccggctt ggccttcaca
   102541 gaattgcaaa agatactgac acgcgccagc gcggagcaaa cggaacgtaa cccgtggaga
   102601 catccgggta tctcggacat tccactgcgt tggaaaatat cgcgtgctct agcattcttc
   102661 gtccctccgg cccccataaa cactttgcag cgcgtgtacg ccgcgctgcc ctcgcaactc
   102721 atgcgggcca tcttcgagat ctcggtcaag accacatggg gaggcgccgt accggcaaac
   102781 ctggcgcgcg acattgacac aggaccgaac acacaacata tctcctccac accaccgccc
   102841 accctcaagg atgttgagac atactgtcaa ggtctgcggg tgggagacac ggagtacgat
   102901 gaggacattg tgagaagccc gctctttgca gacgcgttta ccaagagtca cttgttgcct
   102961 atactgcgcg aggttctgga aaaccgcctg cagaaaaaca gagctctgtt tcagataaga
   103021 tggctgataa tatttgctgc cgaggcggca accgggctca tccctgccag gcgcccgcta
   103081 gccagagcct acttccacat catggacatt ctggaggaga gacattccca agacgcccta
   103141 tacaaccttt tggactgtat ccaggagctc ttcacccaca tcaggcaggc tgttccagac
   103201 gcacagtgtc cgcacgcctt tctacagtcc ctgttcgtct ttcaattccg ccctttcgta
   103261 ctcaaacacc agcagggtgt aaccttgttt ctagatggct tgcagacatc cctccccccg
   103321 gtgataagtc tggccaacct tggagacaag ctgtgtcgtc tcgagttcga gtacgacagc
   103381 gagggcgact tcgtgcgcgt gccagttgca ccgccagaac aaccaccgca cgtacatctg
   103441 tcgcatttca agaagacaat acagaccatc gaacaggcca ccagggaggc caccgtagcc
   103501 atgacaacaa tcgcaaagcc aatatacccc gcctacatcc ggttactgca gcggctagaa
   103561 tatcttaaca gactcaacca ccacattctc aggattccct tcccacagga cgccctttct
   103621 gaactccagg aaacctacct ggcggcgttt gcacggttga caaaattggc agcggacgca
   103681 gcaaacactt gtagctactc cctcaccaag tactttggag ttttattcca acaccagctg
   103741 gtccccacgg ccatcgttaa aaaactgcta catttcgacg aggctaaaga taccacagaa
   103801 gcctttttac agagcctggc acaacccgta gtgcagggac aacggcaggg ggcggctggc
   103861 gggtcgggtg tcctgacgca gaaagaactt gagctcttga acaaaataaa cccacagttt
   103921 acagacgctc aggctaacat tcctccatct attaaacgtt catattcaaa taaatatgac
   103981 gtccctgagg tctcagtcga ctgggaaacg tactcccggt ctgccttcga ggcaccggac
   104041 gacgaactcc gttttgtccc actgacgctg gcaggcctcc ggaaactgtt tgtcgaatag
   104101 aggccatggc agcccagcct ctgtacatgg agggaatggc ctccacccac caagctaact
   104161 gtatattcgg agaacatgct ggatcccagt gcctcagcaa ctgcgtcatg tacctggcgt
   104221 ccagctatta taacagcgaa acccccctcg tcgacagagc cagcctggac gatgtacttg
   104281 aacagggcat gaggctggac ctcctcctac gaaaatctgg catgctggga tttagacaat
   104341 atgcccaact tcatcacatc cccggattcc tccgcacaga cgactgggcc accaagatct
   104401 tccagtctcc agagttttat gggctcatcg gacaggacgc ggccatccgc gagccattca
   104461 tcgagtcctt gaggtcggtt ttgagtcgaa actacgcggg cacggtacag tacctgatca
   104521 ttatctgcca gtccaaagcc ggagcaatcg tcgtcaagga caaaacgtat tacatgtttg
   104581 acccccactg cataccaaac atccccaaca gtcctgcaca cgtcataaag actaacgacg
   104641 ttggcgtttt attaccgtac atagccacac atgacactga atacaccggg tgcttccttt
   104701 actttatccc acatgactac atcagcccag agcactacat cgcaaaccac taccgcacca
   104761 ttgtgttcga agaactccac gggcccagaa tggatatctc ccgcggggtg gaatcatgct
   104821 ccatcaccga aatcacgtcc ccttctgtat cccccgcgcc tagtgaggca ccattgcgca
   104881 gggactccac ccaatcacaa gacgaaacgc gcccgcgcag acctcgcgtc gtcattcctc
   104941 cttacgatcc gacagaccgc ccacgaccgc ctcaccaaga ccgcccgcca gagcaggcag
   105001 cgggatacgg tggaaacaaa ggacgcggcg gtaacaaagg acgcggcgga aagacgggac
   105061 gtggcggaaa tgaaggacgc ggtggccacc agccaccaga cgagcaccag cccccacaca
   105121 tcaccgcgga acacatggac cagtccgacg gacaaggcgc cgatggagac atggatagta
   105181 cacccgcaaa tggtgagaca tccgttacgg aaaccccggg ccccgaaccc aatcccccag
   105241 cacggcctga cagagagcca ccgcccactc ccccggcgac cccaggcgcc acagcgctgc
   105301 tctctgacct aactgccaca agagggcaga aacgcaaatt ttcctcgctt aaagaatctt
   105361 atcccatcga cagcccaccc tctgacgacg atgatgtgtc ccagccctcc caacaaacgg
   105421 ctccggatac tgaagatatt tggattgacg acccactcac acccttgtac ccactaacgg
   105481 atacaccatc tttcgacata acggcggacg tcacacccga caacacccac cccgagaaag
   105541 cagcggacgg ggactttacc aacaagacca caagcacgga tgcggacagg tatgccagcg
   105601 ccagtcagga atcgctgggc accctggtct cgccatacga ttttacaaac ttggatacac
   105661 tgctggcaga gctgggccgg ttgggaacgg cacagcctat ccctgtaatc gtggacagac
   105721 tgacatcgcg accttttcga gaagccagcg ctctacaggc tatggatagg atactaacac
   105781 acgtggtcct agaatacggt ctggtttcgg gttacagcac agctgcccca tccaaatgca
   105841 cccacgtcct ccagtttttc attttgtggg gcgaaaaact cggcatacca acggaggacg
   105901 caaagacgct cctggaaagc gcactggaga tccccgcaat gtgcgagatc gtccaacagg
   105961 gccggttgaa ggagcccacg ttctcccgcc acattataag caagctaaac ccctgcttgg
   106021 aatccctaca cgccactagt cgtcaggact tcaagtccct gatacaggca ttcaacgccg
   106081 aagggattag gatcgcctcg cgtgagaggg agacgtccat ggccgaactg atagaaacga
   106141 taaccgcccg ccttaaacca aattttaaca ttgtctgtgc ccgccaggac gcacaaacca
   106201 ttcaagacgg cgtcggtctc ctcagggccg aggttaacaa gagaaacgca cagatagccc
   106261 aggaggctgc gtattttgag aatataatca cggccctctc cacattccaa ccacctcccc
   106321 aatcgcaaca gacgttcgaa gtgctgccgg acctcaaact gcgcacgctc gtggagcacc
   106381 tgaccctggt tgaggcgcag gtgacaacgc aaacggtgga aagtctacag gcatacctac
   106441 agagcgctgc cactgctgag catcacctta ccaacgtgcc caacgtccac agtatactgt
   106501 ctaacatatc caacactcta aaagttatag attatgtaat tccaaaattt ataataaaca
   106561 ccgatacact ggccccatat aaacagcagt tttcatatct ggggggtgaa ctggcatcta
   106621 tgttctccct tgactggcct cacgcacctg cagaggcggt agagccacta cccgtgctga
   106681 cttctctgcg aggtaaaatc gcagaggcgc tgacgcgtca agaaaacaaa aacgctgtag
   106741 atcaaattct aaccgacgcc gaaggcctcc ttaagaacat taccgatcca aacggcgcac
   106801 acttccacgc ccaggccgta tcaattccag tgttagaaaa ctacgtacat aacgcggggg
   106861 tccttctcaa gggcgaaaag agcgagaggt tctcccggct gaagaccgcc atccaaaacc
   106921 tggtatcctc cgaatcattt atcaccgtga ccctacacag tacaaacctt ggaaacctag
   106981 ttaccaacgt accaaaactt ggtgaggcgt tcaccggggg cccgcacctc ctgacaagcc
   107041 cgtccgtgag acagtccctt tccaccctgt gcacaaccct gctgcgagat gccctggacg
   107101 ccctggaaaa aaaggatccg gcccttcttg gtgaggggac cacgttggcg ctggagacac
   107161 tcctaggata cgggtcggtg caggactaca aggagacggt acagataata tccagccttg
   107221 tgggcatcca aaaattagtc agggaccagg gcgcggacaa gtgggccact gccgtgacaa
   107281 ggctaactga cctcaaatca actctggcca cgaccgccat cgagacggct acgaaacgga
   107341 aactatacag attgatccaa agggacctca aagaggctca aaaacacgag accaatcggg
   107401 ccatggagga atggaagcag aaagtactgg ctcttgacaa tgcgtctccg gaacgtgtcg
   107461 ccaccctcct gcaacaggct cccaccgcga aggctagaga gtttgcagag aagcacttca
   107521 aaatactact ccccgtaccc gcggacgccc ccgtccaagc gtctccaacg ccgatggaat
   107581 acagcgccag ccccctcccg gacccaaagg atatagacag agctacatcc atccacgggg
   107641 aacaggcgtg gaagaagata cagcaggcgt tcaaggattt caacttcgcc gtcctgcggc
   107701 ccgctgactg ggatgccctg gcagcggagt accaacgccg tggttcgccc cttccggcgg
   107761 ccgtgggtcc agcgctctca gggttcctgg agacgatcct agggacgctg aacgacatct
   107821 acatggataa gctccgctcc tttctgcccg acgcgcagcc ttttcaggcg ccgcccttcg
   107881 actggctaac gccgtatcag gaccaagtca gctttttctt gcgcaccata gggctgccgc
   107941 tggtgcgagc gctggccgac aagatcagcg tgcaggcact gaggcttagc cacgcgctcc
   108001 agtccggcga tttgcagcag gccacggtgg gcacgcccct ggagctccct gccacagagt
   108061 acgcgcgcat cgcctccaac atgaagtccg tgttcaacga ccacggactt caggtgcgat
   108121 cagaggtcgc ggattatgtg gaggcccaac gagccgacgc acacacgcca cacgtcccac
   108181 gtccaaagat acaggcacca aagactctga ttccacatcc ggacgcaatc gtcgcggacg
   108241 gactacccgc ctttcttaag acgtccctac tgcagcaaga ggccaaactt ctggcgctac
   108301 agcgggcgga cttcgagtcg ctcgagagcg acatgcgcgc cgcagaggcc cagagaaaag
   108361 catcgcgcga ggaaacccag cgcaaaatgg cacacgccat cactcagctc ttacagcagg
   108421 cacccagtgc gatctcgggg cgcccgctat ccttacagga cccggtgggc ttcctcgagg
   108481 gcatcatata cgacaaggtc ctggagcgcg aatcctacga gacgggtctc gagggactgt
   108541 cctggctcga gcagaccatc aagtccatca ccgtatacgc tcccgtagag gagaagcaaa
   108601 gaatgcacgt gctgctggac gaggtgaaaa agcagcgagc aaacactgag accgctctcg
   108661 agctagaggc cgcggctacg cacggcgacg acgctagact cctgcagcga gcggtcgatg
   108721 agctgtcacc gttgcgcgtt aaggggggga aggccgcggt ggaatcctgg cggcagaaaa
   108781 tccaaaccct gaaatccctg gtacaggaag cggagcaggc cggcctcctg ttggccacca
   108841 tagacacggt ggccggccag gcccaggaga ccatatcacc atccacactc cagggactgt
   108901 accaacaggg acaggaggcc atggcggcca ttaagcggtt tagggactcg ccccagctag
   108961 ctggcctgca ggaaaagctg gccgagctac agcagtacgt caagtacaag aagcagtatc
   109021 tggaacactt tgaggccacc caaagcgtag tgtttacagc ctttccgctc acacaggagg
   109081 ttacgatccc agccctgcat tacgcgggac ctttcgacaa cttggagcgg ctctcacgat
   109141 acctacacat cggccagacg cagccggctc cgggacagtg gctcctgaca cttcccacat
   109201 tcgaccccac gcgcccggcc tgcgtcccag ccggcggcca cgaacccccg ttgcacagac
   109261 aggtggtgtt ctccagcttt ttggaggccc agatccgatt agcgttgtcc gtagcgggcc
   109321 ccgtgcctgg acggggtctg cccggaacac cgcagatccg aaggggcgtg gaggctgccg
   109381 cttgtttcct ccaccagtgg gacgagatat ctcgcctcct tccagaggta ctggacacct
   109441 ttttccacaa cgcgcccctt cccgcagagt cttcctccaa tgctttcctg gccatgtgcg
   109501 tattgacgca ccttgtctac ctagctgggc gcgccgtctt gggcccacgg gagccggagc
   109561 acgccgcccc ggacgcgtac ccaagggagg tggcgctggc cccgcgcgac ctgacctacc
   109621 ttctactggc catgtggcca tcttggatct cggcaatttt gaaacagcct tcgcacgcgg
   109681 aggcggcgca cgcatgtctt gtcacgctgc caacaatgct caaggctgtg ccgtacctca
   109741 cgctggaagc ctcagctgga ccactgccgg cggacatgcg ccacttcgcc acgccagaag
   109801 cgcgtctgtt tttccccgcg cgatggcacc acgtcaacgt gcaggagaaa ctgtggctgc
   109861 gtaatgattt tatgtcgctg tgtcaccgtt ccccggggcg cgcgcgcata gccgtcttgg
   109921 tgtgggccgt cacttgccta gatcctgagg taataaggca gctgtggtcc accttgcggc
   109981 cccttactgc ggatgaatcc gacacggctt ctggactgct gcgggtgcta gtagaaatgg
   110041 agtttggtcc gccgcccaag acgccgcggc gggaggcggt ggcgcccggc gcaacactgc
   110101 caccgtaccc ctacggcctt gccaccggcg agcgcctggt cggccaggcg caggaacgct
   110161 ctggcggcgc tggcaagatg ccggtgtccg ggtttgagat agttttaggc gcactgctgt
   110221 tccgcgcccc cctacgcatt ttcagcaccg catcaaccca caggatctca gatttcgagg
   110281 gcggtttcca gatactgact cctctcctgg actgttgccc agatcgcgag ccattcgcct
   110341 ccctggccgc cgcaccacga aggacggtgc cactgggaga cccgtgcgcc aacattcaca
   110401 cccccgaaga gatacagatc tttgcgcgtc aagccgcctg gcttcaatat accttcgcaa
   110461 attaccagat ccccagcacc gacaacccga taccgatcgt tgtgctaaac gctaacaata
   110521 accttgaaaa cagctacatc cctcgcgatc gcaaagcgga cccgctacga ccattctatg
   110581 tagtccctct gaagccgcag ggtagatggc ctgaaataat gaccacagca acaaccccct
   110641 gccgcctacc gacatcgcca gaagaggcgg gatcacagtt cgccagactc cttcagagcc
   110701 aggtgagcgc cacatggtct gacatcttct ccagggttcc cgagcgcctc gctcccaatg
   110761 cgcctcagaa gagttcccag acaatgtcag aaatccacga ggtcgccgcc acgccgccac
   110821 tcacaatcac cccaaataaa ccgaccggaa cccctcacgt ctccccggag gctgatccaa
   110881 taacagaacg caaacgcgga cagcagccga agattgtcgc ggacaacatg cctagtcgta
   110941 ttctcccgtc gctaccgacc ccgaaaccca gagagcctag aatcacgcta ccccacgcac
   111001 tgcccgttat atcaccccca gcacatcgcc cgtcgcctat accgcatctg ccagcaccgc
   111061 aggtaacgga gcccaaaggg gttctccaaa gcaaacgtgg aactctcgtg ctgcggcccg
   111121 ccgcggtcat tgacccacgg aagcccgtct cggcaccgat cacgcgatat gagaggacgg
   111181 cgctccagcc cccccggact gagggcgaag gccggcgccc tcccgacacg caacccgtca
   111241 ctttaacctt tcgtctccca cctaccgcac ccactcccgc aactgcagcc ctagaaacca
   111301 aaacaactcc cccatccacg cccccacacg ccatagacat tagcccacca cagacacctc
   111361 ccatgtccac ctcacctcac gcgagagaca caagcccccc cgcagaaaag cgggccgcac
   111421 ccgtcattcg agtaatggcg cccacgcaac cgtcgggaga ggcaagagtc aagcgagtgg
   111481 agatcgaaca gggcctttcc acacgcaatg aagcccctcc ccttgaacgc tcgaatcacg
   111541 ccgtgcccgc cgttacccca aggcgcaccg tagcccgcga aatcaggatc ccgccggaga
   111601 taaaggcggg ttgggacact gcaccggaca ttcctctgcc ccacagctcc ccggagtcat
   111661 ccccaccgac ttccccccag cctatccgcg tggatgataa atcgcctctt cccaacctcg
   111721 tagagagata cgcgcggggt ttcctggaca cgccctctgt agaggtgatg tccctggaaa
   111781 atcaggacat cgccgtggac cccggactgc taacccgccg gattccatcc gtggtgccca
   111841 tgccccatcc aattatgtgg tcacccatag tacccatcag tttacaaaac acagacatag
   111901 acactgcaaa gataacactg attagtttta ttagacgcat caaacaaaaa gtggccgccc
   111961 tatcggcgtc cctggcggag acggttgaca gaataaagaa gtggtacttg tgactccacg
   112021 gttgtccaat cgttgcctat ttctttttgc cagagggggg tttcctcgcg tcggccaccg
   112081 cgggggcggc cgtttccgtc gtggatgaga gggttgtgag aatgtctgac gccggcgaca
   112141 atgaatgggg accagaggac agggtggtta tactgcttcc cgagaccccc agtgagtcct
   112201 ggcccccggg cgtggtgccg gatgcagggc ctggcctcga aggcacggtg aacgtccccg
   112261 cgtcgtaagc cgacgccgcg gaaactcggt cagcgcgctc gcgcggtttc tgatccctaa
   112321 gggtctgcag atgatcccgc ctttgaattc cacccatcct cctcagatag gcctcataat
   112381 aatgatgggc aattaagaac acgagatagt gtctcttttg cacgaggtat tcggcctgcg
   112441 acatatttcc ctgatccagg gtattcatgc gagccaccag gggatggtga gcgtagtcat
   112501 gatccagtcg ctcctggatc acggggtctc tcaccttaaa gttggacatc ttccacacag
   112561 gcgggcgaaa tagcctcagg aggaacactt cccgcaacag aactccagca gctgtgaggt
   112621 gagctgaagc agtccgcgca cgtcacggtg ctttaatagg gcagcctcgc agtcgggcgt
   112681 cccaaggcaa ggcactacaa aactgacagt ttgatctagg tctcgaatgg caagggccgc
   112741 gttgttagct agaacagccc tgattacgac gcgtgctagg gtcccgcgtc cggtaatatc
   112801 gcacagggga tacaccctca tatgttcgct gccacagtaa gaacagtaga tcctccccgt
   112861 ggtcgcacag atggtgaact gcttctcttt cctgtccctg ctgaaaaaca cgttggtggg
   112921 aggaaaattg acagtatgaa acttgcccct gccaaagtta agacagtgtc cacactccat
   112981 gcacacaacc gcccgagcgc aacgcgcccg cttggcaagg gccgcgcggg ccacgcgaga
   113041 acagatgacg ggtatggaca cgcaggggga gagaacattg tatgccagaa gcctcctgcc
   113101 aaggttccgc acgagaccag gtccctcctg ctcgcaggcg ggcagcacta cgtggcggga
   113161 cttaataagg ctcaaaaaac acagtgaccc aagcatggcg tcgaacgggt taccgcaggg
   113221 aaccgtaggg gcgacgcgct ccaaggcctc ccggaggccg gtatctgccg cccctatccc
   113281 gagcccgtta ccgtcttcgg tcgcagccac accgcgacgg gtgggcgagg gcacctccag
   113341 gaggggacga cgcggcaacg gcccatgcca cttcttcctt agccagggta gcgacggtgg
   113401 gggcttcgaa cagcaggtca ctaacggaaa gcgagagcaa agcgccaaca gcttgcagag
   113461 ttgggcacag gccttggaaa atggaagcga caggtatttt gcccatacgt ggcgcggtat
   113521 cgccctagca tggtcggcgg cctgggcacg ggacagcgtc accacaaccc atacgtgggc
   113581 gccaagcagc tgctgcgccg cacaaatctg cgcctgtttg gcgacggtgt ctgagccagc
   113641 gcgcaacacg gcgatcgcct gcgccagcga cgggcggtcc aacaggtgcc tggcccagga
   113701 gggcatgttt ccctggaaac cccgctcccc gaatatgaca aaagccacat attcctccac
   113761 tggcacgcca ttctcgccct cgaacacgcg gtgggccgtc agctgggcct catccaaacc
   113821 aaaccaagac acaagaaagc gatcccagcg ctgatccagg gccatgacct tctcaccagc
   113881 gcgaccgcac ggcctaagct ccactgaaag gcgcccagaa tccgcacagt cctacccccc
   113941 tggcccgccc aatataccgc tgtgacgtct gatgtacagg cccgcgcgtc gcggccgttg
   114001 gtgggaaaac cggcaccacc ctgtgcggcc gaatccgcca cgggggctgc cagacagtac
   114061 actgtctcca gcagcgactt cagtctcttg tgacttttgg gcgtcaccac caaaaattgc
   114121 aaaacctgcc tgtagtccgt gaagtaggta cggcatatta ccatggagtt gtacacgccc
   114181 aggttctttg agaacaccag gctcgccttg aactttgtaa agtcatcctg ccccagcacg
   114241 acagacgtat ttttggcaag gtatacgtcc gactccacgg gaaggacgtg cccaaactgg
   114301 gacacggcgt cgcttggtcg gcacagaaag cacttcaggg ttgtggaaag gccattattc
   114361 gatataacaa agcagggaga gaacgggtag tgcatctcct ccaggaggtg cgcccaaaac
   114421 ttatacacaa actctaagtg gtacacgcaa ccgtgctgca ttctaaccgt acatatggcg
   114481 gtagcaccgc ccttagcata aactggggcc ccgtcgatgc accgttccaa atccagggac
   114541 tgaccagact gtcccaagta tgaggatacc acccgacaca gttcgtccac tacacgctta
   114601 ccaacgacac tcatggcgac agcggggtgg ggctggcaag gcccccaaag cgcgacaccc
   114661 gcagtcaatc agggccgtgc ccgcgcctcg gagaatacgg cgtccgtgct cacgatcttg
   114721 cgcaggacct gccttaccgt gtccaccttg ctctccaaca ccagagtatg atcgcaggct
   114781 gcaggctgtg cccgctggac gagaaaggtt tttaaatact gacagtagtt gatggcgttc
   114841 aatctacaat agatcgtggg aaataaaatt tgcatgtcac gaggcagaag ctggtcagac
   114901 gcgtactcca tgttgggttc cacggggagg ggaacacacg ccccaagaca cgacggcgca
   114961 catagggagc ggagcaaaca attgattcaa atatttgact ccgcagcgag ccggtttgca
   115021 gagtggtcac ctgccctgct ccacacccac ccccgcgtct cttccaactc tcaactcacg
   115081 atccagggaa accaccgtcc agtggccatg tttgttccct ggcaactcgg tacaattacc
   115141 cgtcaccgag atgagctcca aaaactactg gcagcctccc tgctcccgga gcacccggag
   115201 gagagcctcg gtaaccccat aatgacacag attcaccagt cgctccaacc atcttccccc
   115261 tgcagggtct gtcagctcct attttctctg gtccgcgatt cgtccacccc catgggtttc
   115321 ttcgaggact atgcctgcct ctgcttcttc tgtctatacg ccccacactg ctggacctcg
   115381 accatggcgg cagcggcaga cctgtgcgag atcatgcatc tgcactttcc agaagaggag
   115441 gcgacatacg ggctattcgg accgggtcgc cttatgggta tcgacttgca gctgcacttc
   115501 tttgttcaaa agtgctttaa gaccaccgcc gccgaaaaaa tactgggaat atccaacctg
   115561 caatttttaa aatcagaatt catccggggc atgctcacag gcaccatcac ctgcaacttc
   115621 tgcttcaaaa cgtcctggcc caggacagac aaggaggagg ccaccggccc caccccatgc
   115681 tgccagatta cagacaccac caccgcaccc gcgagcggca taccggaact agcccgggcc
   115741 acattctgcg gcgcaagtcg ccccacaaag cccagcctac ttcccgcgct aatagatatc
   115801 tggtccacga gctcagagct ccttgacgag ccgcgccctc gactgatcgc aagcgacatg
   115861 agtgaactca aatccgtggt cgcatcccac gatccgttct tctctccccc gcttcaggca
   115921 gacacctcac agggtccatg tctgatgcac ccaaccctgg ggctacgata caaaaacggg
   115981 actgcatccg tctgcctcct ctgcgagtgc cttgcggcac acccagaggc acccaaggcg
   116041 ctgcagaccc ttcagtgcga ggtaatgggc catatagaaa acaacgtaaa gctggtagac
   116101 agaattgcct ttgtgttgga caacccattc gccatgccat atgtctcaga tccgctactt
   116161 agagagctga tccggggctg taccccacag gaaattcaca agcacctgtt ctgcgacccg
   116221 ctgtgcgccc tcaatgctaa ggtggtgtca gaggacgtac tattccgcct gcccagggag
   116281 caggagtata aaaagctcag ggcatccgcg gccgccggac agctcctcga tgccaacacc
   116341 ctgttcgact gcgaggtcgt gcagactttg gtctttctct ttaagggtct ccaaaacgcc
   116401 agggtgggga aaaccacctc actagacatt attcgggagc taaccgcaca actaaaaaga
   116461 caccgcctag acctggccca cccctcacag acgtcacact tgtacgcttg agctggtccc
   116521 gggccttcgc accccatcca ccgatgccga aatcagtgtc cagccacatc agcttggcga
   116581 cctcaaccgg tcgcagtgga ccgcgagaca tcagaagatg cttgtcatcc cgcctgcggt
   116641 cggtcccgcc cggggcgcga agcgccagcg tcagcagcaa gcacagaaac ggccttcgca
   116701 agtttatctc agacaaggta ttttttagca tcctatcgca cagacacgag ctaggagtgg
   116761 actttctccg tgagatggag accccgatat gcacctccaa aacagtaatg ctgcccctag
   116821 acctgtctac cgtcgcaccc ggccgctgcg tctccctctc tccgtttgga cactcctcaa
   116881 acatggggtt ccagtgcgct ctgtgcccat ccacagaaaa tcccaccgtt gcccaaggct
   116941 cccggcctca gacaatggtg ggcgatgcgc tcaaaaaaaa taacgagcta tgctcggtag
   117001 cgctggcctt ttatcaccac gcagacaaag tgatccaaca caagacgttt tacctatcac
   117061 tcctcagtca ctccatggat gtggttcggc agagcttcct gcagcctggt ctactgtacg
   117121 ctaacctggt cctaaaaacc tttgggcacg atcccctacc catcttcact accaacaacg
   117181 gcatgctaac aatgtgcatc ctttttaaaa cccgggcact acatctggga gaaactgcgc
   117241 ttaggctgct tatggataac ctccccaact acaagatatc ggcggactgc tgcagacagt
   117301 cctacgtggt caagtttgtc ccaacgcacc cggacaccgc aagcattgca gtgcaggtac
   117361 acaccatatg cgaagcggtt gcggcgctag actgcaccga cgagatgcgg gatgacattc
   117421 aaaagggaac cgcacttgtc aacgccctat aacctcacat gtagcctgtc accccagctc
   117481 ctattgcaac tgaccatgtt caggtggtaa taaagtcatt aaacgacaaa gtgattcttt
   117541 taatctgttt attgtttttg aacatgtggc acacgctgca atgtactgcc atgaaaggtg
   117601 gttctatatc caccacttgg cgtctgccga agtcagtgcc acaatttcat taacaaacaa
   117661 ggtcaataca ttctgaggga gtgttttttg ccatggtacc attcgtgtgg tttgggagag
   117721 cggacgccat ttgcgtgcaa aatgtgcttt gctggaggcc aacttccgtc gcgctggttg
   117781 atgcgcggca cattgtgtca accagggcac cctcccccac cgagtgcttt aatgcggaga
   117841 ggaatggtgg cctggttgac accgcgtgcc ggccttctga actgtgactg tgttatgagc
   117901 cacgggtatg ccctcgatac gcctgctctt cagcattgta tgtgtttaat gttgtgcttg
   117961 gtgcaaccgt gattgtgctt ttgtatttta ttttactgac actctttggg agggcacgct
   118021 agcttcagtg cgcgcccgtt gcaactcgtg tcctgaatgc tacggggcca cgctggccac
   118081 tcggggggac aacactaatc gccaacagac aaacgagtgg tggtatcgcc ccaagcctcc
   118141 agcgccaccc atttagtaac acatccggga catgaactgc cacaaacacc gttaagcctc
   118201 tatccatgca ttgggattgg agtgaggagg gaggagggca ccaggttccc ggggaggagg
   118261 gcaccaggtt cccggggagg agggcaccag gttcccgggg aggagggcac caggttcccg
   118321 gggaggaggg caccaggttc ccggggagga gggcaccagg ttcccgggga ggagggcacc
   118381 aggttcccgg ggaggagggc accaggttcc cggggaggag ggcaccaggt tcccggggag
   118441 gagggcacca ggttcccggg gaggagggca ccaggttccc ggggaggagg ctggggtgcg
   118501 ccgcgccggg ttcccggggt gcgccgcgcc gggttcccgg ggtgcgccgc gccgggttcc
   118561 tggggtgcgc cgcgccgggt tcctggggtg cgccgcgccg ggttcccggg gtgcgccgcg
   118621 ccgggttccc ggggtgcgcc gcgccgggtt cccggggtgc gccgcgccgg gttcctgggg
   118681 tgcgccgcgc cgggttcctg gggtgcgccg cgccgggttc ctggggtgcg ccgcgccggg
   118741 ttcctggggt gcgccgcgcc gggttcctgg ggtgcgccgc gccgggttcc tggggtgcgc
   118801 cgcgccgggt tcctggggtg cgccgcgccg ggttcctggg gtgcggggtg cggggggggg
   118861 gaccgcgccg gggtactgca gggttcgcag ggttcggggg tactacctgg ttcctggggt
   118921 gtgccaggac gggttcctgg ggtgccaccg ctcctcgata cgtgtaaatc caagagatcc
   118981 gtcctccgtg ccgccgcgcg cgtaatgcgc gaggggggtc ggtctcccct cttctttata
   119041 gcgtttcctg cgaagggggc gtaaccgtag gacaaactgc ttatgtaggg gttagccacc
   119101 catttcccgg ggccgcgcca gaggtgagcg tggacctagc atcccgctcc catttaccga
   119161 aaccacccag aggcgagatt ccagggccgt gactcactag ctcccctccc atcgaacaac
   119221 cacgcttggc taacacggct ggagtggcgg tgggcggggc ccctataatc ctggccccca
   119281 tctaccgaaa cgacccagta gaaaaatccc aaccccatga ctcatcaggc cctattatat
   119341 agaatatccc agtagagtga cccagctggt ttccataaat ggatatactt ccggaaaacg
   119401 aaggagggtt gaatacagtt gggggtagtc cgctggtatt cccagctgag gttgccttat
   119461 ttggtaatgc ttccggaaat accacctgag taccccattg gtttatacct tgtttaattg
   119521 tagaattaca gctggattta cccagccggg tttacgcagc tgcgtatacc cagctgtgtt
   119581 tacgcagcgg ggtttacgca gctgggtaga cccagctggg tatacctact ggaatagggg
   119641 ctgcgatgac tcagctgcgc taggattaaa ggattatata tatatatata ggaaaaatca
   119701 aaacaaaact ctaatcgctg attggttccc gctgtgggcc aatcagcttg ggagttctag
   119761 ggataggggc caatgggagg cctccgaatt tgattgacgg ctggggcgtc caatggaatg
   119821 gcgcggtcgc ctagctcgaa cgagattggt cggccgaatg ggccaatggc ggctcggaaa
   119881 actttgattg acgggccggc ggaccaatgg gagaggggca gaggattacg ggggattagc
   119941 aaattcaaga tggcggcgcc cataaaatgg ccaaaaatta taatttttcg agtcgctcac
   120001 ggtcccacct agcggcgtga cctggaggtg accccgtgca cccggcgctc tgaatttttc
   120061 tgcgcatgcg cgactcctca tctacataat ttatgcacat aaaaggatta gcgcatgcaa
   120121 attagtcaga tagcagggcc atccacactt tatgttggcc gcgtgccagg cgccggcgtg
   120181 ggcgccgcgc gcgtgctctc tcagtcgcgc ctagctgctt ccaacagaca aaagcggggc
   120241 gttagtgagg gagtgcgcgc gctgcgctga cttggccgat ttccagtgca tgctttgtca
   120301 ccccagcgct agaatggaat tttcattatt gagcaatttg ggcaccctgg gcacgataac
   120361 catacatgga tacacgggtt ccaaatatgc aaagtagaca ctaaggtacc atttggcata
   120421 tttggacgtc ctgggcaggt tagctaccca ccagaatata tgggactctg ggcaggatag
   120481 ccacccacaa ttgttttgcg cccctctttg gccaggggac caaggtcgta tggttcgcgc
   120541 tacactaagc ccgaacgttc agctttgcgt gctttcgacg tccaggcggc tggcacacgg
   120601 gccgtgagcg ccagcaacat gggatcatgg tagtaagata cagcataaat ccccgtccgg
   120661 tggcgctcaa cgccaatatg cgcggctgcg tggtatctca tcggtgggca cgcgtacggt
   120721 ggtctcatgg gtattggact tgtaggcgag gggaggcgca tacgacaaaa attgccgccg
   120781 tgaaggtcgg gaacccgccc gcgcttccgc aaggcacggg gccgcatcgg acacaggcta
   120841 agcattaagg atcataacac cgccctagaa atgtttaagc tgtgaccaaa gcgaacctcg
   120901 catgaggcat acgcgagcgt ggaggtagga ttcccaaggc tattgagaga cggtgggtga
   120961 aatgatgaag aacacacaga acaataacgg gcgactagat aaaaagactc gctcaacagc
   121021 ccgaaaacca tcagcccgca ccgccgatgg attaggtgct gctggacaag tctttctaaa
   121081 cccgcgcagg gtttgtgtcg atccagacgc ttacgaacgc ccgctttaaa aacactattc
   121141 ataattaaca gaagttgaca ccagcccgca gttacccaac cttctatttt tttggagtgt
   121201 tgacaagttt ccatcgcccg tttggcgttt cccgcatggt gtcaaattag tgacgcaccc
   121261 tccccccgtc actatgggtt taccctgatt tagtaagtaa aactgccgcc cccgcccact
   121321 cattttttta ccctgttatt tgctgtattt acatctacgg accccctttt ggtgagattg
   121381 ccgtggttct aaataacgtt gtggttttcg gaccctttca gggaccaaat cttttacgtg
   121441 ttgccaaggt agcatttgct ggacccgcat aggtttttgt ggcaccaggt tatggtctta
   121501 tgagcgggct tgaccggcaa gttccaggca tcctaagtgc ttgatgtaga cccttagggc
   121561 actagggact acctaggtca aactccccct tagtcatgac gccgtgccca cgaggtttga
   121621 gaggcgtaga catccgtgtc gactgctgga cggaggtagt ataatcagct aggcctcagt
   121681 attctatgta acaaatgaat gccctagagt actgcggttt agctagttat actgcccggt
   121741 tccaccaggc ggcgttgtgg ccacgggcgg ttcgtcgctt ggacctggag gggtgtcaca
   121801 ttctgtgacc gcgacgttga cgttagacac acgtcgctgc cgtcctcaga atgtgatagc
   121861 ccattacagg cattgtagct gttgcgttgg ttgggagttt ggggaccaaa tttctataat
   121921 tggtgtcacc gcggcagctc tagccctgga agatctggaa gcttgcttca atggctcaga
   121981 tcgacccgga ctacagttag cgaagtagac ccattataat cttaatctta aatctggttg
   122041 acggactttc gcgccgggaa cacgcaggtg gcagcggatg tgttttgccc aaacacgagg
   122101 gttgcaggaa acaggtgctg ccggggatta tgtacagctt acacccagtt tcctgtaatc
   122161 gcccgcatcc ggccgtcctg ggcagcaccg caccctgcgt aaacaaccgc gtactttttc
   122221 ctcgtccccc cacccccaca tccttcctcc caccctgcca gtccaacccg cttcctgttt
   122281 tattcgcctt caaacagaag cacgcattct aatgattctt acaaaacttg ttagtgttta
   122341 ttaaatcaga tacatacatt ctacggacca aaaattagca acagcttgtt atctatggtg
   122401 tatggcgata gtgttgggag tgtgatgggc cggaaaggtg aaggcccatt agggtttgca
   122461 cttggcgctg taggtctact cttgacaaag atctaagcat tgacattagg gcatccacgt
   122521 cagtgggacc cagtaggtct aagttttcca tacagtacac ccagtgtaag aatgtctgtg
   122581 gtgtgctgcg agaccctata gtgtccttgc ttaaaaatat caaagaccta atatccctcg
   122641 cacacagctc cccgtctacg tggagaacag tgagctgata agggctgaaa taactcattg
   122701 tgcccgctag gtggcgctct aaaaaacgcg ggtctaagtg aagcaggtcg cgcaagaggt
   122761 ctctgcgacc tgcacgaaac agacattccg ctaacagggg aaacgttaac ctgccctcct
   122821 cctttaaagc tctaagagct ccaattaatt gggccagtgt gggttgaggt atgaacacgt
   122881 ttaggaggaa caataccact tccctgtcat ccgtgcccag tttccgcgcc acctcacaga
   122941 gaacctcgta agtggccatg gtgccggctt gtatatgtga aggcaccgat gtggaaaaac
   123001 aaaggaaaat ttatttttcc gccctaaaca aaatcacaag cttaatagct gtccagaatg
   123061 cgcagatcaa agtccgaaac agatgttagg atctgttcca ctgccgcctg tagaacggaa
   123121 acatcgcatc ccaatatgct tgccagctga ggaactaccc cacccgagtg ggtatcctgc
   123181 ggaatgacgt tggcaggaac caacagcgca cagcctgcag cgctgataat agaggcgggc
   123241 aatgagccag tctttgggtc aactaaggct tttgtaatca gggtgttgac ctcgtggtgc
   123301 caaaagtcca ggtgttggga gccccccagc aatttaagta acaagaagga agtgacgtcc
   123361 gtcgctaaga ctgcctctgt tcgccacgcc aacttctcaa ggagttcttt ctcctggtct
   123421 ataagttctt ggcgggaaaa ggagtctgcc gcggcatagc aaagtgaact ggtagaaata
   123481 ggcgtgaggc ttctgagctt actggccact aacaggcagg cgctccctgt cttttgaaag
   123541 tgttctttgg acacctgctt tataagtagg agtctgtcca aaagattaag ggccaacgcg
   123601 accacgttag gttctaggtt gtattcctgg caaactgaaa acatccatgt gcccagtaac
   123661 ttacgcatat gcgaagtaag agattgttga aaggtcccaa atacagagtc agaagttaaa
   123721 aagcgcggct caatttcaag aatattgtaa aagatccgat cctcacatag cgtgggatcc
   123781 agaagtcccg agggcgggtt attggcagtt gccatataga gtggcgagcg tatgtggcct
   123841 acctgtagag cctggagttt cagggtgctc tgtcaggttc tcccatcgac gacgctgggc
   123901 cgcgagagta cgctagccgt tgtccgtgtg ttcagttgag gtagatgggt cgtgagaaca
   123961 ctgccccaca cacacaccag cacccatggc gccaaatgca agtgcggagc ggcgacggtg
   124021 gcttctaggg aggaaaaagg gggagaggtg tggcttttat gtcatttcct gtggagagtc
   124081 cccaggacct tggttttccc ctggctgggt taatggcagg ggctttttaa acttaactat
   124141 ggaagattgt aggtttcctg ccagggggtg actagcttcc caggctaggc gggccatttg
   124201 tactttctta cttgtgtctt tgttctgaca atacacatat acacaataag ttatgggcga
   124261 ctggtctggt ccagggtggg gcaagcagga cacggggcct gcctttactc ctccaaactg
   124321 gaaggcctga gataattttt taagtccgta tgggtcattg ccccaaaaaa tcactgcaaa
   124381 cttccattga cactttggat ctcgtcttcc atcctttccc aaaaagcgtc tataaaagat
   124441 gtgttgtggc ctagctttcg caggacaatc atctatctgt ctgtaaggga ccggtggttg
   124501 ttggtatctt ggatgtggct tttttgggtg ggtaactgga acgcgcctca tacgaactcc
   124561 aggtctgtgg ggtggtgatg ttctgagtac atagcggtat tcgcgagatg ggccaggttg
   124621 tgggtcatcg tctggtgtat tatctcctgg tgggctactg gcaatttgtt catgtgtgct
   124681 aacaacaggg taatccactt ccatttcgtc ctcggatgac gacccgtgca agattatggg
   124741 ctcttccacc gtctcctgct cctgctgttc caccccctgc tgctcctgct cttccacctc
   124801 ctctaactcc tgctcttcct gctcttccac ctcctctaac tcctgctctt cctgctcttc
   124861 cacctcctct aactcctgct cctcctgctc ctcctgctcc tgctcttgct cctccacctc
   124921 ctctaattcc tgctcttcct gctcctgctc ttgctcttcc acctcctcta actcctgctc
   124981 ctgctcctgc tcctctaact cctgctcctg ctcctctaac tcctgctcct gctcctctaa
   125041 ctcctgctcc tgctcctcta actcctgctc ctgctcctct aactcctgct cctgctcctc
   125101 taactcctgc tcctgctcct ctaactcctg ctcctgctcc tctaactcct gctcctgctc
   125161 ctctaactcc tgctcctgct cctctaactc ctgctcctgc tcctctaact cctgctcctg
   125221 ctcctctaac tcctgctcct gctcctctaa ctcctgctcc tgctcctcta actcctgctc
   125281 ctgctcctcc tgctgctcct gctcctcctg ctgctcctgc tcctcctgct gctcctgctc
   125341 ctcctgctgc tcctgttcat cctgctgctg ctgctcatcc tgctgctgct catcctgctg
   125401 ctcctgctca tcctgctgct gctcatcctg ctgctgctca tcctgctgct gctcatcctg
   125461 ctgctgctcc tcctgctgct cctgctcctc ctgctgctcc tgttcatcct gctgctgctg
   125521 ctcatcctgc tgctgctcat cctgctgctc ctgctcatcc tgctgctgct catcctgctg
   125581 ctgctcatcc tgctgctgct catcctgctg ctgctcatcc tgctgctgct catcctgctg
   125641 ctgctcatcc tgctgctgct catcctgctg ctgtggctcc tgctgttgtg gctcctgctg
   125701 ttgtggctcc tgctgttgtg gctcctgctg ttgtggctcc tgctgttgtg gctcctgctg
   125761 ctgtggctcc tgctgctgtg gctcctgctg ctgtggctcc tgctgctgtg gctcctgctg
   125821 ctgtggctcc tgctgctgtg gctcctgctg ctgtggctcc cgctgctggg gctcccgctg
   125881 ctgtggctcc cgctgctgtg gctcccgctg ctgtggctcc cgctgctggg gctcccgctg
   125941 ctggggctcc cgctgctggg gctcccgctg ctggggctcc cgctgctggg gctcccgctg
   126001 ctgtggctcc cgctgctgtg gctcccgctg ttgtggctcc tgctgctgtg gctcctgctg
   126061 ttgtggctcc tgctgctgtg gctcctgctg ctgtggctcc tgctgttgtg gctcctgctg
   126121 ctgtggctcc tgctgttgtg gctcctgctg ctgttgtgaa ctttggatgc tcaacgtttt
   126181 gtttccatcg cccccgtcct cctcgtcctc cttcttgtcc tcctcctcgt catcctcctc
   126241 gtcctcattg tcctcatcat cgtcatcctc ctcgtcctcc tcctcctcct cgtcctcctc
   126301 ctcgtcctcc tcctcgtcct cctcctcgtc ctcctcctcg tcatcctcct cgtcatcctc
   126361 ctcgtcatcc tcctcgtcat cctcctcgtc atcctcctcg tcatcctcct cgtcatcctc
   126421 ctcgtcctcc tcatctgtct cctgctcctc ctcatcatcc ttattgtcat tgtcatcctt
   126481 gtcaacctga ctttccttgc taatctcgtt gtccccatta tcctcgccag cctgattatt
   126541 ttcggaacat tctttttcat tcttggatgc ttcttctgca atctccgcaa ggagcaccaa
   126601 catggctgtg tcatcacccc aggatccctc agacggggat gatgatccta tggagatggg
   126661 agatgtaggc ggttggcgtg gcggagtatc gccatcgctg gatgatccca cgtagatcgg
   126721 ggactctgtg gcccatgggg ggtacacact acggttggcg aagtcacatc tagggggaga
   126781 gactgggggc gactgacata ttgggtttag tgtagaggga ccttgggggg acgatagcct
   126841 tctttttctc aggctacgca gggtagacgg agctaaagag tctggtgacg acttggaggg
   126901 aggctcgggt ggaggagtcg tgggtgagtg tggaggtgta gtctgctgcg agggtggcgg
   126961 acgcataggt gttgaagagt ctggccttcc tgtaggactt gaaagcggtg gcctttgaga
   127021 agactctgga gactgcgtgg gtggcaatgc aggagatgga gaatgagtat ccgtggtccc
   127081 cggagacaca ggatgggatg gagggattgg ggaggaagac gtggttacgg ggggtaagag
   127141 tgccggtgga ggtaaaggtg ttgcgggagc gggtgaagga atgggagcca ccggtaaagt
   127201 aggactagac acaaatgctg gcagcccgga tgtgaacact gtgggacttc ctggtatagg
   127261 caaggtgtgg ggtccacatt cccggccgtc gacggagtcg gcgacatgct tccttcgcgg
   127321 ttgtagatgt aggtcatcgc caaggtcaca tctttccgga gacctgtttc gtttcctaca
   127381 acttcctctc gttaagggcg cgccggtgct ccgtcccgac ctcaggcgca ttcccggggg
   127441 cgccatcctc gggaaatctg gtctgacaac caaagtaaaa ttatggaggc ggtggcagta
   127501 tattcacatt atgcaatacc cgtagtgacc acaaggggga gctctcagac aattaagcgg
   127561 ttacacacag tagcaggctg cagtaccgcc catggccaca ggatggagat cgcagacact
   127621 gaaacgctga aacacagcat taagctgcaa taccgccgat ggccaccaga tggcacgcgc
   127681 cgccagcaaa tttaagtcct ggtggctcac ctgccaggta aacaaggtta aagtgggttt
   127741 gctggccttg cgttgccatg gatgctacct aggcaagtcc agatatataa tccgggcgtg
   127801 agaaacagaa acggccaata acccatgttt ttcgaaaacc accacacacc ttaacacaaa
   127861 tcatgtacac ctggtattac tatttcccac acatcttata gcatttcaaa gataagggtg
   127921 ccttacgggc cgcccgaaac aagtgggcgg gcgctactca ctgtttataa gtcagccgga
   127981 ccaagctgct gctcttgggg acgtgactgc ttcgtggcgc agctgcctcc aaatgataca
   128041 cacatttttt gattgtcccg ggcgccgcgt agtggagggc ggagttatat caagctactt
   128101 tctgattggt gccccaggca ggactgccat aaaaactgaa gaaggcgtgt ctgctttgca
   128161 gaatttaccc cccactgtgc tcccggttgc tggcaccggt tcagtggtcc gacctgtcgt
   128221 ctgtgctccc ccgtggacga cgccgagtgc ctctcggggg tccatgtcta gcctcttcat
   128281 ttcattacct tgggtggcgt tcatctggct agccctcctt ggcgcggttg ggggtgcccg
   128341 cgttcagggg cccatgcggg gctctgctgc cctcacctgc gccatcacgc cccgtgctga
   128401 catagttagc gttacctggc aaaaaaggca gctccccggt cccgtaaacg tcgccacgta
   128461 cagccattca tatggggtgg tggttcagac ccagtaccgc cacaaggcaa atataacctg
   128521 tcctgggctt tggaactcta cccttgttat ccataacctt gcagtggatg atgagggctg
   128581 ttacctgtgt atctttaact catttggtgg ccggcaggtg tcatgcacag cctgcctgga
   128641 agtgacatct ccccctactg gacacgtgca ggtaaatagc acagaagacg cagacaccgt
   128701 cacctgtttg gcaactggtc gcccaccccc caatgtcacc tgggccgcac cctggaacaa
   128761 cgcctcttct acccaggagc agttcactga cagtgatggt cttacagttg cgtggaggac
   128821 cgtgaggctg ccgcgtgggg ataataccac cccaagtgag ggaatatgtc tcatcacctg
   128881 gggaaatgag agcatatcaa tcccggcttc tattcaaggc cccttggccc atgaccttcc
   128941 cgcggcccag ggaactcttg ccggggttgc cattactctg gtgggcctat ttgggatatt
   129001 cgcattacat cattgccgcc gcaagcaggg cggtgcatca cctacttcag atgacatgga
   129061 ccccctatcc acccagtgac tagatggaca ccccgtgaac cgtcgtgctt acccaccccc
   129121 ttctgattct gacagacaac actactatgt cccaaagact gttttttaca gcccgatggc
   129181 ccttcaggcc tccttgagtg tctagctggt cccgtggtca ttgtgtggtt tggcagtcac
   129241 ttccccattt tggtgtcgcg ttttgggttt tgccctgccc ccagccaacg tggatcatat
   129301 tctttcccgt caggggagtg acaagctata ggacagaaag gtcacctggc ccaaacggag
   129361 gatcctaggt gggtgtgcat ttattagacg ttggtgtgtt gaaggacgga tcaggcgggg
   129421 aggaggggtg ggggagactt actgcagcac taggttaggt tgaaagccgg ggtaaaaggc
   129481 gtggctaaac aacacctata ctacttgtta ttgtaggcca tggcggccga ggatttccta
   129541 accatcttct tagatgatga tgaatcctgg aatgaaactc taaatatgag cggatatgac
   129601 tactctggaa acttcagcct agaagtgagc gtgtgtgaga tgaccaccgt ggtgccttac
   129661 acgtggaacg ttggaatact ctctctgatt ttcctcataa atgttcttgg aaatggattg
   129721 gtcacctaca ttttttgcaa gcaccgatcg cgggcaggag cgatagatat actgctcctg
   129781 ggtatctgcc taaactcgct gtgtcttagc atatctctat tggcagaagt gttgatgttt
   129841 ttgtttccca atatcatctc cacaggcttg tgcagacttg aaattttttt ttactattta
   129901 tatgtctact tggatatctt cagtgttgtg tgcgtcagtc tagtgaggta cctcctggtg
   129961 gcatattcta cgcgttcctg gcccaagaag cagtccctcg gatgggtact gacatccgct
   130021 gcactgttaa ttgcattggt gctgtcgggg gatgcctgtc ggcacaggag cagggtggtc
   130081 gacccggtca gcaagcaggc catgtgttat gagaacgcgg gaaacatgac tgcagactgg
   130141 cgactgcatg tcagaaccgt gtcagttact gcaggtttcc tgttacccct ggccctcctt
   130201 attctgtttt atgctctcac ctggtgtgtg gtgaggagga caaagctgca agccaggcgg
   130261 aaggtaaggg gggtgattgt tgctgtggtg ctgctgtttt ttgtgttttg cttcccttac
   130321 cacgtactaa atctactgga cactctgcta aggcgacgct ggatccggga cagctgctat
   130381 acgcgggggt tgataaacgt gggtctggca gtaacctcgt tactgcaggc actgtacagc
   130441 gccgttgttc ccctgatata ctcctgcctg ggatccctct ttaggcagag gatgtacggt
   130501 ctcttccaaa gcctcaggca gtctttcatg tccggcgcca ccacgtagcc cgcggatgtc
   130561 tacgtgccct tcccccttaa tttaatctag cctcccgttc ccatgatgca gagaggcgaa
   130621 tctggtttgt acacagatgt gactatgtat ttgttttatt atgcgattaa atgaggggtc
   130681 tgatcccaaa agcaatgttt agtggtggtc gttgatcttc ttgacgctcc ataggtagat
   130741 tgactggaac gccatggccc acggggacat ggacaggggt gttaggtctg gtggaacatg
   130801 ctgccactgc cacggatgga acatcaggga tgggtctatg atcagggcag cgtgtcgccc
   130861 gtcactggat gtaagtccgg ccaccgtgga gttgcctgtg gggtttctgg gatagtgtct
   130921 ggctggcagg gtctcatccg cggcatttcc atggtaggtg agggttatct cgcctcgctg
   130981 tctcagtatg tactcgaggg cgtcctgctc gtaccggacc cccaggtact cgccctgggc
   131041 ccagctgggc agcaccgtcc cccgcaacac tcggaggaaa acgctcttag tgttctgagg
   131101 gatctgtatg tttagccagt ggctgtcata cagcttggac acgttggtct ccaggtttac
   131161 cgcccagcgc tggggtggtg tgggtccgta cgtgtatggt gaggattccg accggcccac
   131221 tacacccagg gccaccagaa gctggaagcc cacttcgcca cagcagatgg agaatgtgtc
   131281 gggcctgttt agaaactctg tcagggtgga ggcacaggta gggtcgttac acagcgccag
   131341 gacccatccc ctggcgctgg cgtagctggc ctggcagcct gttctgagac atgtaatcag
   131401 accagagaac cccgacaagg actgtcctcg tttaagctct tccacagtca ccgtggccac
   131461 ctcaaagccc gtgttctgca acgcggccat gagcgcgtac ggggcgctgc tcccaggcag
   131521 caccaacgcg gccacacggc gcggggaggt ggggcatgaa aacaggcgca gctgactccc
   131581 aaggcacatg gcccttaggc tgcccaggtg atgctccaga cgtcccaggt ccttcctgtg
   131641 catgtcctcc agtgggtgca ggggaggcgt caccaggttc cacatttcgt cagaaaagga
   131701 ggtccatgag acttgcaagg aagtcagggt ctcttgaaac acaactgtct cgttctgcaa
   131761 aatcgtgacg ttgttgcctt gtccctcggg gccaacggtg cccagtgggt gtgccacgca
   131821 gcggtagtcc ctagccgccc gcagcacctc tgacaagtgt acctggggca cctcaaccag
   131881 tgccccaggg gtctctgaaa ccataagttc gagcgggtta gggtgggcgg gtagtgagag
   131941 ctgcagtccc ctgcagccgg ccagggccat ctcgattgca gatgggagaa gccccccgtc
   132001 ccctatgtcg tgccccgata caatgagcct cttggacatc aggtacttaa caagcatgaa
   132061 caggctggcg accgtggacg ggttcagagg gggtattggg tgcctggatg ccaggaagtt
   132121 gtgctcgaag gtggacccgg ctatgagaca gctctgattc acggccaggt ataccagggc
   132181 gttgccttcg acctttacgt ccggggtgac cctgtatctg gatcccttga cctcggccca
   132241 gctggtaaac accaccgagt tgaagggaag gacctccacc gtttcttgct gttgtgtgat
   132301 gcgcacatgg cgctccgaaa gcgtcggaga gctggcagcc gaggagatgg acagtgccac
   132361 tcccagctcc cggcagaatt ccttgcaggc gaagaggcac tcctgtagga ggccggcttg
   132421 gtggtcctcc ggactccacg ccacggcgcc agttagcact acgtcctgga gcttggacac
   132481 gggactgaac atgaggttgg tgagagcctc ggtgatggca taggtggccc cggtggatac
   132541 attagtagcc atcttgtagg cctgctcccc catggccatg gcctgacccc tccacgctgg
   132601 cactggaagc agctcctggg gcagggcctt cacccaggtc tcgaagtcct tgtgtaggag
   132661 gttggccatg gacggagtga tggcctccac cgtgtcgggc actctgggcg ccaccctctc
   132721 ggccagcatg gacgagtgca gcaccaggtg gtagtctgaa accggtatgt ccaggggtcc
   132781 cacgccagcc tgttgggcga tgaggccgtt ggagcatctg tccatgtgtc gcgtaaagaa
   132841 ctccttgctg ccaaccgtcg cgtggcgaag taactggtgg attgtggagc cggtggcaaa
   132901 aaggccccag tcaacatcct cggggtgccc cgagacgcgg acaccatcgg acagcgccag
   132961 ccagggggac gggggggtgg acgagggctg gtctacagag aagaccctcg tggtctcccc
   133021 ggtcaggtcg tctactattc tgatgcctgg ctgctccgag gtcctcccga ggaccgttat
   133081 ctggcacgcg cacaggcgcg cggcgcgctg cagtacctcc aacggggtct cgcccagatc
   133141 cccaggcacc gcgcccgact ctgccaccac cgcaaacacc agggagcaat acacgttgag
   133201 aaagtgctct gccaccgccg cctccacggc atccggaccg gcagcgggat ccgctggcag
   133261 gtgggcgcgc acctcgtcgg gtagcttgga gacaaacagc tccaggccag tccgcggcgc
   133321 tagcgcctgc aggtgcctca ccaccggggc cgggtcatgc gatctgttta gtccggagaa
   133381 gatagggccc ttggcaagcc gctgaaccag cttcagggtc tccaagatgc gcaccgcgtt
   133441 gtcggagctg tcgcgataga ggttagggta ggtgtccggt ccgtccgtgg gctcaaacct
   133501 gcccagacac accactgtct gctgggggat catccttctc agggagatgc attctttgga
   133561 agtagtggta gagatggagc agactgccag ggcgttgcca ggagtggtgg cgatggtgcg
   133621 caccgttttt aagaaacccc ccagggtggg gactcccgct ccctgcagca tctcggcctg
   133681 ctgtacgccc ttggcgaata tgcgacgaaa tcggctgtgc gcacggggtc ccagggccgg
   133741 ttcggtggca tacaggccgg tgagggcccc ctgggtctgt ccgcctggaa acagggtgct
   133801 gtgaaacaac aggttgccaa ggccgcgaat acccctctgc acgctgctgt ggacgtgggt
   133861 gtatgctccg tggatcccga atgcctgtct ggcacagttc cagggccacc gttccatggt
   133921 gcatcttccc ggtatcacaa agtacctggc cacgttataa ttgtccccgg ttgaagcctg
   133981 caccgccagc ggtagcaggt ctgcccccag ggatatcata acagcctgca taatgacatc
   134041 atcttcaatg tgtggcctag ccacgggctg gggaccctcg ggcacttcca acccctcgta
   134101 cggtaccagg tcagtatttt gtgtaaatgc cctgataaac tgaggtgggt gtggttctag
   134161 cagggtctgt gtgattttgg acaccaggtg cctgcccact tccactctag cccactcctg
   134221 cagtcctagc tctcgcagca aaactccaag ctctgttgac agtgttgtgg gcctgtggtt
   134281 tatgtttggc ccgtagccaa aggatacaac acgctcgctc ccccgtggcg gagaccgcct
   134341 gatgacatgg ggatatccaa ggagcggtga cagcacagcg agcaccgtct gtatttccac
   134401 atcccgtctc tctcgctcct ccctcgaagt gggaggtctt cggaaagtta tccatagcag
   134461 atagtagcct ccggtgccac cgggtacgag agtgagtgtg cccgtacggc ttgtataaaa
   134521 gctgacaaaa gcttcctcat ccgcggtgag atcactctcc aaccacagcc cagtgacgtc
   134581 gtaggccatg cctagagggt gccccgcccc cggggacacc ctctgtagtc agacttgggt
   134641 tagggctttg atttctctgg ggagtaggaa gaaactgaga atccccaaat attacgcagg
   134701 cacaggttgc tctgcagagt ttgttttcgc tttcgtggaa tccacagtta catgtagcca
   134761 tgtcactaac ctcaaatact caaaaaaagg tatcgatgtc aaaaagtctg tggtcgtgga
   134821 gggctagttc ctgggaaata aaacctcctc atacaggtcg tctgtcggtt gggtggcggc
   134881 ttgggcggtg tctatacgga aggcactccc accatcaacc cttaaaattg acattcctga
   134941 ttggtctggc tgtggtgatg gttcacgtga ttcttccgca ccggacacta aaatactggc
   135001 atacccgaat acattgggtg ggtccctatt cacttcctgt aactccacct cgttcagtag
   135061 ttggctcccg cggcccctat cggtgacatg gctaggtaac ctaacaggct gtctaaaaaa
   135121 aggtggtaat ggtggagggc taattacatt attgccaagg tggttgtcat tgtggtgtaa
   135181 gttctggtcc cgcgtgtata tgcgccgcct tctctgtcgg taactattta cagccaccac
   135241 ttttttttcc ttatataaat aaaataccag cagtccttgt aacgtaccta aattttaaaa
   135301 tagaaaaata ctttttttac atagtatatg tcatgtggtg atataattta tggtaattag
   135361 tctttaactt actgaatagt gtactgatgc agatgatcat tgttaggatg cctcttgtta
   135421 aaccactagg gagaagcatt actaattgta cacaacctcc agtgtgggac cacgctaaaa
   135481 aatagaggat agttatgttt ttgtgtcatt gttaaaaaat aaaatccaac tttataatgt
   135541 ggaaagtgct acctacctgc aattaaatgc agcattccag taacaagaga cgccttgtta
   135601 aaactttgcc acacataaag gcaccataga aaaatgaggc atacaagaag caatatttcg
   135661 tggcctgttt atacataaaa acacaaatta tgtagtgtac atttatttag atgcttgaac
   135721 cataccatca atgctataca acaaaccttt gatattgcca gtggtgctag taattgcaag
   135781 tagttcggtt gttaaagttt gtgtggttag cactcccccc tgaagaagca ggaacgttaa
   135841 tattccacgt tttggtggag cccatgactt atgaagagtg ctgattatgc cagtgaatcc
   135901 tacaaaaaat gtcgttaaca gcaacatgta ctatgcacca actaaaactt gtatttaaaa
   135961 aatacttgtt ctgtacccaa ataaatgctg gaaagactta atcctgcagc ggtggcagta
   136021 catgtatgcg ttttacagca ggatacaggg taacccatga ccaagcctat aaaaaaagat
   136081 aaccgagtgt taacttcagt ttagttgaca ggcctatctg tgaatttccg gtgtgaaaac
   136141 agtggttaac ttacctgcac aaatgaaaga gacagatgac actaatttaa tattgcctgt
   136201 tttcacggtg gcaaatgcat acaagaatgg caagctgaga gtgaagctaa ttggaaaaaa
   136261 tatccaagac gattgccagg tgtttgacat gtggaccagc atgtttgtca tcaacacagc
   136321 aaacgttgat gtgaataata ttccatgttc aagttgtaat ttacaggcgg tgcagtgttt
   136381 tattaacgtc aaaaaagcta taaaatacaa aaagaatgtt aagtgccata ataagtatga
   136441 gtttgttgga tataacatat agacccacca tactacctac ctgttaccag tgataaaatg
   136501 gccgtggtga ttaagcaagc ataggttaca gagttggtag ttgacaagtt ccaaagttta
   136561 aggacaatgc aagctataaa aacaaatgta tgtgaatata caagtgtcag cttgcaatgt
   136621 ttatactaca atgaaaaaaa ggaaaagcta cttaccagga attcctggta gccagtactt
   136681 accaataatt cctaggtgcc aggatgaagg ccatttagga ttgttgctag agattgcctg
   136741 tgtatactta ttaatagcac tgacaaacaa aatgcacata acaagcaaag aagccattgt
   136801 atcaattgag ttggtagtta cacagacaag agtgatacac caaaaacata ccagtagggc
   136861 ccaaagccat aaattccaga agaatatgag tgtcttcatt ttgactaggt atccacaggg
   136921 cttacaatag agttgttgta aatggggttt gtgattttta aatacgtttt aggattcacg
   136981 tgatactaga aagggcattt aaggttttgt gtacaattgt tttaggaagc cacatggaat
   137041 tttgctgatt tcctaagtat tcccgacaca aggctcataa atattccgga tacaaggctc
   137101 gtaaattgtt acagctgcaa aaaacagata agatgaagag tatcctggaa atgggggaag
   137161 ggaagggcgc gcctggtccc cgcccccgcc cgcgggggac cccgggcagc gagggaaggg
   137221 ggcgccctct ctctactgtg cgaggagtct gggctgctgt gtgtgagcct gtttggggga
   137281 gcctcctcag tgcttgctac gtggagccct ggacactacg tgaacacccc gcgccccgcg
   137341 ccccccacac cgcgccgccc ctccccctcc ccccgctcgc ctcccggcgc tgccgccagg
   137401 ccccggccgg agccggccgc ccgcgggggg cagggcgcgc ccggcggctc cctcgcgggg
   137461 cgggggacgg gggagggggg agccgggccc ccgcgcgccg cggcagcgga gcgcgagcgc
   137521 ccccgccggc cgccagcggc ggcgcaggcc ccggggcccc gagccccgag ccccgccggg
   137581 gtacggggct aggccacgcc tacttttttt ttcgggcggc cccccgaccc tctctcggcc
   137641 cccccggtcc ccgcggcccg cgcgcgcccc cccggggggg taaaataggg ggggggatgc
   137701 ggccgcggcg gcgcccgcgg cggcggcggc gcttgctttc gttttctccc gcggcccccc
   137761 gggcgcgagc cgcgcggcgg cggcgggcgc cccctccccc ggggggctcg gcggggggcc
   137821 ccctgtcccc gcgcgggccc gcgacccccg gcgccgccgc gccccgatcc cgcgggcgcc
   137881 ccgcccccct gccggggacg ccgccggggc ctgcggcgcc tcccgcccgg gcatggggcc
   137941 gcgcgccgcc tcagggcccg gcgcggccg
//
DBGET integrated database retrieval system