GenomeNet

Database: RefSeq
Entry: NC_009334
LinkDB: NC_009334
Original site: NC_009334 
LOCUS       NC_009334             172764 bp    DNA     circular VRL 13-AUG-2018
DEFINITION  Human herpesvirus 4, complete genome.
ACCESSION   NC_009334
VERSION     NC_009334.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Human herpesvirus 4 type 2 (Epstein-Barr virus type 2)
  ORGANISM  Human herpesvirus 4 type 2
            Viruses; Duplodnaviria; Heunggongvirae; Peploviricota;
            Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae;
            Lymphocryptovirus.
REFERENCE   1  (bases 1 to 172764)
  AUTHORS   Dolan,A., Addison,C., Gatherer,D., Davison,A.J. and McGeoch,D.J.
  TITLE     The genome of Epstein-Barr virus type 2 strain AG876
  JOURNAL   Virology 350 (1), 164-170 (2006)
   PUBMED   16490228
REFERENCE   2  (bases 1 to 172764)
  AUTHORS   Dolan,A., Addison,C., Davison,A.J., Rickinson,A.B. and McGeoch,D.J.
  TITLE     DNA sequence of Epstein-Barr virus type 2
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 172764)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-APR-2007) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 172764)
  AUTHORS   McGeoch,D.J. and Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (22-MAY-2006) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
REFERENCE   5  (bases 1 to 172764)
  AUTHORS   McGeoch,D.J. and Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-NOV-2005) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, UK
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from DQ279927.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..172764
                     /organism="Human herpesvirus 4 type 2"
                     /mol_type="genomic DNA"
                     /strain="AG876"
                     /host="Homo sapiens"
                     /db_xref="taxon:12509"
                     /acronym="EBV"
                     /acronym="HHV-4"
     gene            join(167587..172764,1..1680)
                     /locus_tag="HHV4tp2_gp01"
                     /db_xref="GeneID:5176182"
     CDS             join(167587..167942,58..272,360..458,540..788,871..951,
                     1026..1196,1280..1495,1574..1680)
                     /locus_tag="HHV4tp2_gp01"
                     /function="latency and B cell survival"
                     /note="multiple transmembrane protein; LMP-2A"
                     /codon_start=1
                     /product="K15"
                     /protein_id="YP_001129436.1"
                     /db_xref="GeneID:5176182"
                     /translation="MGSLEMVPMGAGPPSPGGDPDGDDGGNNSQYPSASGSSGNTPTP
                     PNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYS
                     PRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALS
                     LLLLAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGG
                     LQGIYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVS
                     MTLLLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLNLTTMFLLMLLWTLV
                     VLLICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNL
                     FCMLLLIVAGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMTNTLLSA
                     WILTAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV"
     misc_feature    join(167587..167942,58..272,360..458,540..788,871..951,
                     1026..1196,1280..1495,1574..1677)
                     /locus_tag="HHV4tp2_gp01"
                     /note="Gammaherpesvirus latent membrane protein (LMP2)
                     protein; Region: Herpes_LMP2; pfam07415"
                     /db_xref="CDD:284762"
     gene            59..1680
                     /locus_tag="HHV4tp2_gp02"
                     /db_xref="GeneID:5176195"
     CDS             join(59..272,360..458,540..788,871..951,1026..1196,
                     1280..1495,1574..1680)
                     /locus_tag="HHV4tp2_gp02"
                     /function="latency and B cell survival"
                     /note="N-terminally truncated form of LMP-2A; multiple
                     transmembrane protein"
                     /codon_start=1
                     /product="LMP-2B"
                     /protein_id="YP_001129437.1"
                     /db_xref="GeneID:5176195"
                     /translation="MNPVCLPVIVAPYLFWLAAIAASCFTASVSTVVTATGLALSLLL
                     LAAVASSYAAAQRKLLTPVTVLTAVVTFFAICLTWRIEDPPFNSLLFALLAAAGGLQG
                     IYVLVMLVLLILAYRRRWRRLTVCGGIMFLACVLVLIVDAVLQLSPLLGAVTVVSMTL
                     LLLAFVLWLSSPGGLGTLGAALLTLAAALALLASLILGTLNLTTMFLLMLLWTLVVLL
                     ICSSCSSCPLSKILLARLFLYALALLLLASALIAGGSILQTNFKSLSSTEFIPNLFCM
                     LLLIVAGILFILAILTEWGSGNRTYGPVFMCLGGLLTMVAGAVWLTVMTNTLLSAWIL
                     TAGFLIFLIGFALFGVIRCCRYCCYYCLTLESEERPPTPYRNTV"
     misc_feature    join(<59..272,360..458,540..788,871..951,1026..1196,
                     1280..1495,1574..1677)
                     /locus_tag="HHV4tp2_gp02"
                     /note="Gammaherpesvirus latent membrane protein (LMP2)
                     protein; Region: Herpes_LMP2; pfam07415"
                     /db_xref="CDD:284762"
     gene            1736..5692
                     /locus_tag="HHV4tp2_gp03"
                     /db_xref="GeneID:5176185"
     CDS             1736..5692
                     /locus_tag="HHV4tp2_gp03"
                     /note="tegument protein; FGAM-synthase; the Herpesviridae
                     are non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; this family of herpesvirus
                     proteins show homology to the eukaryotic
                     phosphoribosylformylglycinamidine synthases
                     (FGAM-synthase)"
                     /codon_start=1
                     /product="FGAM-synthase"
                     /protein_id="YP_001129438.1"
                     /db_xref="GeneID:5176185"
                     /translation="MEDRGRETQMPVARYGGPFIMVRLFGQDGEANIQEQRLYELLSD
                     PRSALGLDPGPLIAENLLLVALRGTNNDPRPQRQERARELALVGILLGNGEQGEHLGT
                     ESALEASGNNYVYAYGPDWMARPSTWSAEIQQFLRLLGATYVLRVEMGRQFGFEVHRS
                     RPSFRQFQAINHLVLFDNALRKYDSGQVAAGFQRALLVAGPETADTRPDLRKLNEWVF
                     GGRAAGGRQLADELKIVSALRDTYSGHLVLQPTETLDTWKVLSRDTRTAHSLEHGFIH
                     AAGTIQANCPQLFMRRQHPGLFPFVSAIASSLGWYYQTATGPGADARAAARRQQAFQT
                     RAAAECHAKSGVPVVAGFYRTINATLKGGEGLQPTMFNGELGAIKHQALDTVRYDYGH
                     YLIMLGPFQPWSGLTAPPCPYAESSWAQAAVQTALELFSALYPAPCISGYARPPGPSA
                     VIEHLGSLVPKGGLLLFLSHLPDDVKDGLGEMGPARATGPGMQQFVSSYFLNPACSNV
                     FITVRQRGEKINGRTVLQALGRACDMAGCQHYVLGSTVPLGGLNFVNDLASPVSTAEM
                     MDDFSPFFTVEFPPIQEEGARSPVPLDVDESMDISPSYELPWLSLESCLTSILSHPTV
                     GSKEHLVRHTDRVSGGRVAQQPGVGPLDLPLADYAFVAHSQVWTRPGGAPPLPYRTWD
                     RMTEKLLVSAKPGGENVKVSGTVITLGEQGYKVSLDLREGTRLAMAEALLNAAFAPIL
                     DPEDVLLTLHLHLDPRRADNSVVMEAMTAASDYARGLGVKLTFGSASCPETGSSASSF
                     MTVVASVSAPGEFSGPLITPVLQKTGSLLIAVRCGDGKIQGGSLFEQLFSDVATTPRA
                     PEALSLKNLFRAVQQLVKSGIVLSGHDISDGGLVTCLVEMALAGQRGVTITMPVASDY
                     LPEMFAEHPGLVFEVEERSVGEVLQTLRSMNMYPAVLGRVGEQGPDQMFEVQHGPETV
                     LRQSLRLLLGTWSSFASEQYECLRPDRINRSMHVSDYGYNEALAVSPLTGKNLSPRRL
                     VTEPDPRCQVAVLCAPGTRGHESLLAAFTNAGCLCRRVFFREVRDNTFLDKYVGLAIG
                     GVHGARDSALAGRATVALINRSPALRDAILKFLNRPDTFSVALGELGVQVLAGLGAVG
                     STDNPPAPGVEVNVQRSPLILAPNASGMFESRWLNISIPATTSSVMLRGLRGCVLPCW
                     VQGSCLGLQFTNLGMPYVLQNAHQIACHFHSNGTDAWRFAMNYPRNPTEQGNIAGLCS
                     RDGRHLALLCDPSLCTDFWQWEHIPPAFGHPTGCSPWTLMFQAAHLWSLRHGRPSE"
     misc_feature    1778..5674
                     /locus_tag="HHV4tp2_gp03"
                     /note="FGAM-synthase; Provisional; Region: PHA03366"
                     /db_xref="CDD:223058"
     misc_feature    2543..3388
                     /locus_tag="HHV4tp2_gp03"
                     /note="dsDNA viral tegument protein; Region:
                     Tegument_dsDNA; pfam12818"
                     /db_xref="CDD:289579"
     misc_feature    3839..4597
                     /locus_tag="HHV4tp2_gp03"
                     /note="AIR (aminoimidazole ribonucleotide) synthase
                     related protein. This family includes Hydrogen
                     expression/formation protein HypE, AIR synthases, FGAM
                     (formylglycinamidine ribonucleotide) synthase and
                     Selenophosphate synthetase (SelD). The N-terminal
                     domain...; Region: PurM-like; cl10019"
                     /db_xref="CDD:299147"
     misc_feature    order(3842..3853,3857..3859,3932..3934,3971..3973,
                     3980..3982,4088..4090,4130..4135,4145..4147)
                     /locus_tag="HHV4tp2_gp03"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100027"
     misc_feature    order(3920..3922,3932..3934,4082..4090)
                     /locus_tag="HHV4tp2_gp03"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100027"
     misc_feature    4844..5662
                     /locus_tag="HHV4tp2_gp03"
                     /note="CobB/CobQ-like glutamine amidotransferase domain;
                     Region: GATase_5; pfam13507"
                     /db_xref="CDD:290241"
     gene            6634..6800
                     /locus_tag="HHV4tp2_gs01"
                     /db_xref="GeneID:5176223"
     misc_RNA        6634..6800
                     /locus_tag="HHV4tp2_gs01"
                     /product="EBER-1"
                     /db_xref="GeneID:5176223"
     gene            6961..7133
                     /locus_tag="HHV4tp2_gs02"
                     /db_xref="GeneID:5176201"
     misc_RNA        6961..7133
                     /locus_tag="HHV4tp2_gs02"
                     /product="EBER-2"
                     /db_xref="GeneID:5176201"
     rep_origin      7320..9295
                     /note="region containing oriP, the latent cycle origin of
                     DNA replication"
     gene            9659..10171
                     /locus_tag="HHV4tp2_gp04"
                     /db_xref="GeneID:5176163"
     CDS             9659..10171
                     /locus_tag="HHV4tp2_gp04"
                     /note="vIL-10"
                     /codon_start=1
                     /product="BCRF1"
                     /protein_id="YP_001129439.1"
                     /db_xref="GeneID:5176163"
                     /translation="MERRLVVTLQCLVLLYLAPECGGTDQCDNFPQMLRDLRDAFSRV
                     KTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHV
                     NSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINY
                     IEAYMTIKAR"
     misc_feature    9677..10159
                     /locus_tag="HHV4tp2_gp04"
                     /note="Interleukin 10; Region: IL10; cl02501"
                     /db_xref="CDD:413341"
     repeat_region   11986..35323
                     /note="7 copies; IR1; W"
                     /rpt_type=direct
                     /rpt_unit_range=11986..15055
     variation       11989
                     /note="also in other copies of IR1"
                     /replace="t"
     misc_feature    12523..13674
                     /note="corresponds to BWRF1 in NC_007605; present in each
                     copy of IR1; unlikely to encode a functional protein"
     variation       12711
                     /note="also in other copies of IR1"
                     /replace="c"
     variation       12715
                     /note="also in other copies of IR1"
                     /replace="a"
     variation       12718
                     /note="also in other copies of IR1"
                     /replace="t"
     gene            14391..35662
                     /locus_tag="HHV4tp2_gp05"
                     /db_xref="GeneID:5176191"
     CDS             join(14391..14392,14542..14602,14684..14815,17607..17672,
                     17754..17885,20677..20742,20824..20955,23747..23812,
                     23894..24025,26817..26882,26964..27095,29887..29952,
                     30034..30165,32957..33022,33104..33235,35441..35473,
                     35558..35662)
                     /locus_tag="HHV4tp2_gp05"
                     /note="latency protein; can initiate within any copy of
                     IR1"
                     /codon_start=1
                     /product="EBNA-LP"
                     /protein_id="YP_001129440.1"
                     /db_xref="GeneID:5176191"
                     /translation="MGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPR
                     RVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSP
                     TRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLL
                     RRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGP
                     EGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPAR
                     PGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDR
                     SEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGS
                     PSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQ
                     EEEVVSGSPSGPLRPRPQPPAQSLREWLLRISERFDPHPVATRRQSVYIEEEEDED"
     misc_feature    join(17610..17672,17754..17885,20677..20742,20824..20955,
                     23747..23776)
                     /locus_tag="HHV4tp2_gp05"
                     /note="Herpesvirus leader protein; Region: Herpes_LP;
                     pfam03363"
                     /db_xref="CDD:281372"
     misc_feature    join(23750..23812,23894..24025,26817..26882,26964..27095,
                     29887..29916)
                     /locus_tag="HHV4tp2_gp05"
                     /note="Herpesvirus leader protein; Region: Herpes_LP;
                     pfam03363"
                     /db_xref="CDD:281372"
     misc_feature    join(29890..29952,30034..30165,32957..33022,33104..33235,
                     35441..35473,35558..35653)
                     /locus_tag="HHV4tp2_gp05"
                     /note="Herpesvirus leader protein; Region: Herpes_LP;
                     pfam03363"
                     /db_xref="CDD:281372"
     gene            36201..37565
                     /locus_tag="HHV4tp2_gp06"
                     /db_xref="GeneID:5176198"
     CDS             36201..37565
                     /locus_tag="HHV4tp2_gp06"
                     /function="transcription factor"
                     /note="latency protein"
                     /codon_start=1
                     /product="EBNA-2"
                     /protein_id="YP_001129441.1"
                     /db_xref="GeneID:5176198"
                     /translation="MPTYYLALHGGQSYNLIVDTDMSGNPSLSVIPTNPYQEQLSNNP
                     LIQLQIVVGENTGAPAPPQPPPPPPPPPPPERRDAWTQEPLPLDMNPLGSDASQGPLA
                     SSIRMLCMAQYLLRNARGQQGLLRPLGPQTRSQVTLERQPVHNPRQEAPIILLQSPAP
                     PRFTPVPMVALGHTLQPTPPPRPTLPQPRIPLIIPPRHTNQPATTPPTAPQRLTLGHQ
                     LSLPPHPPPHQSTPHCSSDSTGLPPPPTSYSIPSMTLSPEPLPPPAAPAHPLPGVIYD
                     QQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKL
                     PEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPI
                     HEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPR
                     TSTQ"
     misc_feature    complement(38278..40385)
                     /note="corresponds to BHLF1 in NC_007605; unlikely to
                     encode a functional protein"
     repeat_region   38281..39944
                     /note="13 copies; IR2; NotI"
                     /rpt_type=direct
                     /rpt_unit_seq="1"
     rep_origin      40417..41409
                     /note="region containing oriLyt, the core lytic cycle
                     origin of DNA replication"
     repeat_region   40482..41525
                     /note="DRleft; similar to DRright"
                     /rpt_type=direct
     gene            42204..42779
                     /locus_tag="HHV4tp2_gp07"
                     /db_xref="GeneID:5176205"
     CDS             42204..42779
                     /locus_tag="HHV4tp2_gp07"
                     /note="vbcl-2a"
                     /codon_start=1
                     /product="BHRF1"
                     /protein_id="YP_001129442.1"
                     /db_xref="GeneID:5176205"
                     /translation="MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPED
                     TVVLRYHVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRAL
                     AWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPG
                     SRRFSWTLFLAGLTLSLLVICSYLFISRGRH"
     misc_feature    42363..42653
                     /locus_tag="HHV4tp2_gp07"
                     /note="Apoptosis regulator proteins, Bcl-2 family; Region:
                     Bcl-2; pfam00452"
                     /db_xref="CDD:395362"
     misc_feature    order(42369..42374,42384..42386,42393..42398,42444..42449,
                     42456..42461,42468..42473,42492..42494,42498..42503,
                     42507..42512,42522..42524,42534..42536)
                     /locus_tag="HHV4tp2_gp07"
                     /note="BH3-homology region binding site [active]"
                     /db_xref="CDD:132900"
     misc_feature    order(42468..42476,42489..42527)
                     /locus_tag="HHV4tp2_gp07"
                     /note="BH1 [active]"
                     /db_xref="CDD:132900"
     misc_feature    42627..42668
                     /locus_tag="HHV4tp2_gp07"
                     /note="BH2 [active]"
                     /db_xref="CDD:132900"
     gene            complement(43807..44763)
                     /locus_tag="HHV4tp2_gp08"
                     /db_xref="GeneID:5176194"
     CDS             complement(43807..44763)
                     /locus_tag="HHV4tp2_gp08"
                     /function="role in egress of capsids from nucleus"
                     /note="herpesvirus core gene UL31 family; ORF69"
                     /codon_start=1
                     /product="BFLF2"
                     /protein_id="YP_001129443.1"
                     /db_xref="GeneID:5176194"
                     /translation="MAPVTPDAVNARQQRPADPALRRLMHPHHRNYTASKASAHSVKS
                     VSRCGKSRSELGRMERVGSVARSICSRHTRHGVDRSHFSLRDFFRGISANFELGKDFL
                     REMNTPIHVSEAVFLPLSLCTLSPGRCLRLSPFGHSLTLGSHCEICINRSQVHVPQEF
                     SSTQLSFFNNVHKIIPNKTFYVSLLSSSPSAVKAGLSQPSLLYAYLVTGHFCGTICPI
                     FSTNGKGRLIMHLLLQGTSLHIPETCLKLLCENIGPTYELAVDLVGDAFCIKVSPRDT
                     VYEKAVNVDEDAIYEAIKDLECGDELRLQIINYTQLILENKQ"
     misc_feature    complement(43825..44586)
                     /locus_tag="HHV4tp2_gp08"
                     /note="Herpesvirus UL31-like protein; Region: Herpes_UL31;
                     cl27388"
                     /db_xref="CDD:421492"
     gene            complement(44776..46353)
                     /locus_tag="HHV4tp2_gp09"
                     /db_xref="GeneID:5176154"
     CDS             complement(44776..46353)
                     /locus_tag="HHV4tp2_gp09"
                     /function="role in nuclear localization of capsids and DNA
                     packaging"
                     /note="herpesvirus core gene UL32 family; ORF68"
                     /codon_start=1
                     /product="BFLF1"
                     /protein_id="YP_001129444.1"
                     /db_xref="GeneID:5176154"
                     /translation="MAHKVTSANEPNPLTGKRLSSCPLTRSGVTEVAQIAGRTPKMED
                     FVPWTVDNLKSQFEAVGLLMAHSYLPANAEEGIAYPPLVHTYESLSPASTCRVCDLLD
                     TLVNHSDAPVAFFEDYALLCYYCLNAPRAWISSLITGMDFLHILIKYFPMAGGLDSLF
                     MPSRILAIDIQLHFYICRCFLPVSSSDMIRNANLGYYKLEFLKSILTGQSPANFCFKS
                     MWPRTTPTFLTLPGPRTCKDSQDVPGDVGRGLYTALCCHLPTRNRVQHPFLRAEKGGL
                     SPKITTKADYCGLLLGTWQGTDLLGGPGHHAIGLNAEYSGDELAELALAITRPEAGDH
                     SQGPCLLAPMFGLRHKNASRTICPLCESLGAHPDAKDTLDRFKSLILDSFGNNIKILD
                     RIVFLIKTQNTLLDVPCPRLRAWLQMCTPQDFHKHLFCDPLCAINHSITNPSVLFGQI
                     YPPSFQAFKAALAAGQNLEQGVCDSLITLVYIFKSTQVARVGKTILVDVTKELDVVLR
                     IHGLDLVQSYQTSQVYV"
     misc_feature    complement(44779..46071)
                     /locus_tag="HHV4tp2_gp09"
                     /note="Herpesvirus putative major envelope glycoprotein;
                     Region: Herpes_env; cl28122"
                     /db_xref="CDD:332943"
     gene            46352..46759
                     /locus_tag="HHV4tp2_gp10"
                     /db_xref="GeneID:5176168"
     CDS             46352..46759
                     /locus_tag="HHV4tp2_gp10"
                     /function="role in DNA packaging"
                     /note="herpesvirus core gene UL33 family; ORF67A"
                     /codon_start=1
                     /product="BFRF1A"
                     /protein_id="YP_001129445.1"
                     /db_xref="GeneID:5176168"
                     /translation="MTHLGGKVRSSGFLIPGSAPVSGTPPQGQGGLASSRVYEDSGGS
                     LLSFSPMIHPNLAPLIAPSAYARLNLLNHCIFLEAFKEENSGQGLGGVQREVLFLKRD
                     IIKQVIARIVAADSTLDLVNHGEPGREAPRRAQ"
     misc_feature    46487..46708
                     /locus_tag="HHV4tp2_gp10"
                     /note="Herpesvirus UL33-like protein; Region: Herpes_UL33;
                     pfam03581"
                     /db_xref="CDD:281567"
     gene            46719..47729
                     /locus_tag="HHV4tp2_gp11"
                     /db_xref="GeneID:5176178"
     CDS             46719..47729
                     /locus_tag="HHV4tp2_gp11"
                     /function="capsid docking protein on nuclear lamina"
                     /function="role in egress of capsids from nucleus"
                     /note="herpesvirus core gene UL34 family; ORF67"
                     /codon_start=1
                     /product="BFRF1"
                     /protein_id="YP_001129446.1"
                     /db_xref="GeneID:5176178"
                     /translation="MASPEERLLDELNNLIVSFLCDSGSLEVERCSGAHVFSRGSSQP
                     LCTVKLRHGQIYHLEFVYKFLAFKLKNCNYPSSPVFVISNNGLATTLRCFLHEPSGLR
                     SGQSGPCLGLSTDVDLPKNSIIMLGQDDFIKFKSPLVFPAELDLLKSMVVCRAYITEH
                     RTTMQFLVFQAANAQKASRVMDMISDMSQQLSRSGQVEDTGARVTGGGGPRPGVTHSG
                     CLGDSHVRGRGGWDLDNFSEAETEDEASYAPWRDKDSWSESEAAPWKKELVRHPIRRH
                     RTRETRRMRGSHSRVEHVPPETRETVVGGAWRYSWRATPYLARVLAVTAVALLLMFLR
                     WT"
     misc_feature    46734..47306
                     /locus_tag="HHV4tp2_gp11"
                     /note="Herpesvirus virion protein U34; Region: Herpes_U34;
                     pfam04541"
                     /db_xref="CDD:282409"
     gene            47636..49411
                     /locus_tag="HHV4tp2_gp12"
                     /db_xref="GeneID:5176228"
     CDS             47636..49411
                     /locus_tag="HHV4tp2_gp12"
                     /note="related to HHV-5 UL49; ORF66"
                     /codon_start=1
                     /product="BFRF2"
                     /protein_id="YP_001129447.1"
                     /db_xref="GeneID:5176228"
                     /translation="MALFLARHTLSGTGAGCHGRGPAPDVSEVDLTLQALGERGFSRL
                     LDLGLACLDLSYVEMREFVVWGRPPASEAAVASTPGSLFRSHSSAYWLSEVERPGGLV
                     RWARSQTSPSSLTLAPHLGPSLLSLSVVTGGGCGAVAFCNAFFLAYFLVVRSVFPAFS
                     DRIAAWICAQSPFCENTRAVARGYRGLVKRFLAFVFERSSYDPPLLRQNSRPVERCFA
                     IKNYVPGLDSQSCVTVPSFSRWAQSHASELDPREIRDRVTPATAPSFVADHASALLAS
                     LQKKASDTPCGNPIQWMWYRLLVNSCLRSAHCLLPIPAVSEGGRKTGGGVGEDLVGAG
                     GPCLSRDVFVAIVSRNVLSCLLNVPAAGPRAYKCFRSHASRPVSGPDYPPLAVFCMDC
                     GYCLNFGKQTGVGGRLNSFRPTLQFYPRDQKEKHVLTCHASGRVYCSNCGSAAVGCQR
                     LAEPPSARSGWRPRIRAVLPHNAAYELDRGSRLLDAIIPCLGPDRTCMRPVVLRGVTV
                     RQLLYLTLRTEARAVCSICQQRQAPEDARDEPHLFSSCLEVELPPGERCAGCRLYQTR
                     YGTPAAQAHPPGEAGGGFSRQSPAS"
     misc_feature    48440..49219
                     /locus_tag="HHV4tp2_gp12"
                     /note="UL49 family; Region: Herpes_UL49_1; pfam03117"
                     /db_xref="CDD:281157"
     gene            49335..49865
                     /locus_tag="HHV4tp2_gp13"
                     /db_xref="GeneID:5176190"
     CDS             49335..49865
                     /locus_tag="HHV4tp2_gp13"
                     /note="small capsid protein on hexon tips; herpesvirus
                     core gene UL35 family; ORF65"
                     /codon_start=1
                     /product="BFRF3"
                     /protein_id="YP_001129448.1"
                     /db_xref="GeneID:5176190"
                     /translation="MARRLPKPTLQGRLEADFPDSPLLPKFQELNQNNLPNDVFREAQ
                     RSYLVFLTSQFCYEEYVQRTFGVPRRQRAIDKRQRASVAGAGAHAHLGGSSATPVQQA
                     QAAASAGTGALASSAPSTAVAQSATPSVSSSISSLRAATSGATAAASAAAAVDTGSGG
                     GGQPQDTAPRGARKKQ"
     misc_feature    49335..>49718
                     /locus_tag="HHV4tp2_gp13"
                     /note="Gammaherpesvirus capsid protein; Region:
                     Herpes_capsid; pfam06112"
                     /db_xref="CDD:399248"
     gene            complement(49906..59370)
                     /locus_tag="HHV4tp2_gp14"
                     /db_xref="GeneID:5176165"
     CDS             complement(49906..59370)
                     /locus_tag="HHV4tp2_gp14"
                     /note="large tegument protein; herpesvirus core gene UL36
                     family; ORF64"
                     /codon_start=1
                     /product="BPLF1"
                     /protein_id="YP_001129449.1"
                     /db_xref="GeneID:5176165"
                     /translation="MSNGDWGQSQRTRGTGPVRGIRTMDVNAPGGGSGGSALRILGTA
                     SCNQAHCKFGRFAGIQCVSNCVLYLVKSFLAGRPLTSRPELDEVLDEGARLDALMRQS
                     GILKGHEMAQLTDVPSSVVLRGGGRVHIYRSAEIFGLVLFPAQIANSAVVQSLAEVLH
                     GSYNGVAQFILYICDIYAGAIIIETDGSFYLFDPHCQKDAAPGTPAHVRVSTYAHDIL
                     QYVGAPGAQYTCVHLYFLPEAFETEDPRIFMLEHYGVYDFYEANGSGFDLVGPELVSS
                     DGEAAGTPGADSSPPVMLPFERRIIPYNLRPLPSRSFTSDSFPAARYSPAKTNSPPSS
                     PASAAPASAAPASAAPASAAPASAAPASAAPASAAPASAAPASAAPASSPPLFIPIPG
                     LGHTPGVPAPSTPPRASGGAAPQTPKRKKGLGKDSPHKKPTSGRRLPLSSTTDTEDDQ
                     LPRTHVPPHRPPSAARLPPPVIPIPHQSPPASPTPRPAPVSTIAPSVTPSPRLPLQIP
                     IPLPQAAPSNPEIPLTTPSPSPTAAAAPTATTLSPPPTQQQPPQSAAPAPSPPPTQQQ
                     PPQSAAPAPSPLLPQQQPPPSAARAPSPLPPQQQPLPSATPAPPHAQQLPPSATTLEP
                     EKNNPSAADRAGTEISPSPPFGQQPSFGDDASGGSGLVRYLSDLEEPFLSMSDSEEAE
                     SDLASDIPTTEDEDMFEDEVFSNSLESGSSAPTSPITLDTARSQYYQTTFDIETPEMD
                     FVPLESNIARIAGHTYQEQAIVYDPASNREVPEADALSMIDYLLVTVVLEQGLIRSRD
                     RSAVLNLLEFLKDWSGHLQVPTLDLEQLLTSELNIQNLANMLSENKGRAGEFHEHLAA
                     KLEACLPSLATKDAVRVDAGAKMLAEIPQLAESGDGKFDLEAARRRLTDLLSGGDQEG
                     EEGGGEPEDHSIYRGPHVDVPLVLDDESWKRLLSLAEAARTAVARQQAGVDEEDVRFL
                     ALLTAIEYGAPPAASVPPFVHNVPVRSKNAALHVRRCTADIRDKVASAASDYLSYLED
                     PSLPTVMDFDDLLTHLRHTCQIIASLPLLNIRYTSIEWDYRELLYLGTALSDMSGIPW
                     PLERVEEDDPSIAPLPEFETVAKKQKELETTRENEKRLRTILDDIEAMLGLAGVASAP
                     GAPISPASPSATPANHDNPEATPPLADTAALTIPVIEKYIANAGSIVGAAKNPTYIRL
                     RDTIQQIVRSKKYLMNILKSITFYTIDNYIASFEESIDHLYRDLPVLDPEVQDGIDRI
                     LDPMVSEALHTFEMGNRLTLEPARLVALQNFATHSTLKETAAAVNLLPGLLAVYDATV
                     TGQAPEDALRLLSGLQNQLSQTLIPGKLKKRFLSYLQKLKNNNNDQLRQKEVQAWRLE
                     AEGFKPATEEQLEAFLDTAPNKELKRQYEKKLRQLMETGRKEKEKLREQEDKERRERR
                     AREANEAWARIRKALGARPEPAPTSPDDWNTLLASLLPDNTDSAAAAAAAVARNTDIL
                     DSLTQILAAMLLGITRVRRERLRSLLVDDGGAAERMEAVEPGWFTEIETGPLARLDAW
                     PATPAATAKEGGGGRGAEEAAGALFRARTAADAIRSALAQTRQALQSPDMKSAVVNTD
                     LEAPYAEYERGLAGLLEKRRSAEAALTAIVSEYVDRTLPEATNDPGQANLPPPPTIPQ
                     ATAPPRLASDSALWPKKPQLLTRRERDDLLQATGDFFSELLTEAEAAEVRALEEQVRE
                     SQTLMAKAHEMAASTRRGFHTALEAVLSRSRDEAPDDELRSLLPSPPKAPVQAPLEAA
                     LARAAAGNGSWPYRKSLAAAKWIRGICEAVRGLSEGALALAGGVGAWLNLAAAADGEI
                     HELTRLLEVEGMAQNSMDGMEELRLALATLDPKRVAGGKETVADWKRRLSRLEAIIQE
                     AQEESQLQGTLQDLVTQARGHTDPRQLKIVVEAARGLALGASAGSQYALLKDKLLRYA
                     SAKQSFLAFYETAQPTVFVKHPLTNNLPLLITISAPPTGWGNGAPTRRAQFLAAAGPA
                     KYAGTLWLETESPCDPLNPAYVSADTQEPLNYIPVYHNFLEYVMPTVLENPEAFSLTP
                     AGRPQAIGPPQDDQERRRRTLASVASARLSAAAADSYWDTWPDVESNAGELLREYVSA
                     PKALMEDLADNPIVAMTLLAHASLIASRNHPPYPAPATDREVILLEQREMMALLVGTH
                     PAYAAAFLGAPSFYAGLGLVSALARDGGLGDLLSDSVLTYRLVRSPASGRGGMPSTTR
                     GSNDGEDARRLTRHRIAGPPTGFIFFQDAWEEMDTRAALWPHPEFLGLVHNQSTARAR
                     ACMLLLARRCFAPEALQQLWHSLRPLEGPVAFQDYLRDFVKQAYTRGEELPRAEGLEV
                     PRETPSSYGTVTGRALRNLMPYGTPITGPKRGSGDTIPVSVFEAAVAAAFLGRPLTLF
                     VSSQYLFNLKTLGQVRVVAPLLYCDGHSEPFRSLVETISLNFLQDLDGYSESFEPEMS
                     IFARQAVWLRELLTEARAAKPKEARPPTVAILANRKNIIWKCFTYRHNLPDVQFYFNA
                     AGASRWPTDVLNPSFYEHEDPPLPVGYQLPPNPRNVQELFSGFPPRVGHGLVSGDGFQ
                     SADNTPASSDRLQQLGGGETDQGEEGSTTAESEASGPPSPQSPLLEKVAPGRPRDWLS
                     PTSSPRDVTVTPGLAAPITLPGPRLMARPYFGAETRASESPDRSPGTSPRPWPKDSLE
                     LLPQPAPQQPPSSPWASEQGPIVYTLSPNSTPSTASGSQKKHTIQIPGLVPSQKPSYP
                     PSAPYKPGQSTGGIAPTPSAASLTTFGLQPQDTQASSQDPPYGHSIMQREKKQQGGRE
                     EAAEIRPSATRLPTAVGLRPRAPVVAAGAAASATPAFDPGEAPSGFPIPQAPALGSGL
                     AAPAHTPVGALAPRPQKTQAQRPQDAAALPTPTIKAVGARPVPKATGALAAGARPRGQ
                     PTAAPPSAASPPRVSLPVRSRQQQSPAIPLPPMHSGSEPGARPEVRLSQYRHAGPQTY
                     TVRKEAPPSAASQLPKMPKCKDSMYYPPSGSARYPAPFQALSFSQSVASPAPSSDQTT
                     LLWNTPSVVTQFLSIEDIIREVVTGGSTSGDLVVPSGSPSSLSTAAPEQDLRYSLTLS
                     QASRVLSRFVSQLRRKLERSTHRLIADLERLKFLYL"
     misc_feature    complement(58708..59238)
                     /locus_tag="HHV4tp2_gp14"
                     /note="Herpesvirus tegument protein, N-terminal conserved
                     region; Region: Herpes_teg_N; pfam04843"
                     /db_xref="CDD:282670"
     gene            complement(59363..63085)
                     /locus_tag="HHV4tp2_gp15"
                     /db_xref="GeneID:5176199"
     CDS             complement(59363..63085)
                     /locus_tag="HHV4tp2_gp15"
                     /note="tegument protein; herpesvirus core gene UL37
                     family; ORF63"
                     /codon_start=1
                     /product="BOLF1"
                     /protein_id="YP_001129450.1"
                     /db_xref="GeneID:5176199"
                     /translation="MASAMESDSGGGSGGADAQPPLAEVDGGLARVTRQLLLSGDDPA
                     ARLRALMPLELGIFGLGDLAQPVLVRDFLNTLTLMSGHAYPAAVLRHHAYYLLRAASF
                     SRRSFGLGHLEAALDVLASSLPPTTASPATDDPLDGSRLIAETRALAATYRRIIEEGS
                     GEVLAVSGPTATFAFVEELVADTYLARWDAFPREGLSFYAFNAAKTTLGRWLVTVYAE
                     TNRYPWAAAGQGQPTAADIKAMAVELVEHSGGGAGGGEGEESGGGGLFHRPESLSSVV
                     ASLPLARRRAVEILGVYAEASGGQTPPVAAVPVLAFDAARLRLLEPSGALFYDYVYEA
                     LLWDQTYGVPDSVIEAFLAGMAAEMEALAARVQEAAGSRASFSPAAIEQVATVLLSAG
                     LNETVAGDYAMMLASVPRVSRSRWRWLEATAALLESLSGFALHFFRLLPTASPTSRFA
                     RVARAAYLRAEAEAVDRRARRTSGPSTPAAAPAATAVGVGAAADPWDAVTPLRIFIVP
                     PPAAEYEQVAGDLSSELLRSLLWVRYSRLWQAPAPAPALPCKPPLLPGEQGRRQWTAA
                     VAAAPRTDVEAYCRSLRAGQTARADPAYVRSPFFPAAFIEFQIWPALRRVLSNELPKT
                     RSLAALRWLVSFGSDLALPSPELTRARRPLELIYATVWEIYDGAPPMPGESPQAVGLR
                     PLNLEGEGKAGDAGAEGAEDEEGGGPWGLSSHDAVLRIMDAVREVSGIISETISASER
                     AAEAPPLAWPTSLFSLLFTLRYSTTAESLGLATRRFLVSGETLSEDISRLTGAAWRLC
                     SRPLLYDAETGRVQIPLATEEEEEAVVAVKEKSVSSSPRHYSTDLQTLKSVVEGIQDV
                     CRDAAARWALATADTATLRRRLLVPALRESRGIADHPLWAHTSEPLRPDLEELNERVE
                     HALELGYSLTGALRRSVAYRFRDYTFARLFQPPAIDAERAEAIVRRDARPPPVFTPAP
                     RRLPQGGADTPPPLSMDDILYLGKSICKALVDVLDHHPAAPETTPIKTYTPAMDLNPE
                     QITVTPRSPSVLAAFARTARVQTHHLVPALTDDSPSPVGQTPPPFRILPAKKLAAILL
                     GNGRNASKRRASRDLSPPPHGRWRAVLDSSPFSFSSSDFSDQDEGEGGEADLRGVPGG
                     GGEGAYEEDRERPSDIDTAARAQKVETSCPRRRSPRTTPSPSRRASGGGGPDRGEAEA
                     HTYPPYLSAAAAASRVRPRTRRGATRRPPRPTAEDE"
     misc_feature    complement(59987..63001)
                     /locus_tag="HHV4tp2_gp15"
                     /note="Herpes virus tegument protein U30; Region:
                     Herpes_U30; pfam04523"
                     /db_xref="CDD:282392"
     gene            63084..64178
                     /locus_tag="HHV4tp2_gp16"
                     /db_xref="GeneID:5176167"
     CDS             63084..64178
                     /locus_tag="HHV4tp2_gp16"
                     /note="capsid triplex protein; Capsid triplex subunit 1;
                     the Herpesviridae are non-segmented dsDNA viruses with
                     genomes ranging from 120-230kbp; although herpes viruses
                     vary greatly in sequence identity and homology, they all
                     share four common elements: an envelope, a tegument which
                     is composed of viral enzymes, a capsid of 162 capsomers,
                     and a core composed of genomic DNA; herpesvirus capsomers
                     are linked in groups of three by distinctive structures
                     called triplexes that are heterotrimers formed by two
                     proteins, Capsid triplex subunit 1 and capsid triplex
                     subunit 2"
                     /codon_start=1
                     /product="Capsid triplex subunit 1"
                     /protein_id="YP_001129451.1"
                     /db_xref="GeneID:5176167"
                     /translation="MKVQGSVDRRRLQRRIAGLLPPPARRLNISRGSEFTRDVRGLVE
                     EHAQASSLSAAAVWRAGLLAPGEVAVAGGGSGGGSFSWSGWRPPVFGDFLIHASSFNN
                     AEATGTPLFQFKQSDPFSGVDAVFTPLSLFILMNHGRGVAARVEAGGGLTRMANLLYD
                     SPATLADLVPDFGRLVADRRFHNFITPVGPLVENIKSTYLNKITTVVHGPVVSKAIPR
                     STVKVTVPQEAFVDLDAWLSGGAGGGGGGCFVGGLGLQPCPADARLYVALTYEEAGPR
                     FTFFQSSRGHCQIMNILRIYYSPSIMHRYAVVQPLHIEELTFGAVACLGTFSATDGWR
                     RSAFNYRGSSLPVVEIDSFYSNVSDWEVIL"
     misc_feature    63084..64175
                     /locus_tag="HHV4tp2_gp16"
                     /note="Capsid triplex subunit 1; Provisional; Region:
                     PHA03263"
                     /db_xref="CDD:223028"
     gene            64253..66733
                     /locus_tag="HHV4tp2_gp17"
                     /db_xref="GeneID:5176186"
     CDS             64253..66733
                     /locus_tag="HHV4tp2_gp17"
                     /note="ribonucleotide reductase large subunit; herpesvirus
                     core gene UL39 family; ORF61"
                     /codon_start=1
                     /product="BORF2"
                     /protein_id="YP_001129452.1"
                     /db_xref="GeneID:5176186"
                     /translation="MATTSHVEHELLSKLIDELKVKANSDPEADVLAGRLLHRLKAES
                     VTHTVAEYLEVFSDKFYDEEFFQMHRDELETRVSAFAQSPAYERIVSSGYLSALRYYD
                     TYLYVGRSGKQESVQHFYMRLAGFCASTTCLYAGLRAALQRARPEIESDMEVFDYYFE
                     HLTSQTVCCSTPFMRFAGVENSTLASCILTTPDLSSEWDVTQALYRHLGRYLFQRAGV
                     GVGVTGAGQDGKHISLLMRMINSHVEYHNYGCKRPVSVAAYMEPWHSQIFKFLETKLP
                     ENHERCPGIFTGLFVPELFFKLFRDTPWSDWYLFDPKDAGDLERLYGEEFEREYYRLV
                     TAGKFCGRVSIKSLMFSIVNCAVKAGSPFILLKEACNAHFWRDLQGEAMNAANLCAEV
                     LQPSRKSVATCNLANICLPRCLVNAPLAVRAQRADTQGDELLLALPRLSVTLPGEGAV
                     GDGFSLARLRDATQCATFVVACSILQGSPTYDSRDMASMGLGVQGLADVFADLGWQYT
                     DPPSRSLNKEIFEHMYFTALCTSSLIGLHTRKIFPGFKQSKYAGGWFHWHDWAGTDLS
                     IPREIWSRLSERIVRDGLFNSQFIALMPTSGCAQVTGCSDAFYPFYANASTKVTNKEE
                     ALRPNRSFWRHVRLDDREALNLVGGRVSCLPEALRQRYLRFQTAFDYNQEDLIQMSRD
                     RAPFVDQSQSHSLFLREEDAARASTLANLLVRSYELGLKTIMYYCRIEKAADLGVMEC
                     KASAALSVPREEQNERSPAEQMPPRPMEPAQVAGPVDIMSKGPGEGPGGWCVPGGLEV
                     CYKYRQLFSEDDLLETDGFTERACESCQ"
     misc_feature    64583..66442
                     /locus_tag="HHV4tp2_gp17"
                     /note="Ribonucleotide reductase and Pyruvate formate
                     lyase; Region: RNR_PFL; cl38938"
                     /db_xref="CDD:422965"
     misc_feature    order(64763..64768,64808..64813,65411..65413,65417..65419,
                     65423..65425,65465..65467,66029..66046)
                     /locus_tag="HHV4tp2_gp17"
                     /note="active site"
                     /db_xref="CDD:153083"
     misc_feature    order(64811..64813,65411..65413,65417..65419,65423..65425,
                     65459..65461,66425..66430)
                     /locus_tag="HHV4tp2_gp17"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:153083"
     misc_feature    order(65129..65131,65138..65143,65279..65281,65285..65290,
                     65300..65302,65321..65323,66362..66370,66374..66379,
                     66389..66394,66398..66403)
                     /locus_tag="HHV4tp2_gp17"
                     /note="R2 peptide binding site [active]"
                     /db_xref="CDD:153083"
     gene            66746..67654
                     /locus_tag="HHV4tp2_gp18"
                     /db_xref="GeneID:5176181"
     CDS             66746..67654
                     /locus_tag="HHV4tp2_gp18"
                     /note="ribonucleotide reductase small subunit; herpesvirus
                     core gene UL40 family; ORF60"
                     /codon_start=1
                     /product="BaRF1"
                     /protein_id="YP_001129453.1"
                     /db_xref="GeneID:5176181"
                     /translation="MSKLLYVRDHEGFACLTVETHRNRWFAAHIVLTKDCGCLKLLNE
                     RDLEFYKFLFTFLAMAEKLVNFNIDELVTSFESHDIDHYYTEQKAMENVHGETYANIL
                     NMLFDGDRAAMNAYAEAIMADEALQAKISWLRDKVAAAVTLPEKILVFLLIEGIFFIS
                     SFYSIALLRVRGLMPGICLANNYISRDELLHTRAASLLYNSMTAKADRPRATWIQELF
                     RTAVEVETAFIEARGEGVTLVDVRAIKQFLEATADRILGDIGQAPLYGTPPPKDCPLT
                     YMTSIKQTNFFEQESSDYTMLVVDDL"
     misc_feature    66812..67549
                     /locus_tag="HHV4tp2_gp18"
                     /note="Ribonucleotide reductase, small chain; Region:
                     Ribonuc_red_sm; pfam00268"
                     /db_xref="CDD:395206"
     misc_feature    order(66926..66928,67016..67018,67025..67027,67205..67207,
                     67307..67309,67316..67318)
                     /locus_tag="HHV4tp2_gp18"
                     /note="dinuclear metal binding motif [ion binding]; other
                     site"
                     /db_xref="CDD:153108"
     gene            67745..68959
                     /locus_tag="HHV4tp2_gp19"
                     /db_xref="GeneID:5176169"
     CDS             67745..68959
                     /locus_tag="HHV4tp2_gp19"
                     /note="DNA polymerase processivity subunit; early antigen
                     D; herpesvirus core gene UL42 family; ORF59"
                     /codon_start=1
                     /product="BMRF1"
                     /protein_id="YP_001129454.1"
                     /db_xref="GeneID:5176169"
                     /translation="METTQTLRFKTKALAVLSKCYDHAQTHLKGGVLQVNLLSVNYGG
                     PRLAAVANAGTAGLISFEVSPDAVAEWQNHQSPEEAPAAVSFRNLAYGRTCVLGKELF
                     GSAVEQASLQFYKRPQGGSRPEFVKLTMEYDDKVSKSHHTCALMPYMPPASDRLRNEQ
                     MIGQVLLMPKTASSLQKWARQQGSGGVKVTLNPDLYVTTYTSGEACLTLDYKPLSVGP
                     YEAFTGPVAKAQDVGAVEAHVVCSVAADSLAAALSLCRIPAVSVPILRFYRSGIIAVV
                     AGLLTSAGDLPLDLSVILFNHASEEAAASTASEPEDKSPRVQPLGTGLQQRPRHTVSP
                     SPSPPPPPRTPTWESPARPETPSPAIPSHSSNTALERPLAVQLARKRTSSEARQKQKH
                     PKKVKQAFNPLI"
     misc_feature    67754..68956
                     /locus_tag="HHV4tp2_gp19"
                     /note="Herpes DNA replication accessory factor; Region:
                     Herpes_DNAp_acc; pfam04929"
                     /db_xref="CDD:282746"
     gene            68964..70037
                     /locus_tag="HHV4tp2_gp20"
                     /db_xref="GeneID:5176179"
     CDS             68964..70037
                     /locus_tag="HHV4tp2_gp20"
                     /note="probable counterpart of HHV-1 UL43; multiple
                     transmembrane protein; ORF58"
                     /codon_start=1
                     /product="BMRF2"
                     /protein_id="YP_001129455.1"
                     /db_xref="GeneID:5176179"
                     /translation="MFSCKQHLSLGACVFCLGLLASTPFIWCFVFANLLSLEIFSPWQ
                     THVYRLGFPTACLMAVLWTLVPAKHAVRAVTPAIMLNIASALIFFSLRVYSTSTWVSA
                     PCLFLANLPLLCLWPRLAIEIVYICPAIHQRFFELGLLLACTIFALSVVSRALEVSAV
                     FMSPFFIFLALGSGSLAGARRNQIYTSGLERRRSIFCARGDHSVASLKETLHKCPWDL
                     LAISALTVLVVCVMIVLHVHAEVFFGLSRYLPLFLCGAMASGGLYLGHSSIIACVMAT
                     LCTLSSVVVYFLHETLGPLGKTVLFISIFVYYFSGVAALSAAMRYKLKKFVNGPLVHL
                     RVVYMCCFVFTFCEYLLVTFIKS"
     misc_feature    68991..70028
                     /locus_tag="HHV4tp2_gp20"
                     /note="Herpesvirus BMRF2 protein; Region: Herpes_BMRF2;
                     pfam04633"
                     /db_xref="CDD:282486"
     gene            complement(70589..72134)
                     /locus_tag="HHV4tp2_gp21"
                     /db_xref="GeneID:5176227"
     CDS             complement(join(70589..71967,72074..72134))
                     /locus_tag="HHV4tp2_gp21"
                     /function="post-transcriptional regulator"
                     /note="herpesvirus core gene UL54 family; ORF57"
                     /codon_start=1
                     /product="BSLF2/BMLF1"
                     /protein_id="YP_001129456.1"
                     /db_xref="GeneID:5176227"
                     /translation="MVPSQRLSRTSSISSNEDPAESHILELEAVSDTNTDCDMDPMEG
                     SEEHSTDGEISSSEEEDEDPTPAHTIPARPSSVVITPTSASFVIPRKKWDLQDKTVTL
                     HRSPLCRDEDEKEETGNSSYTRGHKRRRGEVHGCTDESYGKRRHLPPGARAPRAPRAP
                     RVPRAPRSPRAPRSNRATRGPRSESRGAGRSTRKQARQERSQRPLPNKPWFDMSLVKP
                     VSKITFVTLPSPLASLTLEPIQDPFLQSMLAVAAHPEIGAWQKVQPRHELRRSYKTLR
                     EFFTKSTNKDTWLDARMQAIQNAGLCTLVAMLEETIFWLQEITYHGDLPLAPAEDILL
                     ACAMSLSKVILTKLKELAPCFLPNTRDYNFVKQLFYITCATARQNKVVETLSSSYVKQ
                     PLCLLAAYAAVAPAYINANCRRRHDEVEFLGHYIKNYNPGTLSSLLTEAVETHTRDCR
                     SASCSRLVRAILSPGTGSLGLFFVPGLNQ"
     misc_feature    complement(70604..71257)
                     /locus_tag="HHV4tp2_gp21"
                     /note="Herpesvirus transcriptional regulator family;
                     Region: Herpes_UL69; pfam05459"
                     /db_xref="CDD:310217"
     gene            complement(72103..74727)
                     /locus_tag="HHV4tp2_gp22"
                     /db_xref="GeneID:5176218"
     CDS             complement(72103..74727)
                     /locus_tag="HHV4tp2_gp22"
                     /note="primase subunit of helicase-primase complex;
                     helicase-primase primase subunit; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; the lytic replication of
                     herpesvirus genomes involves several proteins; three of
                     these proteins form a tripartite helicase-primase complex
                     consisting of the helicase BBLF4, the primase BSLF1, and
                     the linker protein BBLF2/3"
                     /codon_start=1
                     /product="helicase-primase primase subunit BSLF1"
                     /protein_id="YP_001129457.1"
                     /db_xref="GeneID:5176218"
                     /translation="MSAPVVIKALVASNTDIAEAILDAILSRPDEGFRLFCLCHNASP
                     LHHVAGSLVELQLHLPKKRLTSQSRCGLVLTLHLPAEEAFPFLRGLTPLTADRLSTYL
                     DRAGALRSLTPLVELLTLSAKKQPQGDARGRVAWLRPKIVGCLRRIYRVNISARWFIS
                     TFGSHEAQFVLVTAAYYFWGIPCTIETLAHLTELFTSESGQSLAAVTSLAELGEVFGS
                     SAWAEQTEAFAHFAHEKLRRDSREIRAVARTIDAYRGRLPLASADLVRYVYLAHAQCF
                     NEGTFKRYSQLTSVGEIGCLPSGGVVLPSLLDRGFAEHMRTYFTRETYLAEHVRVQQL
                     KIRMEPPAPYTWDPDPDDGLMRAWAGLSVDVARELVELARWHADEGPTYPPTLQGFLC
                     LAGQATCRGQWNPKEQFLPPTVLRRVQRLPVFLCHFADRHYFVMTAADPFSSHLAEVV
                     STPTNCRLPDTCLTRALSYTPVYYSQNSLSEQLFVSRHEYFNPRLPVCNLVLDLDLKI
                     KGAPWSLEEIYDLCRTVRREVLRLMRRLGPVSRAHPVYFFKSACPPADPDNMEDVLPF
                     CICTGKLGFRVITPLPRGHAIVGTSAVQGFVSVLQKLMGLTACLRRMRHKIKEIGAPL
                     FDSGVYHAGRCIRLPHTYKVDRGGGLSRQLRLFVCHPEEEDKHSYVKNALNIQNLLHH
                     SLHVGWPAPKTFCYHIADDGRDYLIQRTRETLPPTVENVCAMIEGHLGLDLVAWVSSC
                     IWPSLMSTLATAVPEDKFPQFLHVTFEQTGPNLVQVCHARGRNFACLRHTHRASSKNV
                     RVFLVLYYTSQAITVTFMSQCFAGRCGANQPTAHFSISVPASRIINRAEASQDSTTSQ
                     LARRRDRQDGSFSETLPN"
     misc_feature    complement(72202..74727)
                     /locus_tag="HHV4tp2_gp22"
                     /note="helicase-primase primase subunit BSLF1;
                     Provisional; Region: PHA03142"
                     /db_xref="CDD:222999"
     gene            74770..75426
                     /locus_tag="HHV4tp2_gp23"
                     /db_xref="GeneID:5176173"
     CDS             74770..75426
                     /locus_tag="HHV4tp2_gp23"
                     /note="tegument protein; herpesvirus core gene UL51
                     family; ORF55"
                     /codon_start=1
                     /product="BSRF1"
                     /protein_id="YP_001129458.1"
                     /db_xref="GeneID:5176173"
                     /translation="MAFYLPDWSCCGLWLFGRPRNRYSQLPEEPETFECPDRWRAEID
                     LGLPPGVQVGDLLRNEQTMGSLRQVYLLAVQANSITDHLKRFDAVRVPESCRGVVEAQ
                     VAKLEAVRSVIWNTMISLAVSGIEMDENGLKALLDKQAGDSLALMEMEKVATALKMDE
                     TGAWAQEISAVVSSVTAPSASAPFINSAFEPEVPTPVLAPPPVVRQPEHSGPTELALT
                     "
     misc_feature    74770..75378
                     /locus_tag="HHV4tp2_gp23"
                     /note="Herpes virus U44 protein; Region: Herpes_U44;
                     cl28003"
                     /db_xref="CDD:332824"
     gene            complement(75484..76320)
                     /locus_tag="HHV4tp2_gp24"
                     /db_xref="GeneID:5176172"
     CDS             complement(75484..76320)
                     /locus_tag="HHV4tp2_gp24"
                     /note="deoxyuridine triphosphatase; dUTPase; the
                     Herpesviridae are non-segmented dsDNA viruses with genomes
                     ranging from 120-230kbp; although herpes viruses vary
                     greatly in sequence identity and homology, they all share
                     four common elements: an envelope, a tegument which is
                     composed of viral enzymes, a capsid of 162 capsomers, and
                     a core composed of genomic DNA; viral dUTPases hydrolyze
                     dUTP to dUMP and pyrophosphate thereby minimizing the
                     misincorporation of uracil into viral DNA"
                     /codon_start=1
                     /product="dUTPase"
                     /protein_id="YP_001129459.1"
                     /db_xref="GeneID:5176172"
                     /translation="MEACPHIRYAFQNDKLLLQQASVGRLTLVNKTTILLRPMKTTTV
                     DLGLYARPPEGHGLMLWGSTSRPVTSHVGIIDPGYTGELRLILQNQRRYNSTLRPSEL
                     KIHLAAFRYATPQMEEDKGPINHPQYPGDVGLDVSLPKDLALFPHQTVSVTLTVPPPS
                     IPHHRPTIFGRSGLAMQGILVKPCRWRRGGVDVSLTNFSDQTVFLNKYRRFCQLVYLH
                     KHHLTSFYSPHSDAGVLGPRSLFRWASCAFEEVPGLAMGDSGLSEALEGRQGRGFGSS
                     GQ"
     misc_feature    complement(75487..76320)
                     /locus_tag="HHV4tp2_gp24"
                     /note="dUTPase; Provisional; Region: PHA03131"
                     /db_xref="CDD:222996"
     gene            76393..76701
                     /locus_tag="HHV4tp2_gp25"
                     /db_xref="GeneID:5176229"
     CDS             76393..76701
                     /locus_tag="HHV4tp2_gp25"
                     /note="envelope glycoprotein gN; herpesvirus core gene
                     UL49A family; ORF53"
                     /codon_start=1
                     /product="BLRF1"
                     /protein_id="YP_001129460.1"
                     /db_xref="GeneID:5176229"
                     /translation="MGKVLRKPFAKAVPLLFLAATWLLTGVLPAGASSPTNAAAASLT
                     EAQDQFYSYTCNADTFSPSLTSFASIWALLTLVLVIIASAIYLMYVCFNKFVNTLLTD
                     "
     misc_feature    76486..76692
                     /locus_tag="HHV4tp2_gp25"
                     /note="UL73 viral envelope glycoprotein; Region:
                     Herpes_UL73; pfam03554"
                     /db_xref="CDD:281543"
     gene            76771..77259
                     /locus_tag="HHV4tp2_gp26"
                     /db_xref="GeneID:5176224"
     CDS             76771..77259
                     /locus_tag="HHV4tp2_gp26"
                     /note="ORF52"
                     /codon_start=1
                     /product="BLRF2"
                     /protein_id="YP_001129461.1"
                     /db_xref="GeneID:5176224"
                     /translation="MSAPRKVRLPSVKAVDMSMEDMAARLARLESENKALKQQVLRGG
                     ACASSTSVPSAPVPPPEPLTARQREVMITQATGRLASQAMKKIEDKVRKSVDGVTTRN
                     EMENILQNLTLRIQVSMLGAKGQPSPGEGTRPRESNDPNATRRARSRSRGREAKKVQI
                     SD"
     misc_feature    76816..77169
                     /locus_tag="HHV4tp2_gp26"
                     /note="Herpesvirus BLRF2 protein; Region: Herpes_BLRF2;
                     cl27945"
                     /db_xref="CDD:332766"
     gene            complement(77276..79936)
                     /locus_tag="HHV4tp2_gp27"
                     /db_xref="GeneID:5176231"
     CDS             complement(77276..79936)
                     /locus_tag="HHV4tp2_gp27"
                     /function="binds to CD21"
                     /function="role in entry"
                     /note="envelope glycoprotein gp350; K8.1; ORF51"
                     /codon_start=1
                     /product="BLLF1"
                     /protein_id="YP_001129462.1"
                     /db_xref="GeneID:5176231"
                     /translation="MEAALLVCQYTIQSLIQLTRDDPGFFNVEILEFPFYPACNVCTA
                     DVNATINFDVGGKKHKLNLDFGLLTPHTKAVYQPRGAFGGSENATNLFLLELLGAGEL
                     ALTMRSKKLPINITTGEEQQVSLESVDVYFQDVFGTMWCHHAEMQNPVYLIPETVPYI
                     KWDNCNSTNITAVVRAQGLDVTLPLSLPTSAQDSNFSVKTEMLGNEIDIECIMEDGEI
                     SQVLPGDNKFNITCSGYESHVPSGGILTSTSPVATPIPGTGYAYSLRLTPRPVSRFLG
                     NNSILYVFYSGNGPKASGGDYCIQSNIVFSDEIPASQDMPTNTTDITYVGDNATYSVP
                     MVTSEDANSPNVTVTAFWAWPNNTETDFKCKWTLTSGTPSGCENISGAFASNRTFDIT
                     VSGLGTAPKTLIITRTATNATTTTHKVIFSKAPESTTTSPTLNTTGFAAPNTTTGLPS
                     STHVPTNLTAPASTGPTVSTADVTSPTPAGTTSGASPVTPSPSPRDNGTESKAPDMTS
                     PTSAVTTPTPNATSPTPAVTTPTPNATSPTLGKTSPTSAVTTPTPNATSPTPAVTTPT
                     PNATIPTLGKTSPTSAVTTPTPNATSPTVGETSPQANTTNHTLGGTSSTPVVTSPPKN
                     ATSAVTTGQHNITSSSTSSMSLRPSSISETLSPSTSDNSTSHMPLLTSAHPTGGENIT
                     QVTPASTSTHHVSTSSPAPRPGTTSQASGPGNSSTSTKPGEVNVTKGTPPKNATSPQA
                     PSGQKTAVPTVTSTGGKANSTTGGKHTTGHGARTSTEPTTDYGGDSTTPRTRYNATTY
                     LPPSTSSKLRPRWTFTSPPVTTAQATVPVPPTSQPRFSNLSMLVLQWASLAVLTLLLL
                     LVMADCAFRRNLSTSHTYTTPPYDDAETYV"
     misc_feature    complement(77279..79936)
                     /locus_tag="HHV4tp2_gp27"
                     /note="Herpes virus major outer envelope glycoprotein
                     (BLLF1); Region: Herpes_BLLF1; cl25496"
                     /db_xref="CDD:330317"
     misc_feature    complement(77413..77859)
                     /locus_tag="HHV4tp2_gp27"
                     /note="corresponds to BLLF2 in NC_007605; unlikely to
                     encode a functional protein"
     gene            80026..82888
                     /locus_tag="HHV4tp2_gp28"
                     /db_xref="GeneID:5176209"
     CDS             join(80026..80361,80447..82888)
                     /locus_tag="HHV4tp2_gp28"
                     /note="latency protein; EBNA-3A; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; EBNA-3C, EBNA-1, EBNA-2, and
                     EBNA-3A are essential for virus-induced transformation and
                     latency in B cells"
                     /codon_start=1
                     /product="EBNA-3A"
                     /protein_id="YP_001129463.1"
                     /db_xref="GeneID:5176209"
                     /translation="MDKDRPGLPAPDDNIEEVPSTSGVQERASEGDWENVLIEISDSS
                     SEEEAEDAHLEPSQRGKKRKRVDDDAGGSAPAQHVPPPQLDHPGREAILYRFPLDLRR
                     FIQAIGAAATHPDTRAIDQFFGSQISNTDLYVMYAMAIRQAIRDRRRNPASRRSQVKW
                     RMTTLAAGWPMGYQAYSSWMYSYTDPQVTATIIHLQATLGCASGRRCHVTFSAGTFRP
                     PRCSPGDRQWLYVQSRVGDLVQSSNPCYSIFFDYMAIHRSLTKIWDEVVTPDQRVTFM
                     EFLGFLQRTELVYIKSFVSYALGTTSIETPWMDENPSTETAQAWNAGLLRGRAYGQDL
                     LRTEGEHGEGATCETREESEDTESDGDDEELPRVVSRDGTKHRRPPIFLRRLHRLLLM
                     RAGKGKERARETLAKAPRRTYGTPRPPVQKPRPEVPQSYETATSHGSAQVPEPPPTHP
                     LHQQHSMAPCMVAQNPRAPLGDQLPGVPKDGRGACAPVPALAGPIVRPWESSLLQSPG
                     RAFAPVSPQPMPVEPVPVPTVALERPVCPAPPEIAMQGPGEPSGIKRTRERWRPAPWT
                     PNPPRSPSQMSVRDRLARLRAEAQARQASVEVQPTQLTQVSPQQPMERPLEPEQQMFP
                     GSPFSQVADVARESGVPAMQPQYFDLPLTQPISQGAPAAPLRASMGPVPPVPATQPQY
                     FDIPLTEPINQGASAAHFLPQQPMEGPLVPERWMFQGATLSQSVRPGVAQSQYFDLPL
                     TQPINHGAPAAHFLHQPPMEGPWVPEQWMFQGAPPSQGTDVVQHQLDDLGYPLHDLNH
                     PGVPVSPAVNQYHFSQAAFGLPIDEDESGERSDTSEPYEALDLSIHGRPCPQAPEWPV
                     QGEGGQDATEVLDLSIHGRPRPRTPEWPVQGESGQNVTDHEPRRVVVSAIVHMCQDDE
                     FPDLQDPPDEA"
     misc_feature    join(80026..80361,80447..82885)
                     /locus_tag="HHV4tp2_gp28"
                     /note="EBNA-3A; Provisional; Region: PHA03379"
                     /db_xref="CDD:223066"
     gene            83074..86532
                     /locus_tag="HHV4tp2_gp29"
                     /db_xref="GeneID:5176219"
     CDS             join(83074..83430,83509..86532)
                     /locus_tag="HHV4tp2_gp29"
                     /note="latency protein; EBNA-3B; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; EBNA-3C, EBNA-1, EBNA-2, and
                     EBNA-3A are essential for virus-induced transformation and
                     latency in B cells"
                     /codon_start=1
                     /product="EBNA-3B"
                     /protein_id="YP_001129464.1"
                     /db_xref="GeneID:5176219"
                     /translation="MKKAWLSRAQQADAGGASGSEDPPDYGDQGNVQQVGSDPISPAI
                     GPFELSAASEDDPQSGPVEENLDAAAREEEEPDEQEHNGGDDPLEVHTRQPRFVDVNP
                     TQAPVIQLVHAVYDSMLQSDLRSLGSLFLEQNLNIEEFIWMCMTVRHRCQAIRQKPLP
                     IDKQRRWKLLSPYRTWRMGYRTQTLNVNSFETGGDKVHPLLVTATLGCEEGLRHAITY
                     SAGIVQLPRMSDQNQKIETAFLMARRARSLSAERYTLFFDLVSSGNTLYAIWIGLGTR
                     NRVAFVEFVGWLCKKDHTHIREWFRQCTGRPSPSKPWMRAHPVAVPYDDPLTSEETDL
                     AYARGLAMSIEAARLPDDPIIVEDDDESEEIEDKCDKDEEESGTEDVTSIPQTLPHSP
                     TVYGRPSVFYRKPDTKSTKKCRAIVTDLSIIKVIEDEHRKKKTARTEQPRAKPDSPAP
                     TVVLRRPPTQKVTGPAGSLSVQAQLEPWQPLSWPHETRVILHGPPTQGDQAHGSMLDL
                     LEKDDQHMEQQVMATLLPPEPHQPRSGRRAPCVYTADLDIESDEPATSEPVLDQLLPA
                     PGLGPLAIQPLTSPTTSQLRSSAPSHAQTPWPVTHPSQTPGGPTTQSLAPETEAPRQW
                     PMPLRPIPLHPLRMQPISFNPAVRPTPHQPPQVEPTFYQSTWVKPPQQYQPQMGHIPY
                     QPRPTGHSTMLRPQWAPTTMQPPPRAPTPMPPPQGPPTAMQRPQGAPTPMPPPQGTPT
                     AMQRPQGAPTPMPPPQGTPTAMQRPQGAPTPMPPPQGTPTAIQRPQGAPTPMPPPQGT
                     PTAMQRPQGAPTPMPPPQGTPTAMQRPQGAPTPMPPPQGPPTAMQRPRGAPTPMPPPQ
                     GPPTAMQRPQGAPTPMPPPQGPPTAMQRPRGAPTPMPPPQGPPTAMQRPQGAPTPMPP
                     PQGPPTAMQRPRGAPTPMPPPQGPPTAMQLSPRALTGQKGPAKHILRQLLTGGVKSGR
                     PSLKFKAALERQAAAGLRPSPGSGTGAKIVQAPVFYPPVLQPIQVMWQVGSSKAVAAS
                     TVTQAPTEYTGERRLGGPMSPTDIPPSKRVKKKAYPERKTPHGGPSHSSTVMWENVSQ
                     GQQQTLECGGTDKQERNMLGMGDIAVSSPSSSETSNDE"
     misc_feature    join(83074..83430,83509..86529)
                     /locus_tag="HHV4tp2_gp29"
                     /note="EBNA-3B; Provisional; Region: PHA03378"
                     /db_xref="CDD:223065"
     gene            86654..89937
                     /locus_tag="HHV4tp2_gp30"
                     /db_xref="GeneID:5176150"
     CDS             join(86654..87013,87088..89937)
                     /locus_tag="HHV4tp2_gp30"
                     /note="latency protein; EBNA-3C; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; EBNA-3C, EBNA-1, EBNA-2, and
                     EBNA-3A are essential for virus-induced transformation and
                     latency in B cells"
                     /codon_start=1
                     /product="EBNA-3C"
                     /protein_id="YP_001129465.1"
                     /db_xref="GeneID:5176150"
                     /translation="MESFEGEGDSIQSPDNARGDDVQNTGEHIQDPGPGPSTGGASEG
                     LVQNEPDSRDQQSRGQRRGDENRGWMQRIRRRRRRRAALSGHLLDMEDNVPPWFPPHD
                     ITPYVARNIRDAACQAVKHSHLQALSNLILDSGLDTQHLLCFVMAARQRLQDIRRGPL
                     VVEGGVGWRHWLLTSPSRSWSMGYRTATLRTLTPVPNRVGADSIMLTATFGCQNGALA
                     INTFSATVWIPPPAGPREQERYAREAEVRFLRGKWQRRFRRIFDLIELCGSLHHVWQN
                     MLQTEENLLDFVRFMGVMSSCNSSSVNYWFHKTIGNFKPYYPWNAPPNENPYHARRGI
                     KEQVIQKAFLKAQRQGLSMLATGGGPRGDATSETSSDEDTGRQGSDVELESSDDELPY
                     IDPNMEPVQQRPVMFVSRVPVRKPRTLPWPTPKTHPVKRTIVKTSYRSDEAEEAQSTP
                     ERPGPSKQPSEPVEPAHTTPAGRSTVILHEPPREPEAVSFKPPPPPSRRRRGACVVYD
                     DDIIEVIDVETTEEETTSMQRQPPLGQQPPPPVISTGSAMSSSHTDPSVTQPSKPHRK
                     PQDGFQRSGRRQKRAMPPPVSPSDAGPPSTRPRVMAPPSTGPRVMATPSTGPRDMAPP
                     STGPRDMAPPSTGPRDMAPPSTGPRDMAPTVVHMFTRERLLTQSTGPAPRSFWEMRAG
                     RDAPKIQQEPSSQQQPATQSTPPCQSWVPSVYVLPAVDAGNAQPLQISHLSSMSPTQP
                     ISHEEQPRYEDPDTPLDLSLHPDTATLPPTQDLYPGREDLQATQAPYPGYEEPRPPQA
                     PFVGDYGFVQIPSAQWEPHPSQGTYQGHIDPQLPAALDLGPEQPRFPQDPYVYSGGQL
                     SSCPGYAGPWPSRPQHPRYRHTLALWPREPRHGHSQGPWKPWSAHLPPQWDGSAGHGQ
                     DQVSQFPHLHSETGPPRLQLSSVPQVLYPQPLVSSSAPSWSSPQPRAPIRPIPTRFPP
                     PPMPLQDSMAVGCDSSGTACPSMPFASDYSQGAFTPLDINAPTPKSPRVEESSHGPAR
                     CSQATSEAQEILSDNSEISVFPKDAKQTDYDASTESELD"
     misc_feature    join(86654..87013,87088..89934)
                     /locus_tag="HHV4tp2_gp30"
                     /note="EBNA-3C; Provisional; Region: PHA03377"
                     /db_xref="CDD:177614"
     gene            complement(89959..90630)
                     /locus_tag="HHV4tp2_gp31"
                     /db_xref="GeneID:5176170"
     CDS             complement(89959..90630)
                     /locus_tag="HHV4tp2_gp31"
                     /function="binds MHC II"
                     /function="role in entry"
                     /note="envelope glycoprotein gp42; contains C-type lectin
                     domain"
                     /codon_start=1
                     /product="BZLF2"
                     /protein_id="YP_001129466.1"
                     /db_xref="GeneID:5176170"
                     /translation="MVSFKQVRVPLFTAIALVIVLLLAYFLPPRVRGGGRVSAAAITW
                     VPKPNVEVWPVDPPPPVNFNKTAEQEYGDKEIKLPHWTPTLHTFQVPKNYTKANCTYC
                     NTREYTFSYKERCFYFTKKKHTWNGCFQACAELYPCTYFYGPTPDILPVVTRNLNAIE
                     SLWVGVYRVGEGNWTSLDGGTFKVYQIFGSHCTYVSKFSTVPVSHHECSFLKPCLCVS
                     QRSNS"
     misc_feature    complement(89983..90306)
                     /locus_tag="HHV4tp2_gp31"
                     /note="C-type lectin (CTL)/C-type lectin-like (CTLD)
                     domain; Region: CLECT; cl02432"
                     /db_xref="CDD:413318"
     misc_feature    complement(order(90016..90021,90034..90036,90073..90075,
                     90208..90210))
                     /locus_tag="HHV4tp2_gp31"
                     /note="ligand binding surface [chemical binding]; other
                     site"
                     /db_xref="CDD:153057"
     gene            complement(90724..91697)
                     /locus_tag="HHV4tp2_gp32"
                     /db_xref="GeneID:5176210"
     CDS             complement(join(90724..90855,90941..91045,91197..91697))
                     /locus_tag="HHV4tp2_gp32"
                     /function="induces switch from latent to lytic infection"
                     /note="bZIP transcription factor; EB1; K8; Zta"
                     /codon_start=1
                     /product="BZLF1"
                     /protein_id="YP_001129467.1"
                     /db_xref="GeneID:5176210"
                     /translation="MMDPNSTSEDVKFTPDPYQVPFVQAFDQATRVYQDLGGPSQAPL
                     PCVLWPVLPEPLPQGQLTAYHVSAAPTGSWFPAPQPAPENAYQAYAAPQLFPVSDITQ
                     NQQTNQAGGEAPQPGDNSTVQPAAAVVFACPGANQGQQLADIGAPQPAPAAAPARRTR
                     KPLQPESLEECDSELDIKRYKNRVASRKCRAKFKHLLQHYREVASAKSSENDRLRLLL
                     KQMCPSLDVDSIIPRTPDVLHEDLLNF"
     misc_feature    complement(join(90784..90855,90941..91024))
                     /locus_tag="HHV4tp2_gp32"
                     /note="Basic leucine zipper (bZIP) domain of blue light
                     (BL) receptor aureochrome (AUREO) and similar bZIP
                     domains; Region: bZIP_AUREO-like; cd14809"
                     /db_xref="CDD:269871"
     misc_feature    complement(join(90784..90855,90941..91024))
                     /locus_tag="HHV4tp2_gp32"
                     /note="coiled coil [structural motif]; Region: coiled
                     coil"
                     /db_xref="CDD:269871"
     misc_feature    complement(order(90965..90973,90977..90994,90998..91006,
                     91010..91015))
                     /locus_tag="HHV4tp2_gp32"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:269871"
     misc_feature    complement(order(90787..90792,90796..90801,90808..90813,
                     90817..90822,90829..90834,90838..90843,90850..90855,
                     90944..90949,90956..90961,90968..90970))
                     /locus_tag="HHV4tp2_gp32"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:269871"
     gene            complement(91908..93725)
                     /locus_tag="HHV4tp2_gp33"
                     /db_xref="GeneID:5176221"
     CDS             complement(91908..93725)
                     /locus_tag="HHV4tp2_gp33"
                     /function="role in reactivation from latency"
                     /note="transactivator; ORF50; Rta"
                     /codon_start=1
                     /product="BRLF1"
                     /protein_id="YP_001129468.1"
                     /db_xref="GeneID:5176221"
                     /translation="MRPKKDGLEDFLRLTPEIKKQLGSLVSDYCNVLNKEFTAGSVEI
                     TLRSYKICKAFINEAKAHGREWGGLMATLNICNFWAILRNNRVRRRAENAGNDACSIA
                     CPIVMRYVLDHLIVVTDRFFIQAPSNRVMIPATIGTAMYKLLKHSRVRAYTYSKVLGV
                     DRAAIMASGKQVVEHLNRMEKEGLLSSKFKAFCKWVFTYPVLEEMFQTMVSSKTGHLT
                     DDVKDVRALIKTLPRASYSSHAGQRSYVSGVLPACLLSTKSKAVETPILVSGADRMDE
                     ELMGNDGGASHTEARYSESGQFHAFTDELESLPSPTMPLKPGAQSADCGDSSSSSSDS
                     GNSDTEQSEREEARAEAPRLRAPKSRRTSRPNRGQTPCPSNAEEPEQPWIAAVHQESD
                     ERPIFPHPSKPTFLPPVKRKKGLRDSREGMFLPKPEAGSAISDVFEGREVCQPKRIRP
                     FHPPGSPWANRPLPASLAPTPTGPVHEPVGSLTPAPVPRPLDPAPAVTPEASHLLEDP
                     DEETSQAVKALREMADTVIPQKEEAAICGQMDLNHPPPRGHLDELTTTLESMTEDLNL
                     DSPLTPELNEILDTFLNDECLLHAMHISTGLSIFDTSLF"
     misc_feature    complement(91974..93485)
                     /locus_tag="HHV4tp2_gp33"
                     /note="Herpesvirus transcription activation factor
                     (transactivator); Region: Herpes_TAF50; pfam03326"
                     /db_xref="CDD:308764"
     gene            93724..94656
                     /locus_tag="HHV4tp2_gp34"
                     /db_xref="GeneID:5176203"
     CDS             93724..94656
                     /locus_tag="HHV4tp2_gp34"
                     /note="ORF49"
                     /codon_start=1
                     /product="BRRF1"
                     /protein_id="YP_001129469.1"
                     /db_xref="GeneID:5176203"
                     /translation="MASSNRGNARPLKSFLHELYLKHYPEVGDVVHLLNTIGVDCDLP
                     PSHPLLTAQRGLFLARVLQAVQQHKLLEDTIVPKILKKLAYFLELLSYYSPKDEQRDI
                     AEVLDHLKTNRDLGLDDRLWALIRKLRQDRHHASVNVLMPGSDYTAVSLQYYDGISIG
                     MRKVIADVCRSGYASMPSMTATHNLSHQLLMASGPSEEPCAWRGFFNQVLLWTVALCK
                     FRRCIYYNYIQGSIATISQLLHLEIKALCSWIISQDGMRLFQHSRPLLTLWESVAANQ
                     EVTDAITLPDCAEYIDLLKHTKHVLENCSAMQYK"
     misc_feature    93787..94629
                     /locus_tag="HHV4tp2_gp34"
                     /note="BRRF1-like protein; Region: Herpes_BBRF1; cl27986"
                     /db_xref="CDD:391804"
     gene            94844..96457
                     /locus_tag="HHV4tp2_gp35"
                     /db_xref="GeneID:5176160"
     CDS             94844..96457
                     /locus_tag="HHV4tp2_gp35"
                     /note="ORF48"
                     /codon_start=1
                     /product="BRRF2"
                     /protein_id="YP_001129470.1"
                     /db_xref="GeneID:5176160"
                     /translation="MSGQQRGSVILVPEHLAGALTKLMSDFITGQDVTLSGGNIAVKI
                     RDAINQTPGGGDVAILSSLFALWNALPTSGRQSSRDDLIPAAVQALTTAHNLCLGVIP
                     GETSHKDTPESLLRAIVTGLQKLWVDSCGCPECLQCLKGLKAIKPGLYEIPRIIPHTK
                     QCSPVNLLNMLVHKLVALRGHVQLAYDARVLTPDFHEIPDLDDSDAVFARTLLAALFH
                     LNMFFILKDYITQDSMSLKQALSGHWMSATGNPLPAAPETLRDYLEAFRNSDNHFYLP
                     TTGPLNTFKFPEELLGRVVVIDSSLCAASHVQDVITRGVGAGVPRPQFLALPPAPSRK
                     PQQTCSQLTSRGNESSRRNLGQPGGTSPAVPPVCPIVSLTASGAKQNRGGMGSLHLAK
                     PEETSPAVSPVCPIASPAASRSKQHCGVTGSSQAAPSSSSVAPVASLSGDLEEEEEGS
                     RESPSLPSSKKGADEFEAWLEAQDANFEDVQREFSGLRVIGDEDEDGSEDGEFSDLDL
                     SDSDHEGDEGGGAVGGGRSLHSLYSLSVI"
     misc_feature    94850..95563
                     /locus_tag="HHV4tp2_gp35"
                     /note="Herpesvirus protein of unknown function (DUF832);
                     Region: DUF832; pfam05734"
                     /db_xref="CDD:283407"
     gene            96492..98417
                     /locus_tag="HHV4tp2_gp36"
                     /db_xref="GeneID:5176225"
     CDS             96492..98417
                     /locus_tag="HHV4tp2_gp36"
                     /note="latency protein"
                     /codon_start=1
                     /product="EBNA-1"
                     /protein_id="YP_001129471.1"
                     /db_xref="GeneID:5176225"
                     /translation="MSDEGPGTGPGNGLGQKEDTSGPDGSSGSGPQRRGGDNHGRGRG
                     RGRGRGGGRPGAPGGSGSGPRHRDGVRRPQKRPSCIGCKGAHGGTGAGGGAGAGGAGA
                     GGAGAGGAGAGGAGAGGAGAGGAGAGGAGAGGAGAGGAGAGGGAGAGGAGAGGAGAGG
                     GAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGAGAG
                     GAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGA
                     GGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGAGAGGGGRGRGGS
                     GGRGRGGSGGRGRGGSGGRRGRGRERARGGSRERARGRGRGRGEKRPRSPSSQSSSSG
                     SPPRRPPPGRRPFFHPVAEADYFEYHQEGGPDGEPDMPPGAIEQGPADDPGEGPSTGP
                     RGQGDGGRRKKGGWYGKHRGEGGSSQKFENIAEGLRLLLARCHVERTTEDGNWVAGVF
                     VYGGSKTSLYNLRRGIGLAIPQCRLTPLSRLPFGMAPGPGPQPGPLRESIVCYFIVFL
                     QTHIFAEGLKDAIKDLVLPKPAPTCNIKVTVCSFDDGVDLPPWFPPMVEGAAAEGDDG
                     DDGDEGGDGDEGEEGQE"
     misc_feature    97887..98309
                     /locus_tag="HHV4tp2_gp36"
                     /note="Epstein Barr virus nuclear antigen-1, DNA-binding
                     domain; Region: EBV-NA1; pfam02905"
                     /db_xref="CDD:308516"
     repeat_region   96759..97466
                     /locus_tag="HHV4tp2_gp36"
                     /note="236 copies; IR3; EBNA-1 triplet"
                     /rpt_type=direct
     gene            98500..98913
                     /locus_tag="HHV4tp2_gp37"
                     /db_xref="GeneID:5176156"
     CDS             98500..98913
                     /locus_tag="HHV4tp2_gp37"
                     /note="virion glycoprotein gL; herpesvirus core gene UL1
                     family; ORF47"
                     /codon_start=1
                     /product="BKRF2"
                     /protein_id="YP_001129472.1"
                     /db_xref="GeneID:5176156"
                     /translation="MRTVGVFLATCLVTIFVLPTWGNWAYPCCHVTQLRAQHLLALEN
                     ISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTG
                     HLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG"
     misc_feature    98581..98862
                     /locus_tag="HHV4tp2_gp37"
                     /note="Viral glycoprotein L; Region: Phage_glycop_gL;
                     pfam11108"
                     /db_xref="CDD:288014"
     gene            98895..99662
                     /locus_tag="HHV4tp2_gp38"
                     /db_xref="GeneID:5176162"
     CDS             98895..99662
                     /locus_tag="HHV4tp2_gp38"
                     /note="uracil-DNA glycosylase; uracil DNA glycosylase; the
                     Herpesviridae are non-segmented dsDNA viruses with genomes
                     ranging from 120-230kbp; although herpes viruses vary
                     greatly in sequence identity and homology, they all share
                     four common elements: an envelope, a tegument which is
                     composed of viral enzymes, a capsid of 162 capsomers, and
                     a core composed of genomic DNA; the uracil DNA glyocylases
                     are DNA repair enzymes that excise mis-incorporated uracil
                     residues from DNA by cleaving the N-glycosylic bond"
                     /codon_start=1
                     /product="uracil DNA glycosylase"
                     /protein_id="YP_001129473.1"
                     /db_xref="GeneID:5176162"
                     /translation="MASRGLDLWLDEHVWKRKQEIGVKGENLLLPDLWLDFLQLSPIF
                     QRKLAAVIACVRRLRTQATVYPEEDMCMAWARFCDPSDIKVVILGQDPYHGGQANGLA
                     FSIAYGFPVPPSLRNIYAELHRSLPEFSPPDHGCLDAWASQGVLLLNTILTVQKGKPG
                     SHADIGWAWFTDHVISLLSERLKACVFMLWGAKAGDKASLINSKKHLVLTSQHPSPLA
                     QNSTRKSAQQKFLGNNHFVLANNFLREKGLGEIDWRL"
     misc_feature    98910..99659
                     /locus_tag="HHV4tp2_gp38"
                     /note="uracil DNA glycosylase; Provisional; Region:
                     PHA03347"
                     /db_xref="CDD:177588"
     misc_feature    order(99159..99173,99240..99242,99339..99341,99465..99467,
                     99471..99473,99528..99533,99537..99545,99567..99572)
                     /locus_tag="HHV4tp2_gp38"
                     /note="active site"
                     /db_xref="CDD:381678"
     misc_feature    order(99159..99173,99339..99341,99531..99533)
                     /locus_tag="HHV4tp2_gp38"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:381678"
     misc_feature    99159..99173
                     /locus_tag="HHV4tp2_gp38"
                     /note="motif A [structural motif]; Region: motif A"
                     /db_xref="CDD:381678"
     gene            99676..100329
                     /locus_tag="HHV4tp2_gp39"
                     /db_xref="GeneID:5176197"
     CDS             99676..100329
                     /locus_tag="HHV4tp2_gp39"
                     /note="ORF45"
                     /codon_start=1
                     /product="BKRF4"
                     /protein_id="YP_001129474.1"
                     /db_xref="GeneID:5176197"
                     /translation="MAMFLKSRGVRSCRDRRLLSDEEEETSQSSSYTLGSQASQSIQE
                     EDVSDTDESDYSDEDEEIDLEEEYPSDEDPSEGSDSDPSWHPSDSDESDYSESDEDEA
                     TPGSQASRSSRVSPSTQQSSGLTPTPSFSRPRTRAPPRPPAPAPVRGRASAPPRPPAP
                     VQQSTKDKGPHRPTRPVLRGPAPRRPPPPSSPNTYNKHMMETTPPIKGNNNYNWPWL"
     misc_feature    <99817..100326
                     /locus_tag="HHV4tp2_gp39"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03151"
                     /db_xref="CDD:177546"
     gene            complement(100372..102801)
                     /locus_tag="HHV4tp2_gp40"
                     /db_xref="GeneID:5176217"
     CDS             complement(100372..102801)
                     /locus_tag="HHV4tp2_gp40"
                     /note="helicase subunit of helicase-primase complex;
                     helicase-primase subunit BBLF4; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; the lytic replication of
                     herpesvirus genomes involves several proteins; three of
                     these proteins form a tripartite helicase-primase complex
                     consisting of the helicase BBLF4, the primase BSLF1, and
                     the linker protein BBLF2/3, the catalytic subunit of the
                     Epstein-Barr virus polymerase physically interacts with
                     the helicase-primase complex"
                     /codon_start=1
                     /product="helicase-primase subunit BBLF4"
                     /protein_id="YP_001129475.1"
                     /db_xref="GeneID:5176217"
                     /translation="MAEEPRAPEALSSTFMLNMTSDASVRRIVRRIGTLAKRRVQQLP
                     DMETFSPEFDPEISEPPFLPFSAYVITGTAGAGKSTSVSCLHHTMDCLVTGATTVAAQ
                     NLSQTLRAYCPTVYSAFGFKSRHINMTQRVSSHGRSTDAALEELQRRDMAKYWPVLSD
                     IAAEFRRTKPRGLYSGVSGPAFEVLRDMHQGQLWTTNVIVVDEAGTLSVHILTAVVFC
                     YWFFNAWLRTPLYRRGRIPCIVCVGSPTQTDAFQSSFSHETQVNKIRECDNILTFLVG
                     NPRAATYVDVARNWALFINNKRCTDVQFGHLMKTLEYGLELSPDILAYVDRFVVPRAA
                     IMDPTQYVGWTRLFLSHAEVKTFLTTLHATLKTAGQGRAARGTGGDGGGVTMFTCPVE
                     CEVFLEPLAQYKTLVGLPGLTAHTWLQKNYARLGNYSQFADQDMVPVGTEQDEERVKV
                     TYNVTYVKHSSVSVNCKTKKSICGYTGTFGDFMDTLEADSFVEAHGHEQPEYVYSFLA
                     RLIYGGIYAFSHGGHSLCENGEYVAELGAVPLPGRTWDPEVTAGMELGELPLEVAWDG
                     ERSPAAVFYARVLAPPAANSAPLCSLLNIYNDLRAYFRQCLDVAVRYGRREFRDLPFC
                     TFTNNMLIRDNIEFTSDEPLLHGLLDYASTTENYTLLGYTHLNVFFGIRGKQQPQDAG
                     SSRMPRLMVKDEAGFVCCLEHNTNKLYETIEDKSLNLCSIRDYGISSKLAMTIAKAQG
                     LSLNKVAICFGSHRNIKPGHVYVALSRARHSNCVVMDRNPLSEMITGEGNPASGYIVD
                     ALKNSRALLVY"
     misc_feature    complement(100375..102777)
                     /locus_tag="HHV4tp2_gp40"
                     /note="Helicase; Region: Herpes_Helicase; pfam02689"
                     /db_xref="CDD:280797"
     gene            102746..104587
                     /locus_tag="HHV4tp2_gp41"
                     /db_xref="GeneID:5176175"
     CDS             102746..104587
                     /locus_tag="HHV4tp2_gp41"
                     /note="portal protein; herpesvirus core gene UL6 family;
                     ORF43"
                     /codon_start=1
                     /product="BBRF1"
                     /protein_id="YP_001129476.1"
                     /db_xref="GeneID:5176175"
                     /translation="MFNMNVDESASGALGSSAIPVHPTPASVRLFEILQGKYAYVQGQ
                     TIYANLRNPGVFSRQVFTHLFKRAISHCTYDDVLHDWNKFEACIQKRWPSDDSCASRF
                     RESTFESWSTTMKLTVRDLLTTNIYRVLHSRSVLSYERYVDWICATGMVPAVKKPITQ
                     ELHSKIKSLRDRCVCRELGHERTIRSIGTELYEATREIIESLNSTFIPQFTEVTIEYL
                     PGSDEYVAYYCGRRIRLHVLFPPAIFAGTVTFDSPVQRLYQNIFMCYRTLEHAKICQL
                     LNTAPLKAIVGHGGRDMYKDILAHLEQNSQRKDPKKELLNLLVKLSENKTISGVTDVV
                     EEFITDASNNLVDRNRLFGQPGETAAQGLKKKVSNTVVKCLTDQINEQFDQINGLEKE
                     RELYLKKIRSMESQLQASLGPGGNNPAASAPAAVAAEAASVDILTGSTASAIEKLFNS
                     PSASLGARVSGHNESILNSFVSQYIPPSREMTKDLTELWESELFNTFKLTPVVDNQGQ
                     RLYVRYSSDTISILLGPFTYLVAELSPVELVTDVYATLGIVEIIDELYRSSRLAIYIE
                     DLGRKYCPASATGGDHGIRQAPSARGDAEPDHAKSKPARDPPPGAGS"
     misc_feature    102830..104461
                     /locus_tag="HHV4tp2_gp41"
                     /note="Herpesvirus UL6 like; Region: Herpes_UL6;
                     pfam01763"
                     /db_xref="CDD:280017"
     gene            104490..105326
                     /locus_tag="HHV4tp2_gp42"
                     /db_xref="GeneID:5176152"
     CDS             104490..105326
                     /locus_tag="HHV4tp2_gp42"
                     /note="tegument protein; herpesvirus core gene UL7 family;
                     ORF42"
                     /codon_start=1
                     /product="BBRF2"
                     /protein_id="YP_001129477.1"
                     /db_xref="GeneID:5176152"
                     /translation="MASGKHHQPGGTRSLTMQKVSLRVTPRLVLEVNRHNAICVATNV
                     PEFYNARGDLNIRDLRAHVKARMISSQFCGYVLVSLLDSEDQVDHLNIFPHVFSERMI
                     LYKPNNVNLMEMCALLSMIENAKSPSIGLCREVLGRLTLLHSKCNNLDSLFLYNGART
                     LLSTLVKYHDLEEGAATPGPWNEGLSLFKLHKELKRAPSEARDLMQSLFLTSGKMGCL
                     ARSPKDYCADLNKEEDANSGFTFNLFYQDSLLTKHFQCQTVLQTLRRKCLGSDTVSKI
                     IP"
     misc_feature    104571..105227
                     /locus_tag="HHV4tp2_gp42"
                     /note="Herpesvirus UL7 like; Region: Herpes_UL7;
                     pfam01677"
                     /db_xref="CDD:279943"
     gene            complement(105323..107580)
                     /locus_tag="HHV4tp2_gp43"
                     /db_xref="GeneID:5176202"
     CDS             complement(join(105323..105928,106057..107580))
                     /locus_tag="HHV4tp2_gp43"
                     /note="subunit of helicase-primase complex;
                     helicase-primase subunit BBLF2/3; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; the lytic replication of
                     herpesvirus genomes involves several proteins; three of
                     these proteins form a tripartite helicase-primase complex
                     consisting of the helicase BBLF4, the primase BSLF1, and
                     the linker protein BBLF2/3, the catalytic subunit of the
                     Epstein-Barr virus polymerase physically interacts with
                     the helicase-primase complex"
                     /codon_start=1
                     /product="helicase-primase subunit BBLF2/3"
                     /protein_id="YP_001129478.1"
                     /db_xref="GeneID:5176202"
                     /translation="MMETPAESVRARVSSVTFYNVTQTAGRWWAIWVVGIVPIKREDV
                     ETLIVVQACQPPLGGSLEPPVVNAPSTTELNFLRWERELRRSGGLIAMLADAAEKDLF
                     DLSFRTRDRRLLSAARVEDEQGLIFQPLFPAQVVCQSCSGDDGRDQQPPPVDGFGSEM
                     EGEQTCPHAQRHSESPGQLDVYIRTPRGDVFTYSTETPDDPSPVPFRDILRPVTYEVD
                     LVSSDGATGRGGDARRHRVSLKILEPAGGFESWLVNSWSMAGGGLYAFLRSIYASCYA
                     NHRGTKPIFYLLDPELCPGGSDFQPYVPGFPFLPIHYVGRARPAFWHRAPHSEGLLLL
                     DLNLGVSGTPLADALLGLDARSGQRRGSLLLQQIWPPTRKEINPRHVCTREGGEGGGE
                     DETTVVGRAEATAILEADATWWLYELARCHLSARGAPVGTPDGGGQARDAQTWLRALH
                     RYGTSDTRRALGGLYTAVTRVLLHAAADLGLTWAYADEFILGFVAPTSAHPSEEPLAQ
                     AFLQGVKDSEDASRLDRDVMGGEATVARRHIRVKARRGPGCLLMAIFQGDLYVGGCRE
                     HSGPFLVWHEAFSWTLDQLAARPEADKAPPSHDHLLTLVRDLTRRLAPGRRRNRFWAL
                     PRAWLQRLRRAGLRLSGSHVCLLDKDGARPAPCQTATEHGLSPTAYFREIMAFLLDVI
                     SALHPGYTIPMEITRETDLLMTVLSLF"
     misc_feature    complement(join(105326..105928,106057..107580))
                     /locus_tag="HHV4tp2_gp43"
                     /note="helicase-primase subunit BBLF2/3; Provisional;
                     Region: PHA03312; cl28610"
                     /db_xref="CDD:333430"
     gene            107679..108896
                     /locus_tag="HHV4tp2_gp44"
                     /db_xref="GeneID:5176222"
     CDS             107679..108896
                     /locus_tag="HHV4tp2_gp44"
                     /note="envelope glycoprotein gM; herpesvirus core gene
                     UL10 family; ORF49"
                     /codon_start=1
                     /product="BBRF3"
                     /protein_id="YP_001129479.1"
                     /db_xref="GeneID:5176222"
                     /translation="MKSSKNDTFVYRTWFKTLVVYFVMFVMSAVVPITAMFPNLGYPC
                     YFNALVDYGALNLTNYNLAHHLTPTLYLEPPEMFVYITLVFIADCVAFIYYACGEVAL
                     IKARKKVSGLTDLSAWVSAVGSPTVLFLAILKLWSIQVFIQVLSYKHVFLSAFVYFLH
                     FLASVLHACACVTRFSPVWVVKAQDNSIPQDTFLWWVVFYLKPIVTNLYLGCLALETL
                     VFSLSVFLALGNSFYFMVGDMVLGAVNLFLVLPIFWYILTEVWLASFLRHNFGFYCGM
                     FIASIILILPLVRYEAVFVSAKLHTTVAINVAIIPILCSVAMLIRICRIFKSMRQGTD
                     YVPVSETVELELESEPRPRPSRTPSPGRNRRRSSTSSSSSRSTRRQRPVSTQALISSV
                     LPMTTDSEEEIFP"
     misc_feature    107679..108761
                     /locus_tag="HHV4tp2_gp44"
                     /note="Herpesvirus glycoprotein M; Region: Herpes_glycop;
                     pfam01528"
                     /db_xref="CDD:279822"
     gene            complement(109289..109516)
                     /locus_tag="HHV4tp2_gp45"
                     /db_xref="GeneID:5176158"
     CDS             complement(109289..109516)
                     /locus_tag="HHV4tp2_gp45"
                     /function="role in virion egress"
                     /note="myristylated tegument protein anchored in envelope;
                     Alkaline exonuclease; the Herpesviridae are non-segmented
                     dsDNA viruses with genomes ranging from 120-230kbp;
                     although herpes viruses vary greatly in sequence identity
                     and homology, they all share four common elements: an
                     envelope, a tegument which is composed of viral enzymes, a
                     capsid of 162 capsomers, and a core composed of genomic
                     DNA; the Alkaline exonuclease, UL11/BBLF1 tegument protein
                     is a protein that is well conserved among the mammalian
                     herpesviruses and interacts with UL16, a capsid-associated
                     protein that also interacts with UL21; efficient packaging
                     of UL16 is dependent on the presence of UL11 and UL21"
                     /codon_start=1
                     /product="Alkaline exonuclease"
                     /protein_id="YP_001129480.1"
                     /db_xref="GeneID:5176158"
                     /translation="MGALWSLCRRRVNSIGDVDGGIINLYNDYEEFNLETTKLIAAEE
                     GRACGETNEGLEYDEDSENDELLFLPNKKPN"
     misc_feature    complement(109292..109516)
                     /locus_tag="HHV4tp2_gp45"
                     /note="Alkaline exonuclease; Provisional; Region:
                     PHA03358"
                     /db_xref="CDD:177596"
     gene            complement(109471..110883)
                     /locus_tag="HHV4tp2_gp46"
                     /db_xref="GeneID:5176208"
     CDS             complement(109471..110883)
                     /locus_tag="HHV4tp2_gp46"
                     /note="deoxyribonuclease; herpesvirus core gene UL12
                     family; ORF37"
                     /codon_start=1
                     /product="BGLF5"
                     /protein_id="YP_001129481.1"
                     /db_xref="GeneID:5176208"
                     /translation="MADVDELEDPMEEMTSYTFARFLRSPETEAFVRNLDRPPQMPAM
                     RYVYLYCLCEQIQEFSGETGFCDFVSSLVQENDSQDGPSLKSIYWGLQEATDEQRTVL
                     CSYVESMTRGQSENLMWDILRNGIISSSKLLSTIKNGPTKVFEPAPISTNHYFGGPVA
                     FGLRCEDTVKDIVCKLICGDASANRQFGFMISPTDGIFGVSLDLCVNVESQGDFILFT
                     DRSCIYEIKCRFKYLFSKSEFDPIYPSYTALYKRPCKRSFIRFINSIARPTVEYVPDG
                     RLPSEGDYLLTQDEAWNLKDVRKRKLGPGHDLVADSLAANRGVESMLYVMTDPSENAG
                     RIGIKDRVPVNIFINPRHNYFYQVLLQYKIVGDYVRHSGGGKPGRDCSPRVNIVTAFF
                     RKRSPLDPATCTLGSDLLLDASVEIPVAVLVTPVVLPDSVIRKTLSTAAGSWKAYADN
                     TFDTAPWVPSGLFADDESTP"
     misc_feature    complement(109498..110859)
                     /locus_tag="HHV4tp2_gp46"
                     /note="Herpesvirus alkaline exonuclease; Region:
                     Herpes_alk_exo; pfam01771"
                     /db_xref="CDD:280025"
     gene            complement(110867..112156)
                     /locus_tag="HHV4tp2_gp47"
                     /db_xref="GeneID:5176213"
     CDS             complement(110867..112156)
                     /locus_tag="HHV4tp2_gp47"
                     /note="serine-threonine protein kinase; herpesvirus core
                     gene UL13 family; ORF36"
                     /codon_start=1
                     /product="BGLF4"
                     /protein_id="YP_001129482.1"
                     /db_xref="GeneID:5176213"
                     /translation="MDVNMAAELSPTNSSSSGELSVSPEPPRETQAFLGKVTVIDYFT
                     FQHKHLKVTNIDDMTETLYVKLPENMTRCDHLPITCEYLLGRGSYGAVYAHADNATVK
                     LYDSVTELYHELMVCDMIQIGKATAEDGQDKALVDYLSACTSCHALFMPQFRCSLQDY
                     GHWHDGSIEPLVRGFQGLKDAVYFLNRHCGLFHSDISPSNILVDFTDTMWGMGRLVLT
                     DYGTASLHDRNKMLDVRLKSSKGRQLYRLYCQREPFSIAKDTYKPLCLLSKCYILRGA
                     GHIPDPSACGPVGAQTALRLDLQSLGYSLLYGIMHLADSTHKIPYPNPDMGFDRSDPL
                     YFLQFAAPKVVLLEVLSQMWNLNLDMGLTSCGESPCVDVTAEHMSQFLQWCRSLKKRF
                     KESYFFNCRPRFEHPHLPGLVAELLADDFFGPDGRRG"
     misc_feature    complement(<111434..111907)
                     /locus_tag="HHV4tp2_gp47"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl21453"
                     /db_xref="CDD:419665"
     misc_feature    complement(order(111434..111445,111491..111493,
                     111500..111502,111551..111553,111557..111562,
                     111566..111568,111572..111574,111683..111685,
                     111689..111691,111707..111709,111743..111748,
                     111788..111790,111851..111853,111881..111883,
                     111893..111907))
                     /locus_tag="HHV4tp2_gp47"
                     /note="active site"
                     /db_xref="CDD:270870"
     misc_feature    complement(order(111500..111502,111551..111553,
                     111557..111562,111566..111568,111572..111574,
                     111689..111691,111707..111709,111743..111748,
                     111788..111790,111851..111853,111881..111883,
                     111893..111907))
                     /locus_tag="HHV4tp2_gp47"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    complement(order(111434..111445,111491..111493,
                     111560..111562,111566..111568,111572..111574,
                     111683..111685,111689..111691,111893..111895))
                     /locus_tag="HHV4tp2_gp47"
                     /note="polypeptide substrate binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:270870"
     misc_feature    complement(order(111434..111457,111482..111505))
                     /locus_tag="HHV4tp2_gp47"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:270870"
     gene            complement(112035..112496)
                     /locus_tag="HHV4tp2_gp48"
                     /db_xref="GeneID:5176184"
     CDS             complement(112035..112496)
                     /locus_tag="HHV4tp2_gp48"
                     /note="tegument protein; herpesvirus core gene UL14
                     family; ORF35"
                     /codon_start=1
                     /product="BGLF3.5"
                     /protein_id="YP_001129483.1"
                     /db_xref="GeneID:5176184"
                     /translation="MKMSSSKRDLVAQQLRASVEKRAAVSARDRFGRDHALFETQFTS
                     ARGALESLRRARETFESKQLISTYQRVVTATKTQFPKINYKQLERVEELREQELEARD
                     ELRQALEPFEEHGCEYGCGVEPDELLQQWRVECLPRTPSRDPGLFGEGDCH"
     misc_feature    complement(112074..112487)
                     /locus_tag="HHV4tp2_gp48"
                     /note="Gammaherpesvirus protein of unknown function
                     (DUF848); Region: DUF848; cl27943"
                     /db_xref="CDD:332764"
     gene            complement(112483..113481)
                     /locus_tag="HHV4tp2_gp49"
                     /db_xref="GeneID:5176188"
     CDS             complement(112483..113481)
                     /locus_tag="HHV4tp2_gp49"
                     /note="related to HHV-5 UL95; ORF34"
                     /codon_start=1
                     /product="BGLF3"
                     /protein_id="YP_001129484.1"
                     /db_xref="GeneID:5176188"
                     /translation="MFNAVKADMPDDPMLARRYGQCLELALEACQDTPEQFKLVETPL
                     KSFLLVSNILPQDNRPWHEARSSGRVAEDDYDFSSLALELLPLNPRLPEEWQFGGQGW
                     SSRMEPSQPEMGMGLCFEVFDGDLMRIALAWNKDEVIGQALQILAHSHTWTSLVPEDP
                     LPWMWALFYGPRSHCEERHCVYAAARGKRGPILLPTAVYTPCANIEAFLAHLTRCVYA
                     LYLDVRDWKGEDIAPPFDVSRLNKMAKQLCLLPQEPFCITRVCLLCLLHKQNLNAQYK
                     RPVDTYDPCLILTGEAERYMVDAVGNYREASTGTTVLYPTYDLGSIVADMVTYEDE"
     misc_feature    complement(112492..113481)
                     /locus_tag="HHV4tp2_gp49"
                     /note="UL95 family; Region: Herpes_UL95; pfam03038"
                     /db_xref="CDD:281088"
     gene            113480..118890
                     /locus_tag="HHV4tp2_gp50"
                     /db_xref="GeneID:5176176"
     CDS             join(113480..114415,117754..118890)
                     /locus_tag="HHV4tp2_gp50"
                     /note="putative ATPase subunit of terminase; herpesvirus
                     core gene UL15 family; ORF29"
                     /codon_start=1
                     /product="BGRF1/BDRF1"
                     /protein_id="YP_001129485.1"
                     /db_xref="GeneID:5176176"
                     /translation="MLYASQRGRLTENLRNALQQDSTTQGCLGAETPSIMYTGAKSDR
                     WAHPLVGTIHASNLYCPMLRAYCRHYGPRPVFVASDESLPMFGASPALHTPVQVQMCL
                     LPELRDTLQRLLPPPNLEDSEALTEFKTSVSSARAILEDPNFLEMREFVTSLASFLSG
                     QYKHKPARLEAFQKQVVLHSFYFLISIKSLEITDTMFDIFQSAFGLEEMTLEKLHIFK
                     QKASVFLIPRRHGKTWIVVAIISLILSNLSNVQIGYVAHQKHVASAVFTEIIDTLTKS
                     FDSKRVEVNKETSTITFRHSGKISSTVMCATCFNKNSIRGQTFHLLFVDEANFIKKEA
                     LPAILGFMLQKDAKIIFISSVNSADQATSFLYKLKDAQERLLNVVSYVCQEHRQDFDM
                     QDSMVSCPCFRLHIPSYITMDSNIRATTNLFLDGAFSTELMGDTSSLSQGSLSRTVRD
                     DAINQLELCRVDTLNPRVAGRLASSLYVYVDPAYTNNTSASGTGIAAVTHDRADPNRV
                     IVLGLEHFFLKDLTGDAALQIATCVVALVSSIVTLHPHLEEVKVAVEGNSSQDSAVAI
                     ASIIGESCPLPCAFVHTKDKTSSLQWPMYLLTNEKSKAFERLIYAVNTASLSASQVTV
                     SNTIQLSFDPVLYLISQIRAIKPIPLRDGTYTYTGKQRNLSDDVLVALVMAHFLATTQ
                     KHTFKKVH"
     misc_feature    join(113609..114415,117754..117762)
                     /locus_tag="HHV4tp2_gp50"
                     /note="Probable DNA packing protein, N-terminus; Region:
                     DNA_pack_N; pfam02500"
                     /db_xref="CDD:280634"
     misc_feature    117841..118878
                     /locus_tag="HHV4tp2_gp50"
                     /note="Probable DNA packing protein, C-terminus; Region:
                     DNA_pack_C; pfam02499"
                     /db_xref="CDD:280633"
     gene            complement(114405..115415)
                     /locus_tag="HHV4tp2_gp51"
                     /db_xref="GeneID:5176204"
     CDS             complement(114405..115415)
                     /locus_tag="HHV4tp2_gp51"
                     /note="tegument protein; herpesvirus core gene UL16
                     family; ORF33"
                     /codon_start=1
                     /product="BGLF2"
                     /protein_id="YP_001129486.1"
                     /db_xref="GeneID:5176204"
                     /translation="MASAANSSREQLRKFLNKECLWVLSDASTPQMKVYTATTAVSAV
                     YVPQIAGPPKTYMNVTLIVLKPKKKPTYVTVYINGTLATVARPEVLFTKAVQGPHSLT
                     LMYFGVFSDAVGEAVPVEIRGNPVVTCTDLTTAHVFTTSTAVKTVEELQDITPSEIIP
                     LGRGGAWYAEGALYMFFVNMDMLMCCPNMPTFPSLTHFINLLTRCDNGECVTCYGAGA
                     HVNILRGWTEDDSPGTSGTCPCLLPCTALNNDYVPITGHRALLGLMFKPEDAPFVVGL
                     RFNPPKMHPDMSRVLQGVLANGKEVPCTAQPWTLLRFSDLYSRAMLYNCQVLKRQVLH
                     SY"
     misc_feature    complement(114426..115388)
                     /locus_tag="HHV4tp2_gp51"
                     /note="Herpesvirus UL16/UL94 family; Region: Herpes_UL16;
                     pfam03044"
                     /db_xref="CDD:281094"
     gene            complement(115393..116913)
                     /locus_tag="HHV4tp2_gp52"
                     /db_xref="GeneID:5176151"
     CDS             complement(115393..116913)
                     /locus_tag="HHV4tp2_gp52"
                     /note="tegument protein; herpesvirus core gene UL17
                     family; ORF32"
                     /codon_start=1
                     /product="BGLF1"
                     /protein_id="YP_001129487.1"
                     /db_xref="GeneID:5176151"
                     /translation="MDVHIDNQVLSGLGTPLLVHLFVPDTVMAELCPNRVPNCEGAWC
                     QTLFSDRTGLTRVCRVFAARGMLPGRPSHRGTFTSVPVYCEEGLPELYNPFHVAALRF
                     YDEGGLVGELQIYYLSLFEGAKRALTDGHLIREASGVQESAAAMQPIPIDPGPPGGAG
                     IEHMPMAAAQVEHPKTYDLKQILLEITQEENRGEQRLGHAGSPALCLGLRLRAGAETK
                     AAAETSVSKHHPALENPSNIRGSAGGEGGGGRAGTGGTVGVGSGALSRVPVSFSKTRR
                     AIRESRALVRGIAHIFSPHALYVVTYPELSAQGRLHRMTAVTHASPATDLAEVSILGA
                     PEREFRFLISVALRISASFREKLAMQAWTAQQEIPVVIPTSYSRIYKNSDLIREAFFT
                     VQTRVSWESCWVKAISNAPKTPDACLWIDSHPLYEEGASAWGKVIDSRPPGGLVGAAS
                     QLVALGTDGHCVHLATTSDGQAFLVLPGGFVIKGQLALTPEERGYILARHGIRREQ"
     misc_feature    complement(115450..116913)
                     /locus_tag="HHV4tp2_gp52"
                     /note="Herpesvirus UL17 protein; Region: Herpes_UL17;
                     pfam04559"
                     /db_xref="CDD:309621"
     gene            complement(116883..117560)
                     /locus_tag="HHV4tp2_gp53"
                     /db_xref="GeneID:5176193"
     CDS             complement(116883..117560)
                     /locus_tag="HHV4tp2_gp53"
                     /note="related to HHV-5 UL92; ORF31"
                     /codon_start=1
                     /product="BDLF4"
                     /protein_id="YP_001129488.1"
                     /db_xref="GeneID:5176193"
                     /translation="MSDQGRLSLPRGEGGTDEPNPRHLCSYSKLEFHLPLPESMASVF
                     ACWGCGEYHVCDGSSECTLIETHEGVVCALTGNYMGPHFQPALRPWTEIRQDTQDQRD
                     KWEPEQVQGLVKTVVNHLYHYFLNENVISGVSEALFDQEGALRPHIPALVSFVFPCCL
                     MLFRGASSEKVVDVVLSLYIHVIISIYSQKTVYGALLFKSTRNKRYDAVAKRMRELWM
                     STLTTKC"
     misc_feature    complement(116901..117488)
                     /locus_tag="HHV4tp2_gp53"
                     /note="UL92 family; Region: Herpes_UL92; pfam03048"
                     /db_xref="CDD:281097"
     gene            complement(117539..117772)
                     /locus_tag="HHV4tp2_gp54"
                     /db_xref="GeneID:5176200"
     CDS             complement(117539..117772)
                     /locus_tag="HHV4tp2_gp54"
                     /note="BDLF3; the Herpesviridae are non-segmented dsDNA
                     viruses with genomes ranging from 120-230kbp; although
                     herpes viruses vary greatly in sequence identity and
                     homology, they all share four common elements: an
                     envelope, a tegument which is composed of viral enzymes, a
                     capsid of 162 capsomers, and a core composed of genomic
                     DNA; BDLF3 which encodes a glycoprotein is an ORF found in
                     the lymphocryptovirus genus of herpesvirales which
                     includes Epstein Barr virus (Human herpesvirus type 4) and
                     Macacine herpesvirus 4"
                     /codon_start=1
                     /product="BDLF3"
                     /protein_id="YP_001129489.1"
                     /db_xref="GeneID:5176200"
                     /translation="MSAPGCSERQDKKRVTIGETEFGQLLSWDPTDLPRTVARVYVAV
                     GGLFEQEVSEVQRLENICTLLDLAGVECQTKAD"
     misc_feature    complement(117542..117772)
                     /locus_tag="HHV4tp2_gp54"
                     /note="BDLF3; Provisional; Region: PHA03256"
                     /db_xref="CDD:165514"
     gene            complement(118901..119605)
                     /locus_tag="HHV4tp2_gp55"
                     /db_xref="GeneID:5176212"
     CDS             complement(118901..119605)
                     /locus_tag="HHV4tp2_gp55"
                     /note="putative membrane glycoprotein gp150; BDLF3; the
                     Herpesviridae are non-segmented dsDNA viruses with genomes
                     ranging from 120-230kbp; although herpes viruses vary
                     greatly in sequence identity and homology, they all share
                     four common elements: an envelope, a tegument which is
                     composed of viral enzymes, a capsid of 162 capsomers, and
                     a core composed of genomic DNA; BDLF3 which encodes a
                     glycoprotein is an ORF found in the lymphocryptovirus
                     genus of herpesvirales which includes Epstein Barr virus
                     (Human herpesvirus type 4) and Macacine herpesvirus 4;
                     ORF28"
                     /codon_start=1
                     /product="BDLF3"
                     /protein_id="YP_001129490.1"
                     /db_xref="GeneID:5176212"
                     /translation="MAHARDKAGAVLAMILICETSLIWTSSGSSTASAGNVTGTTAVT
                     TPSPSASGPSTNQSTTLTTTSAPITTTAILSTNTTTVTSTGTTVTPVPTTSNASTINV
                     TTKVTAQNITATEAGTGTSTGVTSNVTTRSSTTTSATTRITNATTLAPTLSSKGTSNA
                     TKTTAELPTVPDERQPSLSYGLPLWTLVFVGLTFLMLILIFAAGLMMSAKNKPLDEAL
                     LTNAVTRDPSLYKGLV"
     misc_feature    complement(118904..119605)
                     /locus_tag="HHV4tp2_gp55"
                     /note="BDLF3; Provisional; Region: PHA03255"
                     /db_xref="CDD:165513"
     gene            complement(119666..120928)
                     /locus_tag="HHV4tp2_gp56"
                     /db_xref="GeneID:5176177"
     CDS             complement(119666..120928)
                     /locus_tag="HHV4tp2_gp56"
                     /note="ORF27"
                     /codon_start=1
                     /product="BDLF2"
                     /protein_id="YP_001129491.1"
                     /db_xref="GeneID:5176177"
                     /translation="MVDEQVAVEHGTVSHTISREEDGVVHERRVLASGERVEVFYKAP
                     APRPREGRASTFHDFTVPAAAAVPGPEPEPEPHPPMPIHANGGGETKTNTQDQNQNQT
                     TRTRTNAKAEERTAEMDDTMASSGGQRGAPISADLLSLSSLTGRMAAMAPSWMKSEVC
                     GERMRFKEDVYDGEAETLAEPPRCFMLSFVFIYYCCYLAFLALLAFGFNPLFLPSFMP
                     VGAKVLRGKGRDFGVPLSYGCPTNPFCKVYTLIPAVVINNVTYYPNNTDSHGGHGGFE
                     AAALHVAALFESGCPNLQAVTNRNRTFNVTRASGRVERRLVQDMQRVLASAVVVMHHH
                     CHYETYYVFDGVGPEFGTIPTPCFKDVLAFRPSLVTNCTAPLKTSVKGPNWSGAAGGM
                     KRKQCRVDRLTDRSFPAYLEEVMYVMVQ"
     gene            complement(120939..121844)
                     /locus_tag="HHV4tp2_gp57"
                     /db_xref="GeneID:5176192"
     CDS             complement(120939..121844)
                     /locus_tag="HHV4tp2_gp57"
                     /note="capsid triplex protein; Capsid triplex subunit 2;
                     the Herpesviridae are non-segmented dsDNA viruses with
                     genomes ranging from 120-230kbp; although herpes viruses
                     vary greatly in sequence identity and homology, they all
                     share four common elements: an envelope, a tegument which
                     is composed of viral enzymes, a capsid of 162 capsomers,
                     and a core composed of genomic DNA; herpesvirus capsomers
                     are linked in groups of three by distinctive structures
                     called triplexes that are heterotrimers formed by two
                     proteins, Capsid triplex subunit 1 and capsid triplex
                     subunit 2"
                     /codon_start=1
                     /product="Capsid triplex subunit 2"
                     /protein_id="YP_001129492.1"
                     /db_xref="GeneID:5176192"
                     /translation="MDLKVVVSLSSRLYTDEIAKMQQRIGCILPLASTHGTQNVQGLG
                     LGQVYSLETVPDYVSMYNYLSDCTLAVLDEVSVDSLILTKIVPGQTYAIKNKYQPFFQ
                     WHGTGSLSVMPPVFGREHATVKLESNDVDIVFPMVLPTPIAEEVLQKILLFNVYSRVV
                     MQAPGNADMLDVHMHLGSVSYLGHHYELALPEVPGPLGLALLDNLSLYFCIMVTLLPR
                     ASMRLVRGLIRHEHYDLLNLFQEMVPDEIARIDLDDLSVADDLSRMRVMMTYLQSLAS
                     LFNLGPRLATAAYSQETLTATCWLR"
     misc_feature    complement(120942..121844)
                     /locus_tag="HHV4tp2_gp57"
                     /note="Capsid triplex subunit 2; Provisional; Region:
                     PHA03258"
                     /db_xref="CDD:165516"
     gene            complement(121860..126005)
                     /locus_tag="HHV4tp2_gp58"
                     /db_xref="GeneID:5176226"
     CDS             complement(121860..126005)
                     /locus_tag="HHV4tp2_gp58"
                     /note="major capsid protein; herpesvirus core gene UL19
                     family; ORF25"
                     /codon_start=1
                     /product="BcLF1"
                     /protein_id="YP_001129493.1"
                     /db_xref="GeneID:5176226"
                     /translation="MASNEGVENRPFPYLTVDADLLSNLRQSAAEGLFHSFDLLVGKD
                     AREAGIKFEVLLGVYTNAIQYVRFLETALAVSCVNTEFKDLSRMTDGKIQFRISVPTI
                     AHGDGRRPSKQRTFIVVKNCHKHHISTEMELSMLDLEILHSIPETPVEYAEYVGAVKT
                     VASALQFGVDALERGLINTVLSVKLRHAPPMFILQTLADPTFTERGFSKTVKSDLIAM
                     FKRHLLEHSFFLDRAENMGSGFSQYVRSRLSEMVAAVSGESVLKGVSTYTTAKGGEPV
                     GGVFIVTDNVLRQLLTFLGEEADNQIMGPSSYASFVVRGENLVTAVSYGRVMRTFEHF
                     MARIVDSPEKAGSTKSDLPAVAAGVEDQPRVPISAAVIKLGNHAVAVESLQKMYNDTQ
                     SPYPLNRRMQYSYYFPVGLFMPNPKYTTSAAIKMLDNPTQQLPVEAWIVNKNNLLLAF
                     NLQNALKVLCHPRLHTPAHTLNSLNAAPAPRDRRETYSLQHRRPNHMNVLVIVDEFYD
                     NKYAAPVTDIALKCGLPTEDFLHPSNYDLLRLELHPLYDIYIGRDAGERARHRAVHRL
                     MVGNLPTPLAPAAFQEARGQQFETATSLAHVVDQAVIETVQDTAYDTAYPAFFYVVEA
                     MIHGFEEKFVMNVPLVSLCINTYWERAGRLAFVNSFSMIKFICRHLGNNAISKEAYSM
                     YRKIYGELIALEQALMRLAGSDVVGDESVGQYVCALLDPNLLPPVAYTDIFTHLLTVS
                     DRAPQIIIGNEVYADTLAAPQFIERVGNMDEMAAQFVALYGYRVNGDHDHDFRLHLGP
                     YVDEGHADVLEKIFYYVFLPTCTNAHMCGLGVDFQHVAQTLAYNGPAFSHHFTRDEDI
                     LDNLENGTLRDLLEISDLRPTVGMIRDLSASFMTCPTFTRTVRVSVDNDVTQQLAPNP
                     ADKRTEQTVLVNGLVAFAFSERTRAVTQCLFHAIPFHMFYGDPRVAATMHQDVATFVM
                     RNPQQRAVEAFNRPEQLFAEYREWHRSPMGKYAAECLPSLVSISGMTAMHIKMSPMAY
                     IAQAKLKIHPGVAMTVVRTDEILSENILFSSRASTSMFIGTPNVSRREARVDAVTFEV
                     HHEMASIDTGLSYSSTMTPARVAAITTDMGIHTQDFFSVFPAEAFGNQQVNDYIKAKV
                     GAQRNGTLLRDPRTYLAGMTNVNGAPGLCHGQQATCEIIVTPVTADVAYFQKSNSPRG
                     RAACVVSCENYNQEVAEGLIYDHSRPDAAYEYRSTVNPWASQLGSLGDIMYNSSYRQT
                     AVPGLYSPCRAFFNKEELLRNNRGLYNMVNEYSQRLGGHPATSNTEVQFVVIAGTDVF
                     LEQPCSFLQEAFPALSASSRALIDEFMSVKQTHAPIHYGHYIIEEVAPVRRILKFGNK
                     VVF"
     misc_feature    complement(121887..125963)
                     /locus_tag="HHV4tp2_gp58"
                     /note="Herpes virus major capsid protein; Region:
                     Herpes_MCP; pfam03122"
                     /db_xref="CDD:281162"
     gene            126004..128256
                     /locus_tag="HHV4tp2_gp59"
                     /db_xref="GeneID:5176153"
     CDS             126004..128256
                     /locus_tag="HHV4tp2_gp59"
                     /note="hypothetical protein; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_001129494.1"
                     /db_xref="GeneID:5176153"
                     /translation="MTQGKREMGGGLEGFSSQLGLFYALACNRSPPALPEDATLLIKW
                     LDTALGREATFYACRAMRRLLLGVIRINDCQELPPGLIILSPGTVPGPLGVQSLEHTD
                     CEIWSSAHPDHAAHLPVPRVITYTDCPGSISTSSMFRLIIRYLSHHQFERCFEQFCRV
                     VPRRFLGTCKQNSAKMLAHLKQVTRIPPCPPFSGREARLKFHFFSWSTFMLSWPNNAT
                     LREIRTRAATNLTHHPHLVDTLYHASPQTPFLTRSGALYRFVTCCNCTLPNISIQQCK
                     AGDRPGDLEIILQSNGGGRPASFQFPSSPTGALLRCIVAAALLPEVSVGHQELSPLMS
                     RSHGGQTDVRSGPDPARRLVALLRREDGAPKDPPLGPFGHPRGPGPAKSEDEESERRD
                     APPPPLDFSFQASRLVPVGPGFRLLVFNTNRVINTKLVCSEPLVKMRVCNVPRLINNF
                     VARKYVVKETAFTVSLFFTDGVGANLAINVNISGTYLSFLLAMTSLRCFLPVEAIYPA
                     AVSNWNSTLDLHGLENQSLVRENRSGVFWTTNFPSVVSCQDGLNVSWFKAATATISRV
                     HGRTLEQHLIREITPIVTHREAKISRIKNRLFTLLELRNRSQIQVLHKRFLEGLLDCA
                     SLLRLDPSCINRIASEGLFDFSKRSIAHSKNRHECALLGHRHSANVTKLVVNERKTRL
                     DILGRNANFLTRCKHQVNLRQSPIFLTLLRHIRRRLGLGRASVKREITLLLAHLRKKT
                     APIHCRDAQV"
     misc_feature    126004..128205
                     /locus_tag="HHV4tp2_gp59"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03374"
                     /db_xref="CDD:223063"
     gene            128243..129457
                     /locus_tag="HHV4tp2_gp60"
                     /db_xref="GeneID:5176214"
     CDS             128243..129457
                     /locus_tag="HHV4tp2_gp60"
                     /note="related to HHV-5 UL88; ORF23"
                     /codon_start=1
                     /product="BTRF1"
                     /protein_id="YP_001129495.1"
                     /db_xref="GeneID:5176214"
                     /translation="MLKCKQPGARFIHGAVHLPSGQIVFHTIHSPTLASALGLPGENV
                     PIPALFRASGLNVRESLPMTNMRAPIISLARLILAPNPYILEGQLTVGMTQDNGIPVL
                     FARPVIEVKSGPESNIKASSQLMIAEDSCLNQIAPFSASEHPAFSMVESVKRVRVDEG
                     ANTRRTIRDILEIPVTVLSSLQLSPTKSILKKAPEPPPPEPQATFDAAPYARIFYDIG
                     RQVPKLGNAPAAQVSNVLIANRSHNSLRLVPNPDLLPLQHLYLKHVVLKSLNLENIVQ
                     DFEAIFTSPSDTISEAETKAFEKLVEQAKNTVENIVFCLNSICSTSTLPDVVPDVNNP
                     NISLALEKYFLMFPPSGTIMRNVRFATPIVRLLCQGAELGTMAQFLGKYIKVKKETGM
                     YTLVKLYYLLRI"
     misc_feature    128243..129454
                     /locus_tag="HHV4tp2_gp60"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03148"
                     /db_xref="CDD:223001"
     gene            complement(129454..131574)
                     /locus_tag="HHV4tp2_gp61"
                     /db_xref="GeneID:5176171"
     CDS             complement(129454..131574)
                     /locus_tag="HHV4tp2_gp61"
                     /note="envelope glycoprotein gH; gp85; herpesvirus core
                     gene UL22 family; ORF22"
                     /codon_start=1
                     /product="BXLF2"
                     /protein_id="YP_001129496.1"
                     /db_xref="GeneID:5176171"
                     /translation="MQLLCVFCLVLLWEVGAASLSEVKLHLDIEGHASHYTIPWTELM
                     AKVPGLSPEALWREANVTEDLASMLNRYKLIYKTSGTLGIALAEPVDIPAVSEGSMQV
                     DASKVHPGVISGLNSPACMLSAPLEKQLFYYIGTMLPNTRPHSYVFYQLRCHLSYVAL
                     SINGDKFQYTGAMTSKFLMGTYKRVTEKGDEHVLSLIFGKTKDLPDLRGPFSYPSLTS
                     AQSGDYSLVIVTTFVHYANFHNYFVPNLKDMFSRAVTMTAASYARYVLQKLVLLEMKG
                     GCREPELDTETLTTMFEVSVAFFKVGHAVGETGNGCVDLRWLAKSFFELTVLKDIIGI
                     CYGATVKGMQSYGLERLAAVLMATVKMEELGHLTTEKQEYALRLATVGYPKAGVYSGL
                     IGGATSVLLSAYNRHPLFQPLHTVMRETLFIGSHVVLRELRLNVTTQGPNLALYQLLS
                     TALCSALEIGEVLRGLALGTESGLFSPCYLSLRFDLTRDKLLSMAPQEAMLDQAAVSN
                     AVDGFLGRLSLEREDRDAWHLPAYKCVDRLDKVLMIIPLINVTFIISSDREVRGSALY
                     EASTTYLSSSLFLSPVIMNKCSQGAVAGEPRQIPKIQNFTRTQKSCIFCGFALLSYDE
                     KEGLETTTYITSQEVQNSILSSNYFDFDNLHVHYLLLTTNGTVMEIAGLYEERAHVVL
                     AIILYFIAFALGIFLVHKIVMFFL"
     misc_feature    complement(129469..131418)
                     /locus_tag="HHV4tp2_gp61"
                     /note="Herpesvirus glycoprotein H; Region:
                     Herpes_glycop_H; pfam02489"
                     /db_xref="CDD:280625"
     gene            complement(131576..133399)
                     /locus_tag="HHV4tp2_gp62"
                     /db_xref="GeneID:5176155"
     CDS             complement(131576..133399)
                     /locus_tag="HHV4tp2_gp62"
                     /note="thymidine kinase; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; thymidine kinase utilizes ATP to
                     phosphorylate deoxythymidine (dT) in the formation pathway
                     of deoxythymidine triphosphate for viral DNA synthesis;
                     thymidine kinase is the target of ganciclovir"
                     /codon_start=1
                     /product="thymidine kinase"
                     /protein_id="YP_001129497.1"
                     /db_xref="GeneID:5176155"
                     /translation="MAGFPGKEAGPPGGWRKCQEDESPENERHENFYAEIDDFAPSVL
                     TPTGSDSGAGEEDDDGLYQVPTHWPPLMAPTGLSGERVPCRTQAAVTSNTGNSPGSRH
                     TSCPFTLPRGAQPPAPAHQKPTAPTPKPRSRECGPSKTPDPFSWFRKTSCTEGGADST
                     SRSFMYQKGFEEGLAGLGLDDKSDCESEDESNFRRPSSHSALKQKNGGKGKPSGLFEH
                     LAAHGREFSKLSKHAAQLKRLSGSVMNVLNLDDAQDTRQAKAQRKESTRVPIVTHLTN
                     HVPVIKPACSLFLEGAPGVGKTTMLNHLKAVFGDLTIVVPEPMRYWTHVYENAIKAMH
                     KNVTRARHGREDTSAEVLACQMKFTTPFRVLASRKRSLLVTESGARSVAPLDCWILHD
                     RHLLSASVVFPLMLLRSQLLSYSDFIQVLATFTADPGDTIVWMKLNVEENMRRLKKRG
                     RKHESGLDAGYLKSVNDAYHAVYCAWLLTQYFAPEDIVKVCAGLTTITTVCHQSHTPI
                     IRSGVAEKLYKNSIFSVLKEVIQPFRADAVLLEVCLAFTRTLAYLQFVLVDLSEFQDD
                     LPGCWTEIYMQALKNPAIRSQFFDWAGLSKVISDFERGNRD"
     misc_feature    complement(131579..133390)
                     /locus_tag="HHV4tp2_gp62"
                     /note="thymidine kinase; Provisional; Region: PHA03132"
                     /db_xref="CDD:222997"
     gene            133398..134144
                     /locus_tag="HHV4tp2_gp63"
                     /db_xref="GeneID:5176174"
     CDS             133398..134144
                     /locus_tag="HHV4tp2_gp63"
                     /note="nuclear protein; herpesvirus core gene UL24 family;
                     ORF20"
                     /codon_start=1
                     /product="BXRF1"
                     /protein_id="YP_001129498.1"
                     /db_xref="GeneID:5176174"
                     /translation="MDPTRGLCALSTHDLAKFHSLPPARKAAGKRAHLRCYSKLLSLK
                     SWEQLASFLSLPPGPTFTDFRLFFEVTLGRRIADCVVVALQPSPRCYIVEFKTAMSNT
                     ANPQSVTRKAQRLEGTAQLCDCANFLRTSCPPVLGSQGLEVLAALVFKNQRSLRTLQV
                     EFPALGQKTLPTSTTGLLNLLSRWQDGALRARLDRPRPTAQGHRPRTHVGPKPSQLTA
                     RVPRSARAGRAGGRKGQVGAVGQVCPGAQK"
     misc_feature    133455..133973
                     /locus_tag="HHV4tp2_gp63"
                     /note="Herpes virus proteins UL24 and UL76; Region:
                     Herpes_UL24; pfam01646"
                     /db_xref="CDD:307668"
     gene            133954..135666
                     /locus_tag="HHV4tp2_gp64"
                     /db_xref="GeneID:5176157"
     CDS             133954..135666
                     /locus_tag="HHV4tp2_gp64"
                     /note="putative portal-capping protein; herpesvirus core
                     gene UL25 family; ORF19"
                     /codon_start=1
                     /product="BVRF1"
                     /protein_id="YP_001129499.1"
                     /db_xref="GeneID:5176157"
                     /translation="MALSGHVLIDPARLPRDTGPELMWAPSLRNSLRVSPEALELAER
                     EAERARSERWDRCAQVLKNRLLRVELDGIMRDHLARAEEIRQDLDAVVAFSDGLESMQ
                     VRSPSTGGRSAPAPPSPSPAQPFTRLTGNAQYAVSISPTDPPLMVAGSLAQTLLGNLY
                     GNINQWVPSFGPWYRTMSANAMQRRVFPKQLRGNLNFTNSVSLKLMTEVVAVLEGTTQ
                     DFFSDVRHLPDLQAALILSVAYLLLQGGSSHQQRPLPASREELLELGPESLEKIIADL
                     KAKSPGGNFMILTSGNKEARQSIAPLNRQAAYPPGTFADNKIYNLFVGAGLLPTTAAL
                     NVPGAAGRDRDLVYRIANQIFGEDVPPFSSHQWNLRVGLAALEALMLVYTLCETANLA
                     EAATRRLHLSSLLPQAMQRRKPAMASAGMPGAYPVQTLFRHGELFRFIWAHYVRPTVA
                     ADPQASISSLFPGLVLLALELKLMDGQAPSHYAINLTGQKFDTLFEIINQKLLFHDPA
                     AMLAARTQLRLAFEDGVGVALGRPSPMLAAREILERQFSASDDYDRLYFLTLGYLASP
                     VAPS"
     misc_feature    134020..135591
                     /locus_tag="HHV4tp2_gp64"
                     /note="Herpesvirus UL25 family; Region: Herpes_UL25;
                     pfam01499"
                     /db_xref="CDD:396196"
     gene            complement(135636..136454)
                     /locus_tag="HHV4tp2_gp65"
                     /db_xref="GeneID:5176216"
     CDS             complement(135636..136454)
                     /locus_tag="HHV4tp2_gp65"
                     /note="related to HHV-5 UL79; ORF18"
                     /codon_start=1
                     /product="BVLF1"
                     /protein_id="YP_001129500.1"
                     /db_xref="GeneID:5176216"
                     /translation="MLMGLGVRGDDARMTPGIHGLLLKMLKNWPLCALREDELRFLHL
                     SLTKLLTLSVNFYLWREAVINTGNRTNRVLARKVPDEYWYLLYRALARVGFPAEALRP
                     GNRSRSLCLFLHDRPDVTGAVCACVWAQLGLRRAPDLSQVTLADGNLLFNLGSVLPNR
                     LVVGVLYCLVHWGADEHETRVRARLRPLFVAFLCLAGYLLLDRAILSDAHDYEGLWHA
                     VALSMAAWHGLTPLPETRDEKEAKPPCDDFIYLFANDPLQCEELAQLGATGEAR"
     misc_feature    complement(135690..136448)
                     /locus_tag="HHV4tp2_gp65"
                     /note="UL79 family; Region: Herpes_UL79; cl28065"
                     /db_xref="CDD:332886"
     gene            136465..138282
                     /locus_tag="HHV4tp2_gp66"
                     /db_xref="GeneID:5176187"
     CDS             136465..138282
                     /locus_tag="HHV4tp2_gp66"
                     /note="minor capsid scaffold protein; capsid maturational
                     protease; herpesvirus core gene UL26 family; ORF17"
                     /codon_start=1
                     /product="BVRF2"
                     /protein_id="YP_001129501.1"
                     /db_xref="GeneID:5176187"
                     /translation="MVQAPSVYVCGFVERPDAPPKDACLHLDPLTVKSQLPLKKPLPL
                     TVEHLPDAPVGSVFGLYQSRAGLFSAASITSGVFLSLLDSIYHDCDIAQSQRLPLPRE
                     PKLEALHAWLPSLSLASLHPDIPQTTADGGKLSFFDHVSICALGRRRGTTAVYGTDLA
                     WVLKHFSDLEPSIAAQIENDANAAKRESGCPEDHPLPLTKLIAKAIDAGFLRNRVETL
                     RQDRGVANIPAESYLKASDAPDLQKPDKALQSPPPASTDPDTMLSGNAGEGATACGGS
                     AAAGQDLISVPRNTFMTLLQTNLDNKPPRQTPLPYAAPLPPFSHQAIATAPSYGPGAG
                     AVAPAGGYFTSPGGYYAGPAGGDPGAFLAMDAHTYHPHPHPPPAYFGLPGLFGPPPPV
                     PPYYGSHLRADYVPAPSRSNKRKRDPEEDEEGGGLFPGEDATLYRKDIAGLSKSVNEL
                     QHTLQALRRETLSYGHTGVGYCPQQGPCYTHPGPYGFQPHQSYEVPRYVPHPPPPPTS
                     HQAAQAQPPPPGTQAPEAHCVAESTIPEAGAAGNSGPREDTNPQQPTTEGHHRGKKLV
                     QASASGVAQSKEPTTPKAKSVSAHLKSIFCEELLNKRVA"
     misc_feature    136534..137442
                     /locus_tag="HHV4tp2_gp66"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     gene            137245..138282
                     /locus_tag="HHV4tp2_gp67"
                     /db_xref="GeneID:5176196"
     CDS             137245..138282
                     /locus_tag="HHV4tp2_gp67"
                     /note="major capsid scaffold protein; herpesvirus core
                     gene UL26.5 family; ORF17.5"
                     /codon_start=1
                     /product="BdRF1"
                     /protein_id="YP_001129502.1"
                     /db_xref="GeneID:5176196"
                     /translation="MLSGNAGEGATACGGSAAAGQDLISVPRNTFMTLLQTNLDNKPP
                     RQTPLPYAAPLPPFSHQAIATAPSYGPGAGAVAPAGGYFTSPGGYYAGPAGGDPGAFL
                     AMDAHTYHPHPHPPPAYFGLPGLFGPPPPVPPYYGSHLRADYVPAPSRSNKRKRDPEE
                     DEEGGGLFPGEDATLYRKDIAGLSKSVNELQHTLQALRRETLSYGHTGVGYCPQQGPC
                     YTHPGPYGFQPHQSYEVPRYVPHPPPPPTSHQAAQAQPPPPGTQAPEAHCVAESTIPE
                     AGAAGNSGPREDTNPQQPTTEGHHRGKKLVQASASGVAQSKEPTTPKAKSVSAHLKSI
                     FCEELLNKRVA"
     misc_feature    <137284..138270
                     /locus_tag="HHV4tp2_gp67"
                     /note="Assemblin (Peptidase family S21); Region:
                     Peptidase_S21; cl25932"
                     /db_xref="CDD:330753"
     gene            complement(138317..139063)
                     /locus_tag="HHV4tp2_gp68"
                     /db_xref="GeneID:5176166"
     CDS             complement(138317..139063)
                     /locus_tag="HHV4tp2_gp68"
                     /note="membrane glycoprotein; contains Ig domain"
                     /codon_start=1
                     /product="BILF2"
                     /protein_id="YP_001129503.1"
                     /db_xref="GeneID:5176166"
                     /translation="MTHLVLLLCCCVGSVCAFFSDLVKFENVTAHAGARVNLTCSVPS
                     NESVSRIELGRGYTPGDGQLPLAVATSNNGTHITNGGYNYSLTLEWVNDSNTSVSLII
                     PNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEEDDQYHANRTLTQRMHLTVIPATT
                     IAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFPIDPWRPKTTWVHWALLLITCA
                     VVAPVLLIIIISCLGWLAGWGRRRKGWIPL"
     misc_feature    complement(138971..138985)
                     /locus_tag="HHV4tp2_gp68"
                     /note="Ig strand A' [structural motif]; Region: Ig strand
                     A'"
                     /db_xref="CDD:409353"
     misc_feature    complement(138692..138982)
                     /locus_tag="HHV4tp2_gp68"
                     /note="Immunoglobulin domain; Region: Ig; cl11960"
                     /db_xref="CDD:416386"
     misc_feature    complement(138935..138964)
                     /locus_tag="HHV4tp2_gp68"
                     /note="Ig strand B [structural motif]; Region: Ig strand
                     B"
                     /db_xref="CDD:409353"
     misc_feature    complement(138851..138871)
                     /locus_tag="HHV4tp2_gp68"
                     /note="Ig strand C [structural motif]; Region: Ig strand
                     C"
                     /db_xref="CDD:409353"
     misc_feature    complement(138839..138847)
                     /locus_tag="HHV4tp2_gp68"
                     /note="Ig strand C' [structural motif]; Region: Ig strand
                     C'"
                     /db_xref="CDD:409353"
     misc_feature    complement(138803..138820)
                     /locus_tag="HHV4tp2_gp68"
                     /note="Ig strand D [structural motif]; Region: Ig strand
                     D"
                     /db_xref="CDD:409353"
     misc_feature    complement(138752..138778)
                     /locus_tag="HHV4tp2_gp68"
                     /note="Ig strand E [structural motif]; Region: Ig strand
                     E"
                     /db_xref="CDD:409353"
     misc_feature    141396..144755
                     /note="corresponds to LF3 in NC_007605; unlikely to encode
                     a functional protein"
     repeat_region   141591..144696
                     /note="30 copies; IR4; PstI"
                     /rpt_type=direct
     rep_origin      144674..145855
                     /note="region containing oriLyt, the core lytic cycle
                     origin of DNA replication"
     repeat_region   144695..145739
                     /note="DRright; similar to DRleft"
                     /rpt_type=direct
     gene            complement(150519..151808)
                     /locus_tag="HHV4tp2_gp69"
                     /db_xref="GeneID:5176211"
     CDS             complement(150519..151808)
                     /locus_tag="HHV4tp2_gp69"
                     /note="hypothetical protein; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_001129504.1"
                     /db_xref="GeneID:5176211"
                     /translation="MAEAYPGGAHAALASRRSSFRNSLRRLRPTEKPDTSFMRGVWKY
                     EIFPSYVRVTNKQVLQLDAQCQELPPCPSVGQILSFKLPSFSFNTTTYGSRYFTVAFL
                     FFGAEDNEVFLKPFFVMHSDQDIVLSVLNPRSLFIEKGKFTWYIVPIRLVKNPYLYLQ
                     ILPGQSDIQLTRSCTQSGDKLNTSEPQIFLSGSPVTSQDECLPYLLAQHTPPFLKSYA
                     RIHTFPGKVCPVNAIRRGKGYVRVSVDTPDLKREGPLNVKVGMTLLDDVIIAFRYNPY
                     PKSHWRWDGESTDIRYFGSPVIIPPNFITELEYNNTYEAPLSSKITAVVVSHSSNPVF
                     YVYPQEWKPGQTLKLTVRNISNNPITIVTGQSMAQAFFIYAGDPSISTIMRRYIQRQG
                     CALTLPGNIVVESSSLPTFERINKTFNGNIVASEGTL"
     misc_feature    complement(150546..151799)
                     /locus_tag="HHV4tp2_gp69"
                     /note="hypothetical protein; Provisional; Region:
                     PHA03365"
                     /db_xref="CDD:177602"
     gene            complement(151769..153178)
                     /locus_tag="HHV4tp2_gp70"
                     /db_xref="GeneID:5176164"
     CDS             complement(151769..153178)
                     /locus_tag="HHV4tp2_gp70"
                     /note="derived from herpesvirus dUTPase; ORF10"
                     /codon_start=1
                     /product="LF1"
                     /protein_id="YP_001129505.1"
                     /db_xref="GeneID:5176164"
                     /translation="MALQTDTHAWRVEIGTRGLMFSNCVPLHLPEGQYHKLRLPVSAY
                     EALAVARYGLVGSLWEVPAVNSALQCLAAAAPCKDVKIYPSCIFQVHAPMFVTIKTSL
                     RCLNPHDLCLCLICVGAAILDIPLLCAPRDGAGARAAEGQAAAAQGGKLRVWGRLSPS
                     SPISLSLAFPYAGPPPVAWYRHSIKLTRSEGVGIGKDCAQDHACPVPPQGHASSAADQ
                     AGVPERGRKRAHEGPGAGEAASAGRGDVALSQSRALLWRGLGWDTGRGRLAPGLAMSR
                     DAASGSVHLDIQVDRAEEGWVCDVLLEPGPPTAREGCFLSMDPGLVTLKDAWTLFPLH
                     PEHDAVVPPKEEIHVMAQGHLQGGTPSLWGFTFQEAACDQWVLRPRVWTAHSPIKMTV
                     YNCGHKPLHIGPSTRLGLALFWPAERSDNLDAGRIFYQLTSGELYWGRTVARPPTLTL
                     PVDELRPWPKLTPEEPMQH"
     misc_feature    complement(151862..153166)
                     /locus_tag="HHV4tp2_gp70"
                     /note="Herpesvirus dUTPase protein; Region: Herpes_ORF11;
                     cl27111"
                     /db_xref="CDD:331932"
     misc_feature    join(151807..151832,156751..157036)
                     /note="corresponds to RPMS1 in NC_007605; unlikely to
                     encode a functional protein"
     gene            complement(153187..154125)
                     /locus_tag="HHV4tp2_gp71"
                     /db_xref="GeneID:5176230"
     CDS             complement(153187..154125)
                     /locus_tag="HHV4tp2_gp71"
                     /note="G-protein coupled receptor"
                     /codon_start=1
                     /product="BILF1"
                     /protein_id="YP_001129506.1"
                     /db_xref="GeneID:5176230"
                     /translation="MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLL
                     VLLILLTLAGILFIIFVRKLVHRMDVWLIALLIELLLWVLGKMIQEFSSTGLCLLTQN
                     MMFLGLMCSVWTHLGMALEKTLALFSRTPKRTSHRNVCLYLMGVFCLVLLLIIILLIT
                     MGPDANLNRGPNMCREGPTKGMHTAVQGLKAGCYLLAAVLIVLLTVIIIWKLLRTKFG
                     RKPRLICNVTFTGLICAFSWFMLSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLAL
                     LLIILYAWSFSHFMDSLKNQVTVTARYFRRVPSQST"
     gene            complement(154725..157772)
                     /locus_tag="HHV4tp2_gp72"
                     /db_xref="GeneID:5176180"
     CDS             complement(154725..157772)
                     /locus_tag="HHV4tp2_gp72"
                     /note="DNA polymerase catalytic subunit; herpesvirus core
                     gene UL30 family; ORF9"
                     /codon_start=1
                     /product="BALF5"
                     /protein_id="YP_001129507.1"
                     /db_xref="GeneID:5176180"
                     /translation="MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDV
                     RGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILET
                     VYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLD
                     VEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHPNSVCHVAT
                     WLQDKHGCRIFEANVDATRRFVLDNDFVTFGWYSCRRAIPRLQHRDSYAELEYDCEVG
                     DLSVRREDSSWPSYQALAFDIECLGEEGFPTATNEADLILQISCVLWSTGEEAGRYRR
                     ILLTLGTCEDIEGVEVYEFPSELDMLYAFFQLIRDLSVEIVTGYNVANFDWPYILDRA
                     RHIYSINPASLGKIRAGGVCEVRRPHDAGKGFLRANTKVRITGLIPIDMYAVCRDKLS
                     LSDYKLDTVARHLLGAKKEDVHYKEIPRLFAAGPEGRRRLGMYCVQDSALVMDLLNHF
                     VIHVEVAEIAKIAHIPCRRVLDDGQQIRVFSCLLAAAQKENFILPMPSASDRDGYQGA
                     TVIQPLSGFYNSPVLVVDFASLYPSIIQAHNLCYSTMITPGEEHRLAGLRPGEDYESF
                     RLTGGVYHFVKKHVHESFLASLLTSWLAKRKAIKKLLAACEDPRQRTILDKQQLAIKC
                     TCNAVYGFTGVANGLFPCLSIAETVTLQGRTMLERAKAFVEALSPANLQALAPSPDAW
                     APLNPEGQLRVIYGDTDSLFIECRGFSESETLRFAEALAAHTTRSLFVAPISLEAEKT
                     FSCLMLITKKRYVGVLTDGKTLMKGVELVRKTACKFVQTRCRRVLDLVLADARVKEAA
                     SLLSHRPFQESFTQGLPVGFLPVIDILNQAYTDLREGRVPMGELCFSTELSRKLSAYK
                     STQMPHLAVYQKFVERNEELPQIHDRIQYVFVEPKGGVKGARKTEMAEDPAYAERHGV
                     PVAVDHYFDKLLQGAANILQCLFDNNSGAALSVLQNFTARPPF"
     misc_feature    complement(156396..157367)
                     /locus_tag="HHV4tp2_gp72"
                     /note="DNA polymerase family B, exonuclease domain;
                     Region: DNA_pol_B_exo1; pfam03104"
                     /db_xref="CDD:397292"
     misc_feature    complement(154791..156206)
                     /locus_tag="HHV4tp2_gp72"
                     /note="DNA polymerase family B; Region: DNA_pol_B;
                     pfam00136"
                     /db_xref="CDD:395085"
     gene            complement(157775..160348)
                     /locus_tag="HHV4tp2_gp73"
                     /db_xref="GeneID:5176207"
     CDS             complement(157775..160348)
                     /locus_tag="HHV4tp2_gp73"
                     /note="envelope glycoprotein gB; glycoprotein BALF4; the
                     Herpesviridae are non-segmented dsDNA viruses with genomes
                     ranging from 120-230kbp; although herpes viruses vary
                     greatly in sequence identity and homology, they all share
                     four common elements: an envelope, a tegument which is
                     composed of viral enzymes, a capsid of 162 capsomers, and
                     a core composed of genomic DNA; BALF4 is a transmembrane
                     glycoprotein found in the lipid envelope of several
                     herpesviruses"
                     /codon_start=1
                     /product="glycoprotein BALF4"
                     /protein_id="YP_001129508.1"
                     /db_xref="GeneID:5176207"
                     /translation="MTRRRVLSVVVLLAALACRLGAQTPEQPAPPATTVQPTATRQQT
                     SFPFRVCELSSHGDLFRFSSDIQCPSFGTRENHTEGLLMVFKDNIIPYSFKVRSYTKI
                     VTNILIYNGWYADSVTNRHEEKFSVDSYETDQMDTIYQCYNAVKMTKDGLTRVYVDRD
                     GVNITVNLKPTGGLANGVRRYASQTELYDAPGWLIWTYRTRTTVNCLITDMMAKSNSP
                     FDFFVTTTGQTVEMSPFYDGKNKETFHERADSFHVRTNYKIVDYDNRGTNPQGERRAF
                     LDKGTYTLSWKLENRTAYCPLQHWQTFDSTIATETGKSIHFVTDEGTSSFVTNTTVGI
                     ELPDAFKCIEEQVNKTMHEKYEAVQDRYTKGQEAITYFITSGGLLLAWLPLTPRSLAT
                     VKNLTELTTPTSSPPSSPSPPAPPAARGSTSAAVLRRRRRDAGNATTPVPPAAPGKSL
                     GTLNNPATVQIQFAYDSLRRQINRMLGDLARAWCLEQKRQNMVLRELTKINPTTVMSS
                     IYGKAVAAKRLGDVISVSQCVPVNQATVTLRKSMRVPGSETMCYSRPLVSFSFINDTK
                     TYEGQLGTDNEIFLTKKMTEVCQATSQYYFQSGNEIHVYNDYHHFKTIELDGIATLQT
                     FISLNTSLIENIDFASLELYSRDEQRASNVFDLEGIFREYNFQAQNIAGLRKDLDNAV
                     SNGRNQFVDGLGELMDSLGSVGQSITNLVSTVGGLFSSLVSGFISFFKNPFGGMLILV
                     LVAGVVILVISLTRRTRQMSQQPVQMLYPGIDELAQQHASGEGPGINPISKTELQAIM
                     LALHEQNQEQKRAAQRAAGPSVASRALQAARDRFPGLRRRRYHDPETAAALLGEAETE
                     F"
     misc_feature    complement(157829..160279)
                     /locus_tag="HHV4tp2_gp73"
                     /note="glycoprotein BALF4; Provisional; Region: PHA03231"
                     /db_xref="CDD:223014"
     misc_feature    join(158136..158221,158330..158412,160109..160235,
                     161265..161349)
                     /note="corresponds to A73 in NC_007605; unlikely to encode
                     a functional protein"
     gene            complement(160335..162392)
                     /locus_tag="HHV4tp2_gp74"
                     /db_xref="GeneID:5176189"
     CDS             complement(160335..162392)
                     /locus_tag="HHV4tp2_gp74"
                     /note="subunit of terminase; herpesvirus core gene UL28
                     family; ORF7"
                     /codon_start=1
                     /product="BALF3"
                     /protein_id="YP_001129509.1"
                     /db_xref="GeneID:5176189"
                     /translation="MSGLLAAAYSQVYALAVELSVCARLDPRSLDVAAVVRNAGLLAE
                     LEAILLPRLRRQNDRACSALSLELVHLLENSREASAALLAPGRKGTRVPPLRTPSVAY
                     SVEFYGGHKVDVSLCLINDIEILMKRINSVFYCMSHTMGLESLERALDLLGRFRGVSP
                     IPDPRLYITSVPCWRCVGELMVLPNHGNPSTAEGTHVSCNHLAVPVNPEPVSGLFENE
                     VRQAGLGHLLEAEEKARPGGPEEGAVPGPGRPEAEGATRALDTYNVFSTVPPEVAELS
                     ELLYWNSGGHAIGATGQGEGGGHSRLSALFARERRLALVRRACEEALAGARLTHLFDA
                     VAPGATERLFCGGVYSSSGDAVEALKADCAAAFTAHPQYRAILQKRNELYTRLNRAMQ
                     RLGRGEEEASRESPEVPRPAGAREPGPSGALSDALKRKEQYLRQVATEGLAKLQSCLA
                     QQSETLTETLCLRVWGDVVYWELARMRNHFLYRRAFVSGPWEDRRAGEGAAFENSKYI
                     KTHLFTQTLSSEHLHALTHSLYTFITGPLAEESGLFPPPSNVALARCCDAAGTLPHQK
                     AFLTSLIWPGIEPSDWIETSFNSFYSVPGGSLASSQQILCRALREAVLTVSLYNKTWG
                     RSLILRRADAVSPGQALPPDGLYLTYDSDRPLILLYKGRGWVFKDLYALLYLHLQMRD
                     DSA"
     misc_feature    complement(160584..162389)
                     /locus_tag="HHV4tp2_gp74"
                     /note="Herpesvirus processing and transport protein;
                     Region: PRTP; pfam01366"
                     /db_xref="CDD:279677"
     misc_feature    160605..162020
                     /note="corresponds to BARF0 in NC_007605; unlikely to
                     encode a functional protein"
     gene            complement(162410..165796)
                     /locus_tag="HHV4tp2_gp75"
                     /db_xref="GeneID:5176206"
     CDS             complement(162410..165796)
                     /locus_tag="HHV4tp2_gp75"
                     /note="single-stranded DNA-binding protein;
                     single-stranded DNA binding protein; the Herpesviridae are
                     non-segmented dsDNA viruses with genomes ranging from
                     120-230kbp; although herpes viruses vary greatly in
                     sequence identity and homology, they all share four common
                     elements: an envelope, a tegument which is composed of
                     viral enzymes, a capsid of 162 capsomers, and a core
                     composed of genomic DNA; the single-stranded DNA binding
                     protein is a subunit of the replication fork machinery
                     involved in virion DNA replication"
                     /codon_start=1
                     /product="single-stranded DNA binding protein"
                     /protein_id="YP_001129510.1"
                     /db_xref="GeneID:5176206"
                     /translation="MQGAQTSEDNLGSQSQPGPCGYIYFYPLATYPLREVATLGTGYA
                     GHRCLTVPLLCGITVEPGFSINVKALHRRPDPNCGLLRATSYHRDIYVFHNAHMVPPI
                     FEGPGLEALCGETREVFGYDAYSALPRESSEPGDFFPEGLDPSAYLGAVAITEAFKER
                     LYSGNLVAIPSLKQEVAVGQSASVRVPLYDKEVFPEGVPQLRQFYNSDLSRCMHEALY
                     TGLAQALRVRRVGKLVELLEKQSLQDQAKVAKVAPLKEFPASTISHPDSGALMIVDSA
                     ACELAVSYAPAMLEASHETPASLNYDSWPLFADCEGPEARVAALHRYNASLAPHVSTQ
                     IFATNSVLYVSGVSKSTGQGKESLFNSFYMTHGLGTLQEGTWDPCRRPCFSGWGGPDV
                     TGTNGPGNYAVEHLVYAASFSPNLLARYAYYLQFCQGQKSSLTPVPETGSYVAGAAAS
                     PMCSLCEGRAPAVCLNTLFFRLRDRFPPVMSTQRRDPYVISGASGSYNETDFLGNFLN
                     FIDKEDDGQRPDDEPRYTYWQLNQNLLERLSRLGIDAEGKLEKEPHGPRDFVKMFKDV
                     DAAVDAEVVQFMNSMAKNNITYKDLVKSCYHVMQYSCNPFAQPACPIFTQLFYRSLLT
                     ILQDISLPICMCYENDNPGLGQSPPEWLKGHYQTLCTNFRSLAIDKGVLTAKEAKVVH
                     GEPTCDLPDLDAALQGRVYGRRLPVRMSKVLMLCPRNIKIKNRVVFTGENAALQNSFI
                     KSTTRRENYIINGPYMKFLNTYHKTLFPDTKLSSLYLWHNFSRRRSVPVPSGASAEEY
                     SDLALFVDGGSRAHEESNVIDVVPGNLVTYAKQRLNNAILKACGQTQFYISLIQGLVP
                     RTQSVPARDYPHVLGTRAVESAAAYAEATSSLTATTVVCAATDCLSQVCKARPVVTLP
                     VTINKYTGVNGNNQIFQAGNLGYFMGRGVDRNLLQAPGAGLRKQAGGSSMRKKFVFAT
                     PTLGLTVKRRTQAATTYEIENIRAGLEAIISQKQEEDCVFDVVCNLVDAMGEACASLT
                     RDDAEYLLGRFSVLADSVLETLATIASSGIEWTAGAARDFLEGVWGGPGAAQDNFISV
                     AEPVSTASQASAGLLLGGGGQGSGGRRKRRLATVLPGLEV"
     misc_feature    complement(162497..165781)
                     /locus_tag="HHV4tp2_gp75"
                     /note="single-stranded DNA binding protein; Provisional;
                     Region: PHA03367"
                     /db_xref="CDD:223059"
     gene            complement(165881..166429)
                     /locus_tag="HHV4tp2_gp76"
                     /db_xref="GeneID:5176161"
     CDS             complement(165881..166429)
                     /locus_tag="HHV4tp2_gp76"
                     /note="vbcl-2b"
                     /codon_start=1
                     /product="BALF1"
                     /protein_id="YP_001129511.1"
                     /db_xref="GeneID:5176161"
                     /translation="MRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVF
                     TRDEKDLPLPALVLCRLIKASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYN
                     DHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPR
                     SLRRQFPVTWALASLTDFLKSL"
     misc_feature    complement(165884..166429)
                     /locus_tag="HHV4tp2_gp76"
                     /note="BALF1 protein; Region: BALF1; pfam06861"
                     /db_xref="CDD:115513"
     gene            166530..167195
                     /locus_tag="HHV4tp2_gp77"
                     /db_xref="GeneID:5176183"
     CDS             166530..167195
                     /locus_tag="HHV4tp2_gp77"
                     /note="BARF1; the Herpesviridae are non-segmented dsDNA
                     viruses with genomes ranging from 120-230kbp; although
                     herpes viruses vary greatly in sequence identity and
                     homology, they all share four common elements: an
                     envelope, a tegument which is composed of viral enzymes, a
                     capsid of 162 capsomers, and a core composed of genomic
                     DNA; BARF1 inhibits alpha interferon to modulate the host
                     immune response to viral infection"
                     /codon_start=1
                     /product="BARF1"
                     /protein_id="YP_001129512.1"
                     /db_xref="GeneID:5176183"
                     /translation="MARFIAQLLLLASCVAAGQAVTAFLGERVTLTSYWRRVSLGPEI
                     EVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNY
                     LCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLM
                     PEGVEPAPTAANGGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGY
                     LSQ"
     misc_feature    166530..167192
                     /locus_tag="HHV4tp2_gp77"
                     /note="BARF1; Provisional; Region: PHA03376"
                     /db_xref="CDD:177613"
     gene            complement(168024..168320)
                     /locus_tag="HHV4tp2_gp78"
                     /db_xref="GeneID:5176220"
     CDS             complement(168024..168320)
                     /locus_tag="HHV4tp2_gp78"
                     /codon_start=1
                     /product="BNLF2b"
                     /protein_id="YP_001129513.1"
                     /db_xref="GeneID:5176220"
                     /translation="MRPGRPLAGFYATLRRSFRRMSKRSKNKAKKERVPVEDRPPTPM
                     PTSQRLIRRNALGGGVRPDAEDCIQRCHPLEPALGVSTKNFDLLSLRCELGWCG"
     gene            complement(168330..168512)
                     /locus_tag="HHV4tp2_gp79"
                     /db_xref="GeneID:5176159"
     CDS             complement(168330..168512)
                     /locus_tag="HHV4tp2_gp79"
                     /note="contains hydrophobic domain"
                     /codon_start=1
                     /product="BNLF2a"
                     /protein_id="YP_001129514.1"
                     /db_xref="GeneID:5176159"
                     /translation="MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLL
                     LVVLCVLFGLLCLLLI"
     gene            complement(169188..170457)
                     /locus_tag="HHV4tp2_gp80"
                     /db_xref="GeneID:5176215"
     CDS             complement(join(169188..169948,170025..170111,
                     170190..170457))
                     /locus_tag="HHV4tp2_gp80"
                     /note="transmembrane protein expressed in latent
                     infection; functional similarity to CD40; role in
                     transformation"
                     /codon_start=1
                     /product="LMP-1"
                     /protein_id="YP_001129515.1"
                     /db_xref="GeneID:5176215"
                     /translation="MEHDLERGPPGPRRPPRGPPLSSSLGLALLLLLLALLFWLYIVM
                     SDWTGGALLVLYSFALILIIIILIIFIFRRDLLCPLGALCLLLLMITLLLIALWNLHG
                     QALYLGIVLFIFGCLLVLGLWIYLLEILWRLGATIWQLLAFFLAFFLDLILLIIALYL
                     QQNWWTLLVDLLWLLLFLAILIWMYYHGQRHSDEHHHDDSLPHPQQATDDSGHESDSN
                     SNEGRHHLLVTGAGDGPPLCSQNLGAPGGGPDNGPQDPDNTDDNGPQDPDNTDDNGPQ
                     DPDNTDDNGPQDPDNTADNGPHDPLPHNPSDSAGNDGGPPNLTEEVENKGGDRGPPSM
                     TDGGGGDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD"
     misc_feature    complement(join(169191..169948,170025..170111,
                     170190..170457))
                     /locus_tag="HHV4tp2_gp80"
                     /note="Herpesvirus latent membrane protein 1 (LMP1);
                     Region: Herpes_LMP1; pfam05297"
                     /db_xref="CDD:283060"
     repeat_region   171077..172734
                     /locus_tag="HHV4tp2_gp01"
                     /note="TR"
                     /rpt_type=direct
                     /rpt_unit_range=171077..172634
ORIGIN      
        1 agaatttgtc ttgctctatt caccgttact tttcttcttg cccgttctct ttcttagtat
       61 gaatccagta tgcctgcctg taattgttgc gccctacctg ttttggctgg cggctattgc
      121 cgcctcgtgt ttcacggcct cagttagtac cgttgtgacc gccaccggct tggccctctc
      181 acttctactc ttggcagcag tggccagctc atatgccgct gcacaaagga aactgctgac
      241 accggtgaca gttcttactg cggttgtcac ttgtgagtac acacgcacca tttacaatgc
      301 atgatgttcg tgagattgat ctgtctctaa cagttcactt cctctgcttt tctcctcagt
      361 ctttgcaatt tgcctaacat ggaggattga ggacccacct tttaattctc ttctgtttgc
      421 attgctggcc gcagctggcg gactacaagg catttacggt tagtgtgcct ctgtgatgga
      481 atgcaggttt gacttcatat gtatgccttg gcatgacgtc aactttactt ttatttcagt
      541 tctggtgatg cttgtgctcc tgatactagc gtacagaagg agatggcgcc gtttgactgt
      601 ttgtggcggc atcatgtttt tggcatgtgt acttgtcctt atcgtcgacg ctgttttgca
      661 gctgagtccc ctccttggag ctgtaactgt ggtttccatg acgctgctgc tactggcttt
      721 cgtcctctgg ctctcttcgc cagggggcct aggtactctt ggtgcagccc ttttaacgtt
      781 ggcagcaggt aagccacacg tgtgacattg cttgcctttt tgccacatgt tttctggaca
      841 caggactaac catgccatct ctgattatag ctctggcact gctagcgtca ctgattttgg
      901 gcacacttaa cttgactaca atgttccttc tcatgctcct atggacactt ggtaagtttt
      961 cccttccttt aactcattac ttgttctttt gtaatcgcag ctctaacttg gcatctcttt
     1021 tacagtggtt ctcctgattt gctcttcgtg ctcttcatgt ccactgagca agatccttct
     1081 ggcacgactg ttcctatatg ctctcgcact cttgttgcta gcctccgcgc taatcgctgg
     1141 tggcagtatt ttgcaaacaa acttcaagag tttaagcagc actgaattta tacccagtga
     1201 gtatctattt gttactcctg tttagttgaa gaaaacaagc tattggattg taacacacat
     1261 tttacgcttt gttccttaga tttgttctgc atgttattac tgattgtcgc tggcatactc
     1321 ttcattcttg ctatcctgac cgaatggggc agtggaaata gaacatacgg tccagttttt
     1381 atgtgcctcg gtggcctgct caccatggta gccggcgctg tgtggctgac ggtgatgact
     1441 aacacgcttt tgtctgcctg gattcttaca gcaggattcc tgattttcct cattggtaag
     1501 tgtgacacca acaggtgttg ccttgttatg tcaccgttct gacacatgac ttacatgggt
     1561 ttggcttttg taggctttgc cctctttggg gtcattagat gctgccgcta ctgctgctac
     1621 tactgcctta cactggaaag tgaggagcgc ccaccgaccc catatcgcaa cactgtataa
     1681 aggtaagtat tattaaattt tagagacact atcacgtgta acttgacgtg caaggatgga
     1741 ggataggggc agggaaacgc aaatgccggt tgcccggtat gggggcccgt ttattatggt
     1801 aaggctcttc gggcaagatg gagaggcaaa catacaggag caaaggctat atgagctact
     1861 ctctgacccc cgctccgcgc tcggcctaga cccggggccc ctgattgctg agaacctgct
     1921 gctagtggcg ctgcgtggca ccaacaacga tcccaggcct cagcgtcagg agagggccag
     1981 agaactggcc ctcgttggca ttctactagg aaacggcgag cagggtgaac acttgggcac
     2041 ggagagtgcc ctggaggcct caggcaacaa ctatgtgtat gcctacggac cagactggat
     2101 ggcaaggcct tccacatggt ccgcggaaat ccagcaattc ctgcgactcc tgggcgccac
     2161 gtacgtgctt cgcgtggaga tgggcaggca gtttggcttc gaggtgcata gaagccggcc
     2221 ctccttccgt cagttccagg ccatcaatca tcttgtcctg tttgacaacg cccttcgcaa
     2281 gtacgattcc ggccaggtgg cggcgggctt ccagagggcc cttctggtgg ccgggccaga
     2341 gaccgctgac acgaggccgg acctccgcaa gctgaatgag tgggtgtttg gtggcagggc
     2401 tgctggtggc agacagctgg ccgacgagct aaagatcgtg tccgcgctgc gagacactta
     2461 ctcgggccac ttggtccttc agcccacgga gacccttgac acatggaagg tgttgagcag
     2521 ggacacacga accgctcata gtttggagca cggattcatt catgccgcgg ggaccatcca
     2581 ggccaactgc ccacagctgt ttatgagacg ccagcacccc ggcctctttc ccttcgttag
     2641 tgcaatagca tcatcgctgg gctggtacta ccagaccgcc accggccccg gagcagatgc
     2701 cagggcggcg gcccggcgtc aacaggcctt tcagaccagg gcggcggctg aatgccatgc
     2761 caaaagcggg gtgccggtcg tggccggctt ctataggacc atcaacgcca cgctcaaggg
     2821 aggagagggc ctacagccca ctatgtttaa cggggagctg ggggccatca agcaccaggc
     2881 acttgacact gtgaggtatg actacggcca ctatctcata atgttggggc cattccagcc
     2941 atggagcgga ctgacggccc ctccgtgccc ttacgccgaa agttcatggg cacaggcggc
     3001 cgtgcagacg gccctcgagc tgttctcggc cctgtacccg gccccgtgca tctcgggcta
     3061 cgcgcgcccc ccgggcccca gtgctgtgat cgagcatctg gggtccctag tcccaaaggg
     3121 gggtctgctg ttgtttctgt ctcacctacc ggatgatgtt aaggacgggc tcggagaaat
     3181 ggggccggcc agggccacgg gacctggaat gcagcagttt gtcagcagct acttcctcaa
     3241 ccccgcctgt tccaacgtct tcattacagt gaggcagcga ggggaaaaga tcaacggccg
     3301 taccgtcctc caagcgctcg gacgcgcatg cgatatggca ggctgccagc actatgtgct
     3361 gggctccacg gttcccctcg gtggactcaa ctttgtcaac gacctggcgt ccccggtttc
     3421 caccgccgag atgatggatg atttctctcc cttcttcacc gtggagtttc ccccgattca
     3481 agaggagggc gcacgttctc cggtaccctt agatgtggac gagagcatgg acatctctcc
     3541 gtcttacgag ttgccctggc tctcgctgga gtcatgcctc acaagcatcc tgtcacaccc
     3601 caccgtggga agcaaggagc acttggtcag gcacacggac agggtcagcg gaggacgcgt
     3661 ggcacagcag cccggggtag gtcccctgga cctgccgctg gcggactacg ccttcgttgc
     3721 ccacagtcag gtctggacca ggcccggtgg ggctcctccc ttgccctatc gtacctggga
     3781 tcgaatgaca gagaagctgc ttgtctccgc aaagcccggc ggagagaacg ttaaggtttc
     3841 aggtaccgtg attacattgg gagaacaggg gtacaaagtg tcgttggatc tgagggaggg
     3901 aaccaggctg gcaatggctg aggcgctgct gaatgcagca tttgccccaa tcttggatcc
     3961 ggaagacgtc ttgctcaccc tgcatctaca cctggatccg cgccgggcag acaactcggt
     4021 cgtgatggag gctatgacgg cggcgagtga ctacgcgcgt ggcctgggcg tgaagctgac
     4081 ctttggctcg gcctcctgcc ccgagaccgg ctcgtccgcc tccagcttca tgactgtggt
     4141 ggcctctgtc tccgccccag gggaattctc gggtcctctg atcacgccag tgcttcagaa
     4201 gacgggcagt ctcctgattg cggtgcgttg cggggatggc aagatccagg gagggtcgct
     4261 gtttgagcag ctctttagcg acgtggccac gaccccacgg gcgcccgagg cgttgtctct
     4321 gaagaatctc ttccgggcag tccagcagct ggtcaagagc ggcatcgtgc tgtcagggca
     4381 tgacatcagc gacgggggcc tggtgacctg cctggtggag atggccctgg ccgggcagcg
     4441 gggagtgacc atcactatgc cggtggcctc cgactacctc ccggagatgt ttgcagagca
     4501 ccccggcctg gtgtttgagg tggaggagcg cagcgtgggt gaggtgctgc agaccctgcg
     4561 ctccatgaac atgtacccgg cagtcctcgg tcgagtgggc gagcaaggtc cagatcaaat
     4621 gtttgaggtg cagcacggcc cagagacggt gttgcgccag tcgctgcgcc tgctgctggg
     4681 aacctggtcc tcctttgcca gcgagcagta cgagtgcctg cgaccagatc ggattaaccg
     4741 gtccatgcac gtttccgact acggctataa cgaagcactg gcagtctccc cgttgacagg
     4801 aaagaatctc agcccacgcc ggctggtgac agagcctgac ccacgatgtc aggtggccgt
     4861 gctatgcgcc ccgggcacca ggggccatga aagcctcctg gcggccttca cgaatgccgg
     4921 atgcctgtgc cgacgggtgt tctttcgcga ggttagggac aacacgttcc tcgacaagta
     4981 cgtgggtctg gccatcggag gagttcatgg ggccagggac tctgccctgg caggccgtgc
     5041 caccgtggcg ctgattaatc gttcccccgc cctgcgtgac gctattctaa agttcctcaa
     5101 caggccagat acgttctcgg tggccttggg ggagctgggg gtgcaagttt tggctggcct
     5161 gggggccgtg gggtcaacag ataatccacc cgcccctggc gtggaagtta atgtccagag
     5221 atcacctctg attctggccc ccaacgcctc tggcatgttt gagtcccgct ggctgaacat
     5281 tagcatcccg gcgaccacca gctctgtcat gctgcgtggc ctccggggct gcgtcctgcc
     5341 ttgttgggtg caaggctcgt gcctgggcct gcaatttact aacctcggga tgccatatgt
     5401 tttgcagaat gcccaccaga tcgcctgcca cttccacagc aatggcacgg acgcctggcg
     5461 ctttgctatg aattatccaa gaaaccccac ggagcagggc aacattgcag ggctctgttc
     5521 acgcgatggt cgtcatctgg ctctcctgtg tgacccctca ctttgtacag acttttggca
     5581 atgggagcac attccccccg cctttgggca ccccacgggg tgctccccct ggacacttat
     5641 gtttcaagca gctcacctat ggtcactcag gcacggtcgc ccctccgagt gaccagtcac
     5701 cttccagact atgcatacac tgaatttagc ctgatattgt cccccgagcc ccgggcccag
     5761 ccctcctcag aaaactctgc atggagaagc tggacgtgaa ccttcccccc ccccccgacc
     5821 tgtgtgctgt atttacaaac actacaataa acccaatgtg caaatgtggt ttgtatggct
     5881 actttgtgtt cctaaaaaat gcaacaatag aagtggaaac cctcagtcac gggacattaa
     5941 cctcaaccac aaaatggggg ttggagaaag taaccacata tactggagat gattcatggg
     6001 ctgggggttc ccggacaata cacccatctg gagttcaact taattacatg gtagataaat
     6061 taagagtccc tcctcaccac tcgaaactat ggcagacatt ctataagata acgaggagag
     6121 atgaggtgag ggcagaggac attgggcagg tgtgggccac ggggcagctg gccatatccc
     6181 ccgcaccaca gaagtgtaag caaagtgaag ggctcggaag gcaggcgggg cctagcaatg
     6241 tcacagctaa atgcccacca gggcacacac tcaagcgggg tctcggagct cctaggtcag
     6301 accacgaaag gtcagcctgc aaggtggatg gcgtgttttc tgaggttatc cccgctacgt
     6361 gcagtgctgg gtgagagaga ccctagaatg tgtcgaaatg accaagcgtc cccgcagcgg
     6421 ggctcccaac acgggttccc agagagggta aaagaggggg ccataaagcc cagggtgtaa
     6481 aacaccgacc gcgccaccag atggcacacg tgggggaaat gagggttagc ataggcaacc
     6541 cccgcctaca caccaactat agcaaacccc gccccgtcac ggtgacgtag tctgtcttga
     6601 ggagatgtag acttgtagac actgcaaaac ctcaggacct acgctgccct agaggttttg
     6661 ctagggagga gacgtgtgtg gctgtagcca cccgtcccgg gtacaagtcc cgggtggtga
     6721 ggacggtgtc tgtggttgtc ttcccagact ctgctttctg ccgtcttcgg tcaagtacca
     6781 gctggtggtc cgcatgtttt gatccaaact ttagttttag gatttatgca tccattatcc
     6841 cgcagttcca cctaaacggg gcttaacgtt gcatcccaga agatgcacac gtaaccccgc
     6901 ctacaaccgt gacgtggctg tttaccagca tatatagagt tacggttcac tacatcaaac
     6961 aggacagccg ttgccctagt ggtttcggac acaccgccaa cgctcagtgc ggtgctaccg
     7021 acccgaggtc aagtcccggg ggaggagaag agaggcttcc cgcctagagc atttgcaagt
     7081 caggattctc taatccctct gggagaaggg tattcggctt gtccgctgtt tttttgtggc
     7141 tagttttgca cccacaacat gtaagggccc gctaccccta caacacaaaa caaactatct
     7201 ccactaacca tccttttgcc aatcaattct gtgacggggt ttcctggaca cccagtctta
     7261 gttcaggtag acacccagtt atgcagtgcc accaattcca accattttta aacctcctgg
     7321 aattctatca ttaaacggca tgcaggaaaa ggacaagcag cgaaaattca cgcccccttg
     7381 ggaggtggcg gcatatgcaa aggatagcac tcccactcta ctactgggta ttatatgctg
     7441 actgtatatg cattaggata gcatatgcta cccagatata gattaggata gcatatgcta
     7501 cccggatata gattaggata gcatatacta cccaaataga gattaggata gcatatgcta
     7561 cccaaataga gattaggata gcatatgcta cccggatata gattaggata gcatatacta
     7621 cccaaataga gattaggata gcatatgcta cccaaataga gattaggata gcatatgcta
     7681 cccggatata gattaggata gcatatgcta cccaaataga gattgggata gcatatgcta
     7741 cccggatata gattaggata gcatatgcta cccaaataga gattaggata gcatatgcta
     7801 cccggatata gattaggata gcatatgcta cccaaataga gattgggata gcatatgcta
     7861 tcctaatctc tatctgggta gcatatacta tcctaatctc tatatgggta gcatatgcta
     7921 tcctaatcta tatctgggta gcatatacta tcctaatctc tatatgggta gcatatgcta
     7981 tcctaatcta tatctgggta gcatatgcta tccatcgcaa cattagccca ccgtgctctc
     8041 aacgacctcg tgaatatgag gaccaacaac cctgtgcttg gcgctcaggc gcaagtgtgt
     8101 gtaacttgtc ttccagatcg cagcaatcgc gcccctatct tggcccgccc acctacttat
     8161 gcaggtattc cccggggtgc cattagtggt tttgtgggca agtggtttga ccgcagtggt
     8221 tagcggggtt acaatcagcc aagttattac acccttagtt tacagtccaa aaccgcaggg
     8281 cggcgtgtgg gggctgacgc gtgcccccac tccacaattt caaaaaaaag agtggccact
     8341 tgtctttgtt tatgggcccc attggcgtgg agccccgttt aattttcggg ggtgttagag
     8401 acaaccagtg gagtccgctg ctgtcggcgt ccactctctt tccccttgtt acaaatagag
     8461 tgtaacaaca tggttcacct gtcttggtcc ctgcctggga cacatcttaa taaccccagt
     8521 atcatattgc actaggatta tgtgttgccc atagccataa attcgtgtga gatggacatc
     8581 cagtctttac ggcttgtccc caccccatgg atttctattg ttaaagatat tcagaatgtt
     8641 tcattcctac actagtattt attgcccaag gagtttgtga gggttatatt ggtgtcatag
     8701 cacaatgcca ccactgaacc ccccgtccaa attttattct gggggcgtca cctgaaacct
     8761 tgttttcgag cacctcacat acaccttact gttcacaact cagcagttat tctattagct
     8821 aaacgaagga gaatgaagaa gcaggcgaag attcaggaga gttcactgcc cgctccttga
     8881 tcttcagcca ctgcccttgt gactaaaatg gttcactacc ctcgtggaat cctgatccca
     8941 tgtaaataaa accgtgacag ctcatggggt gggagatatc gctgttcctt aggacccttt
     9001 tactaaccct aattcgatag catatgcttc ccgttgggta acatgtgcta ttgaattagg
     9061 gttagtctgg atagtatatg ctactacccg ggaagcatat gctacccgtt tagggttaaa
     9121 aagggggcct tataaacact cttgctaacg ccctcttgag ggtccgctta tcggtagcta
     9181 cacaggcccc tctgattgac gttggtgtag cctcccatag tcttcctggg cccctgggag
     9241 gtacatgtcc cccagcattg gtgtaagagc ttcaaccaag agttacacat aaaggcaatg
     9301 ttgtgttgca gtccacagac tgcaaagtct gcttcaggat gaaagccact cagtgttggc
     9361 aaatgtgcac atccatttat aaggatgtca actacagtca gagaacccct ttgtgtttgg
     9421 tccccccccc gtgtcacatg tggaacaggg cccagttggc aagttgtacc aaccaactga
     9481 agggattaca tgcactgccc cgcgggaaat acgtcctacc caggaacccg aaacagtgtt
     9541 tcccagaagc tgtaaaaata gaacgccctg gaactgcccc actgtgcaat gcagctttta
     9601 gccatgccat gctctataaa tcacttccct atctcaggta ggcctgcaca ccttaggtat
     9661 ggagcgaagg ttagtggtca ctctgcagtg cctggtgctg ctttacctgg cacctgagtg
     9721 tggaggtaca gaccaatgtg acaattttcc ccaaatgttg agggacctaa gggatgcctt
     9781 cagtcgtgtt aaaacctttt tccagacaaa ggacgaggta gataaccttt tgctcaagga
     9841 gtctctgcta gaggacttta agggctacct tggatgccag gccctgtcag aaatgatcca
     9901 attctacctg gaggaagtca tgccacaggc tgaaaaccag gaccctgaag ccaaagacca
     9961 tgtaaattct ttgggtgaaa atctaaagac cctacggctc cgcctgcgca ggtgccacag
    10021 gttcctgccg tgtgagaaca agagtaaagc tgtggaacag ataaaaaatg cctttaacaa
    10081 gctgcaggaa aaaggaattt acaaagccat gagtgaattt gacattttta ttaactacat
    10141 agaagcatac atgacaatta aagccaggtg ataattccat accctggaag caggagatgg
    10201 gtgcatttca ccccaacccc ccctttcgac tgtcatttac aataaaatga aaccttttat
    10261 tcttgattgc ctcttgtgtt cttgccgccc aggtaccttc ctgtgttctc cccacgggaa
    10321 aaagaatagc ttctgcagaa ggccattgac gcaagttttg cccgtgggga ttacccgacc
    10381 cggccactta cagcacattt tgttctaggt ccatcttagg agcccgggcc agcattctat
    10441 cagcttaacg ggaagagaag tggggagggc actcgcccac taaccttaac acctgcagcc
    10501 tacaaaagta cactagctgt ttgctctatt cgccactaga gaccgccaag atgcgaaact
    10561 gcaggcccgg gcccaggcct tgtagggcag acggttaggc tgacaagggg acaagtgtgg
    10621 caggtgggcg ggaaggggca caagaatgac ggcgaaactg gaccacggtc caccccgccc
    10681 tcaagcgtcc gggagccagg cggttcggtt aaggagggcg gccttgcgaa caatcattag
    10741 tagctaccaa caagggcccc cagatgcccc ccaccagtca ccccggccgt gtccactcac
    10801 atattccact cttattttta aattaatgtg tcccaattag aaacccaagc gcagaaatta
    10861 gttgagaggc tagtgtttta aacatgcacc ctaggccagc cagagataat gtcacaagac
    10921 tatcaagttg gtgtaaacac gccgtgggaa aaaatttatg gttcagtgcg tcgagtgcta
    10981 tctttggaac agtagaaaat tgaaccttgt tggcgggaga aggcataacg ccttatctgg
    11041 gaggagcgac ggattatagc caataagaga gctcaagacg cagggctcgc aaagtatagt
    11101 ggccccgtgg gaccttagag gtggagcaac gtctaaagtg gtaataacac caggcggggc
    11161 tgggcaaagg ggtcctacgg gcgggattaa ttacgccttg cttacgcaag ctcagttaat
    11221 tcgcccacga cttgaaaaat gtagccctta accaattggc ggcccctaag ggggggacta
    11281 aggtcccact acaaaaactc tgtgttctgc tgcaaatttt agataagatg gcatagagac
    11341 aaggacaccg aagaccccca gagccctcat cgcagggttc ttaccatgcg gccatgtagg
    11401 cccacttaac actacaagac ctacgcctct ccattcatca tgtaacccac aaatcatcta
    11461 aaccgtaagt ctaagggcct cctgaggttt tctcaggagg ccctaatgta taattaatca
    11521 tgcatttgat tttaaaaaag taggttacac tcattttagg ccagacttta tttgcagatt
    11581 aataatttat gtgattctcc ttccctctag gactgaagaa acagcctcct gcacgtgagc
    11641 atgtatctga aataattatt atgtcataag tgtaatgatt agaaagtcat aaacccactt
    11701 ccctttacat gaatctgggc actgaatttt ggggtacttc taaagactaa cgtgttcgat
    11761 ttcggggtca cttccccttt tataagtgtg tgaacagtga tttcagtaaa acctaagaga
    11821 tatttggtgt cacttccgca ttttaagttt cagaaaattt taaaattaaa attgaaattt
    11881 ctctcaaaat aattccaatg aaaacttcaa agaatcttat gtatgtaatt cttttgcccc
    11941 aaactgggct tcagatgcct tctattgcac tctcacaaaa acattctgga cacatgtgcc
    12001 agacgcctgg gcctctaagg ccctcgggtc cccctggacc ccggcctcag caaccctgct
    12061 gctcccctcc tgccacccca gcctcccccc ctccccgtcc cccttcgctc cttatcctcc
    12121 cccggtcccc agtagggccg cctgcccccc tgcacccagt acctgcccct cttggccacg
    12181 caccccgggc caggccacct tagacccggc caagccccat ccctgaagac ccagcggcca
    12241 ttctctctgg taacgagcag agaagaagta gaggcccgcg gccattgggc ccagattgag
    12301 agaccagtcc aggggcccga ggttggagcc agcgggcacc cgaggtccca gcacccggtc
    12361 cctccggggg gcagagacag gcagggcccc ccggcagctg gccccgagga ggcgcccgga
    12421 gtggggccgg tcggctgggc tggccgagcc cgggtctggg aggtctgggg tggcgagcct
    12481 gctgtctcag gaggggcctg gctccgccgg gtggccctgg ggtaagtctg ggaggcagag
    12541 ggacggccta ggcccgggga agtggagggg gatcgcccgg gtctctgttg gcagagtccg
    12601 ggcgatcctc tgagaccctc cgggcccgga cggccgccct cggcccccca gacagacccc
    12661 agggtctcca ggcagggtcc ggcatctcca ggggcagcag gctcaccacc acaggccccc
    12721 cagacccggg tctcggccag ccgagccgac cggccccgcg ccgggcgcct cctcggagcc
    12781 agcccccggg gttggttctg cccctctctc tgtccttcag aggaaccagg gacctcgggc
    12841 accccagagc ccctcgggcc cgcctccagg cgccctcctg gtctccgctc ccctctgagc
    12901 cccgttaaac ccaaagaatg tctgagggga gccaccctcg gggcccaggc cccagagtcc
    12961 agaggtcagg ggcacctcag ggtgcctccc cgggtcccag gccagccgga gggaccccgg
    13021 cagcccgggc ggccccagag gccggttcct cgccccttcc ccgggcttca gagcccaggg
    13081 tgtcccccag aagggaccct aggcgtcccc tctcctcccc tccaggcccg agcctctccc
    13141 tcgcggagag gggcctcttc gagccctcaa gtccagtccc accgagaccc gagtggcccg
    13201 gatcccccac cggcccttct ctttccccct actcctctcc aaccttcgct ccaccctaga
    13261 ccccagcttc tggcctcccc gggtccacca ggccagccgg agggaccccg gcagcccggg
    13321 cgagtcgcct tccctctccc ctggcctctc cttcccgcct cccacccgag ccccctcagc
    13381 ttgcctcccc accgggtcca tcaggccggc cggagggacc ccggcggccc ggtgtcagtt
    13441 ccccctgcag ccgcccagtc tctgcctcca ggcaagggcg ccagcttttc tccccccagc
    13501 ctgaggccca ggctcctgtg cactgtctgt aaagtccagc ctcccacgcc cgtccacggc
    13561 tcccaggccc agccccgtcc acccctcccc acgttggaca ggccctctgt ccacccgggc
    13621 catccccgcc cccctgtgtc caccccagtc ccgtccaggg gggactttat gtgacccttg
    13681 ggcctggctc cccatagact cccatgtaag cctgcctcga gtaggtgcct ccagagcccc
    13741 ttttgccccc ctggcggccc agcccgaccc ccgggcgccc ccaaactttg tccagatgtc
    13801 caggggtccc cgagggcgag gcccagcccc ctcccgcccc tgtccactgc cccggtcccc
    13861 ccagaagccc ccaaaagtag aggctcaggc catgcgcgcc ctgtcaccag gcctgccaaa
    13921 gagccagatc taaggccggg agaggcagcc ccaaagcggg tgcagtaaca ggtaatctct
    13981 ggtagtgatt tggacccgaa atctgacact ttagagctct ggaggacttt aaaactctaa
    14041 aaatcaaaac tttagaggcg aatgggcgcc attttgtccc cacgcgcgca taatggcgga
    14101 cctaggccta aaacccccag gaagcgggtc tatggttggc tgcgctgctg ctatctttag
    14161 aggggaaaag aggaataagc ccccagacag gggagtgggc ttgtttgtga cttcaccaaa
    14221 ggtcagggcc caagggggtt cgcgttgcta ggccaccttc tcagtccagc gcgtttacgt
    14281 aagccagaca gcagccaatt gtcagttcta gggaggggga ccactgcccc tggtataaag
    14341 tggtcctgca gctatttctg gtcgcatcag agcgccagga gtccacacaa atgtaagagg
    14401 gggtcttcta cctctcccta gccctccgcc ccctccaagg actcgggccc agtttctaac
    14461 tttttcccct tccctccctc gtcttgccct gcgcctgggg ccaccttcat caccgtcgct
    14521 gactccgcca tccaagccta ggggagaccg aagtgaagtc cctggaccag cccggcccgg
    14581 gccccccggt atcgggccag aggtaagtgg actttaattt tttctgctaa gcccaacact
    14641 ccaccacacc caggcacaca ctacacacac ccacccgtct cagggtcccc tcggacagct
    14701 cctaagaagg caccggtcgc ccagtcctac cagagggggc caagaaccca gacgagtccg
    14761 tagaagggtc ctcgtccagc aagaagagga ggtggtaagc ggttcacctt caggggtaag
    14821 taacctgacc tctccagggc tcacataaag ggaggcttag tatacatgct tcttgctttt
    14881 cacaggaacc tgggggctag tctgggtggg tttaggctgc ctcaagttgc atcagccagg
    14941 gcttcatgcc ctcctcagtt ccctagtccc cgggcttcag gccccctccg tccccgtcct
    15001 ccagagaccc gggcttcagg ccctgcctct cctgttaccc ttttagaacc acagcctgga
    15061 cacatgtgcc agacgcctgg gcctctaagg ccctcgggtc cccctggacc ccggcctcag
    15121 caaccctgct gctcccctcc tgccacccca gcctcccccc ctccccgtcc cccttcgctc
    15181 cttatcctcc cccggtcccc agtagggccg cctgcccccc tgcacccagt acctgcccct
    15241 cttggccacg caccccgggc caggccacct tagacccggc caagccccat ccctgaagac
    15301 ccagcggcca ttctctctgg taacgagcag agaagaagta gaggcccgcg gccattgggc
    15361 ccagattgag agaccagtcc aggggcccga ggttggagcc agcgggcacc cgaggtccca
    15421 gcacccggtc cctccggggg gcagagacag gcagggcccc ccggcagctg gccccgagga
    15481 ggcgcccgga gtggggccgg tcggctgggc tggccgagcc cgggtctggg aggtctgggg
    15541 tggcgagcct gctgtctcag gaggggcctg gctccgccgg gtggccctgg ggtaagtctg
    15601 ggaggcagag ggacggccta ggcccgggga agtggagggg gatcgcccgg gtctctgttg
    15661 gcagagtccg ggcgatcctc tgagaccctc cgggcccgga cggccgccct cggcccccca
    15721 gacagacccc agggtctcca ggcagggtcc ggcatctcca ggggcagcag gctcaccacc
    15781 acaggccccc cagacccggg tctcggccag ccgagccgac cggccccgcg ccgggcgcct
    15841 cctcggagcc agcccccggg gttggttctg cccctctctc tgtccttcag aggaaccagg
    15901 gacctcgggc accccagagc ccctcgggcc cgcctccagg cgccctcctg gtctccgctc
    15961 ccctctgagc cccgttaaac ccaaagaatg tctgagggga gccaccctcg gggcccaggc
    16021 cccagagtcc agaggtcagg ggcacctcag ggtgcctccc cgggtcccag gccagccgga
    16081 gggaccccgg cagcccgggc ggccccagag gccggttcct cgccccttcc ccgggcttca
    16141 gagcccaggg tgtcccccag aagggaccct aggcgtcccc tctcctcccc tccaggcccg
    16201 agcctctccc tcgcggagag gggcctcttc gagccctcaa gtccagtccc accgagaccc
    16261 gagtggcccg gatcccccac cggcccttct ctttccccct actcctctcc aaccttcgct
    16321 ccaccctaga ccccagcttc tggcctcccc gggtccacca ggccagccgg agggaccccg
    16381 gcagcccggg cgagtcgcct tccctctccc ctggcctctc cttcccgcct cccacccgag
    16441 ccccctcagc ttgcctcccc accgggtcca tcaggccggc cggagggacc ccggcggccc
    16501 ggtgtcagtt ccccctgcag ccgcccagtc tctgcctcca ggcaagggcg ccagcttttc
    16561 tccccccagc ctgaggccca ggctcctgtg cactgtctgt aaagtccagc ctcccacgcc
    16621 cgtccacggc tcccaggccc agccccgtcc acccctcccc acgttggaca ggccctctgt
    16681 ccacccgggc catccccgcc cccctgtgtc caccccagtc ccgtccaggg gggactttat
    16741 gtgacccttg ggcctggctc cccatagact cccatgtaag cctgcctcga gtaggtgcct
    16801 ccagagcccc ttttgccccc ctggcggccc agcccgaccc ccgggcgccc ccaaactttg
    16861 tccagatgtc caggggtccc cgagggcgag gcccagcccc ctcccgcccc tgtccactgc
    16921 cccggtcccc ccagaagccc ccaaaagtag aggctcaggc catgcgcgcc ctgtcaccag
    16981 gcctgccaaa gagccagatc taaggccggg agaggcagcc ccaaagcggg tgcagtaaca
    17041 ggtaatctct ggtagtgatt tggacccgaa atctgacact ttagagctct ggaggacttt
    17101 aaaactctaa aaatcaaaac tttagaggcg aatgggcgcc attttgtccc cacgcgcgca
    17161 taatggcgga cctaggccta aaacccccag gaagcgggtc tatggttggc tgcgctgctg
    17221 ctatctttag aggggaaaag aggaataagc ccccagacag gggagtgggc ttgtttgtga
    17281 cttcaccaaa ggtcagggcc caagggggtt cgcgttgcta ggccaccttc tcagtccagc
    17341 gcgtttacgt aagccagaca gcagccaatt gtcagttcta gggaggggga ccactgcccc
    17401 tggtataaag tggtcctgca gctatttctg gtcgcatcag agcgccagga gtccacacaa
    17461 atgtaagagg gggtcttcta cctctcccta gccctccgcc ccctccaagg actcgggccc
    17521 agtttctaac tttttcccct tccctccctc gtcttgccct gcgcctgggg ccaccttcat
    17581 caccgtcgct gactccgcca tccaagccta ggggagaccg aagtgaagtc cctggaccag
    17641 cccggcccgg gccccccggt atcgggccag aggtaagtgg actttaattt tttctgctaa
    17701 gcccaacact ccaccacacc caggcacaca ctacacacac ccacccgtct cagggtcccc
    17761 tcggacagct cctaagaagg caccggtcgc ccagtcctac cagagggggc caagaaccca
    17821 gacgagtccg tagaagggtc ctcgtccagc aagaagagga ggtggtaagc ggttcacctt
    17881 caggggtaag taacctgacc tctccagggc tcacataaag ggaggcttag tatacatgct
    17941 tcttgctttt cacaggaacc tgggggctag tctgggtggg tttaggctgc ctcaagttgc
    18001 atcagccagg gcttcatgcc ctcctcagtt ccctagtccc cgggcttcag gccccctccg
    18061 tccccgtcct ccagagaccc gggcttcagg ccctgcctct cctgttaccc ttttagaacc
    18121 acagcctgga cacatgtgcc agacgcctgg gcctctaagg ccctcgggtc cccctggacc
    18181 ccggcctcag caaccctgct gctcccctcc tgccacccca gcctcccccc ctccccgtcc
    18241 cccttcgctc cttatcctcc cccggtcccc agtagggccg cctgcccccc tgcacccagt
    18301 acctgcccct cttggccacg caccccgggc caggccacct tagacccggc caagccccat
    18361 ccctgaagac ccagcggcca ttctctctgg taacgagcag agaagaagta gaggcccgcg
    18421 gccattgggc ccagattgag agaccagtcc aggggcccga ggttggagcc agcgggcacc
    18481 cgaggtccca gcacccggtc cctccggggg gcagagacag gcagggcccc ccggcagctg
    18541 gccccgagga ggcgcccgga gtggggccgg tcggctgggc tggccgagcc cgggtctggg
    18601 aggtctgggg tggcgagcct gctgtctcag gaggggcctg gctccgccgg gtggccctgg
    18661 ggtaagtctg ggaggcagag ggacggccta ggcccgggga agtggagggg gatcgcccgg
    18721 gtctctgttg gcagagtccg ggcgatcctc tgagaccctc cgggcccgga cggccgccct
    18781 cggcccccca gacagacccc agggtctcca ggcagggtcc ggcatctcca ggggcagcag
    18841 gctcaccacc acaggccccc cagacccggg tctcggccag ccgagccgac cggccccgcg
    18901 ccgggcgcct cctcggagcc agcccccggg gttggttctg cccctctctc tgtccttcag
    18961 aggaaccagg gacctcgggc accccagagc ccctcgggcc cgcctccagg cgccctcctg
    19021 gtctccgctc ccctctgagc cccgttaaac ccaaagaatg tctgagggga gccaccctcg
    19081 gggcccaggc cccagagtcc agaggtcagg ggcacctcag ggtgcctccc cgggtcccag
    19141 gccagccgga gggaccccgg cagcccgggc ggccccagag gccggttcct cgccccttcc
    19201 ccgggcttca gagcccaggg tgtcccccag aagggaccct aggcgtcccc tctcctcccc
    19261 tccaggcccg agcctctccc tcgcggagag gggcctcttc gagccctcaa gtccagtccc
    19321 accgagaccc gagtggcccg gatcccccac cggcccttct ctttccccct actcctctcc
    19381 aaccttcgct ccaccctaga ccccagcttc tggcctcccc gggtccacca ggccagccgg
    19441 agggaccccg gcagcccggg cgagtcgcct tccctctccc ctggcctctc cttcccgcct
    19501 cccacccgag ccccctcagc ttgcctcccc accgggtcca tcaggccggc cggagggacc
    19561 ccggcggccc ggtgtcagtt ccccctgcag ccgcccagtc tctgcctcca ggcaagggcg
    19621 ccagcttttc tccccccagc ctgaggccca ggctcctgtg cactgtctgt aaagtccagc
    19681 ctcccacgcc cgtccacggc tcccaggccc agccccgtcc acccctcccc acgttggaca
    19741 ggccctctgt ccacccgggc catccccgcc cccctgtgtc caccccagtc ccgtccaggg
    19801 gggactttat gtgacccttg ggcctggctc cccatagact cccatgtaag cctgcctcga
    19861 gtaggtgcct ccagagcccc ttttgccccc ctggcggccc agcccgaccc ccgggcgccc
    19921 ccaaactttg tccagatgtc caggggtccc cgagggcgag gcccagcccc ctcccgcccc
    19981 tgtccactgc cccggtcccc ccagaagccc ccaaaagtag aggctcaggc catgcgcgcc
    20041 ctgtcaccag gcctgccaaa gagccagatc taaggccggg agaggcagcc ccaaagcggg
    20101 tgcagtaaca ggtaatctct ggtagtgatt tggacccgaa atctgacact ttagagctct
    20161 ggaggacttt aaaactctaa aaatcaaaac tttagaggcg aatgggcgcc attttgtccc
    20221 cacgcgcgca taatggcgga cctaggccta aaacccccag gaagcgggtc tatggttggc
    20281 tgcgctgctg ctatctttag aggggaaaag aggaataagc ccccagacag gggagtgggc
    20341 ttgtttgtga cttcaccaaa ggtcagggcc caagggggtt cgcgttgcta ggccaccttc
    20401 tcagtccagc gcgtttacgt aagccagaca gcagccaatt gtcagttcta gggaggggga
    20461 ccactgcccc tggtataaag tggtcctgca gctatttctg gtcgcatcag agcgccagga
    20521 gtccacacaa atgtaagagg gggtcttcta cctctcccta gccctccgcc ccctccaagg
    20581 actcgggccc agtttctaac tttttcccct tccctccctc gtcttgccct gcgcctgggg
    20641 ccaccttcat caccgtcgct gactccgcca tccaagccta ggggagaccg aagtgaagtc
    20701 cctggaccag cccggcccgg gccccccggt atcgggccag aggtaagtgg actttaattt
    20761 tttctgctaa gcccaacact ccaccacacc caggcacaca ctacacacac ccacccgtct
    20821 cagggtcccc tcggacagct cctaagaagg caccggtcgc ccagtcctac cagagggggc
    20881 caagaaccca gacgagtccg tagaagggtc ctcgtccagc aagaagagga ggtggtaagc
    20941 ggttcacctt caggggtaag taacctgacc tctccagggc tcacataaag ggaggcttag
    21001 tatacatgct tcttgctttt cacaggaacc tgggggctag tctgggtggg tttaggctgc
    21061 ctcaagttgc atcagccagg gcttcatgcc ctcctcagtt ccctagtccc cgggcttcag
    21121 gccccctccg tccccgtcct ccagagaccc gggcttcagg ccctgcctct cctgttaccc
    21181 ttttagaacc acagcctgga cacatgtgcc agacgcctgg gcctctaagg ccctcgggtc
    21241 cccctggacc ccggcctcag caaccctgct gctcccctcc tgccacccca gcctcccccc
    21301 ctccccgtcc cccttcgctc cttatcctcc cccggtcccc agtagggccg cctgcccccc
    21361 tgcacccagt acctgcccct cttggccacg caccccgggc caggccacct tagacccggc
    21421 caagccccat ccctgaagac ccagcggcca ttctctctgg taacgagcag agaagaagta
    21481 gaggcccgcg gccattgggc ccagattgag agaccagtcc aggggcccga ggttggagcc
    21541 agcgggcacc cgaggtccca gcacccggtc cctccggggg gcagagacag gcagggcccc
    21601 ccggcagctg gccccgagga ggcgcccgga gtggggccgg tcggctgggc tggccgagcc
    21661 cgggtctggg aggtctgggg tggcgagcct gctgtctcag gaggggcctg gctccgccgg
    21721 gtggccctgg ggtaagtctg ggaggcagag ggacggccta ggcccgggga agtggagggg
    21781 gatcgcccgg gtctctgttg gcagagtccg ggcgatcctc tgagaccctc cgggcccgga
    21841 cggccgccct cggcccccca gacagacccc agggtctcca ggcagggtcc ggcatctcca
    21901 ggggcagcag gctcaccacc acaggccccc cagacccggg tctcggccag ccgagccgac
    21961 cggccccgcg ccgggcgcct cctcggagcc agcccccggg gttggttctg cccctctctc
    22021 tgtccttcag aggaaccagg gacctcgggc accccagagc ccctcgggcc cgcctccagg
    22081 cgccctcctg gtctccgctc ccctctgagc cccgttaaac ccaaagaatg tctgagggga
    22141 gccaccctcg gggcccaggc cccagagtcc agaggtcagg ggcacctcag ggtgcctccc
    22201 cgggtcccag gccagccgga gggaccccgg cagcccgggc ggccccagag gccggttcct
    22261 cgccccttcc ccgggcttca gagcccaggg tgtcccccag aagggaccct aggcgtcccc
    22321 tctcctcccc tccaggcccg agcctctccc tcgcggagag gggcctcttc gagccctcaa
    22381 gtccagtccc accgagaccc gagtggcccg gatcccccac cggcccttct ctttccccct
    22441 actcctctcc aaccttcgct ccaccctaga ccccagcttc tggcctcccc gggtccacca
    22501 ggccagccgg agggaccccg gcagcccggg cgagtcgcct tccctctccc ctggcctctc
    22561 cttcccgcct cccacccgag ccccctcagc ttgcctcccc accgggtcca tcaggccggc
    22621 cggagggacc ccggcggccc ggtgtcagtt ccccctgcag ccgcccagtc tctgcctcca
    22681 ggcaagggcg ccagcttttc tccccccagc ctgaggccca ggctcctgtg cactgtctgt
    22741 aaagtccagc ctcccacgcc cgtccacggc tcccaggccc agccccgtcc acccctcccc
    22801 acgttggaca ggccctctgt ccacccgggc catccccgcc cccctgtgtc caccccagtc
    22861 ccgtccaggg gggactttat gtgacccttg ggcctggctc cccatagact cccatgtaag
    22921 cctgcctcga gtaggtgcct ccagagcccc ttttgccccc ctggcggccc agcccgaccc
    22981 ccgggcgccc ccaaactttg tccagatgtc caggggtccc cgagggcgag gcccagcccc
    23041 ctcccgcccc tgtccactgc cccggtcccc ccagaagccc ccaaaagtag aggctcaggc
    23101 catgcgcgcc ctgtcaccag gcctgccaaa gagccagatc taaggccggg agaggcagcc
    23161 ccaaagcggg tgcagtaaca ggtaatctct ggtagtgatt tggacccgaa atctgacact
    23221 ttagagctct ggaggacttt aaaactctaa aaatcaaaac tttagaggcg aatgggcgcc
    23281 attttgtccc cacgcgcgca taatggcgga cctaggccta aaacccccag gaagcgggtc
    23341 tatggttggc tgcgctgctg ctatctttag aggggaaaag aggaataagc ccccagacag
    23401 gggagtgggc ttgtttgtga cttcaccaaa ggtcagggcc caagggggtt cgcgttgcta
    23461 ggccaccttc tcagtccagc gcgtttacgt aagccagaca gcagccaatt gtcagttcta
    23521 gggaggggga ccactgcccc tggtataaag tggtcctgca gctatttctg gtcgcatcag
    23581 agcgccagga gtccacacaa atgtaagagg gggtcttcta cctctcccta gccctccgcc
    23641 ccctccaagg actcgggccc agtttctaac tttttcccct tccctccctc gtcttgccct
    23701 gcgcctgggg ccaccttcat caccgtcgct gactccgcca tccaagccta ggggagaccg
    23761 aagtgaagtc cctggaccag cccggcccgg gccccccggt atcgggccag aggtaagtgg
    23821 actttaattt tttctgctaa gcccaacact ccaccacacc caggcacaca ctacacacac
    23881 ccacccgtct cagggtcccc tcggacagct cctaagaagg caccggtcgc ccagtcctac
    23941 cagagggggc caagaaccca gacgagtccg tagaagggtc ctcgtccagc aagaagagga
    24001 ggtggtaagc ggttcacctt caggggtaag taacctgacc tctccagggc tcacataaag
    24061 ggaggcttag tatacatgct tcttgctttt cacaggaacc tgggggctag tctgggtggg
    24121 tttaggctgc ctcaagttgc atcagccagg gcttcatgcc ctcctcagtt ccctagtccc
    24181 cgggcttcag gccccctccg tccccgtcct ccagagaccc gggcttcagg ccctgcctct
    24241 cctgttaccc ttttagaacc acagcctgga cacatgtgcc agacgcctgg gcctctaagg
    24301 ccctcgggtc cccctggacc ccggcctcag caaccctgct gctcccctcc tgccacccca
    24361 gcctcccccc ctccccgtcc cccttcgctc cttatcctcc cccggtcccc agtagggccg
    24421 cctgcccccc tgcacccagt acctgcccct cttggccacg caccccgggc caggccacct
    24481 tagacccggc caagccccat ccctgaagac ccagcggcca ttctctctgg taacgagcag
    24541 agaagaagta gaggcccgcg gccattgggc ccagattgag agaccagtcc aggggcccga
    24601 ggttggagcc agcgggcacc cgaggtccca gcacccggtc cctccggggg gcagagacag
    24661 gcagggcccc ccggcagctg gccccgagga ggcgcccgga gtggggccgg tcggctgggc
    24721 tggccgagcc cgggtctggg aggtctgggg tggcgagcct gctgtctcag gaggggcctg
    24781 gctccgccgg gtggccctgg ggtaagtctg ggaggcagag ggacggccta ggcccgggga
    24841 agtggagggg gatcgcccgg gtctctgttg gcagagtccg ggcgatcctc tgagaccctc
    24901 cgggcccgga cggccgccct cggcccccca gacagacccc agggtctcca ggcagggtcc
    24961 ggcatctcca ggggcagcag gctcaccacc acaggccccc cagacccggg tctcggccag
    25021 ccgagccgac cggccccgcg ccgggcgcct cctcggagcc agcccccggg gttggttctg
    25081 cccctctctc tgtccttcag aggaaccagg gacctcgggc accccagagc ccctcgggcc
    25141 cgcctccagg cgccctcctg gtctccgctc ccctctgagc cccgttaaac ccaaagaatg
    25201 tctgagggga gccaccctcg gggcccaggc cccagagtcc agaggtcagg ggcacctcag
    25261 ggtgcctccc cgggtcccag gccagccgga gggaccccgg cagcccgggc ggccccagag
    25321 gccggttcct cgccccttcc ccgggcttca gagcccaggg tgtcccccag aagggaccct
    25381 aggcgtcccc tctcctcccc tccaggcccg agcctctccc tcgcggagag gggcctcttc
    25441 gagccctcaa gtccagtccc accgagaccc gagtggcccg gatcccccac cggcccttct
    25501 ctttccccct actcctctcc aaccttcgct ccaccctaga ccccagcttc tggcctcccc
    25561 gggtccacca ggccagccgg agggaccccg gcagcccggg cgagtcgcct tccctctccc
    25621 ctggcctctc cttcccgcct cccacccgag ccccctcagc ttgcctcccc accgggtcca
    25681 tcaggccggc cggagggacc ccggcggccc ggtgtcagtt ccccctgcag ccgcccagtc
    25741 tctgcctcca ggcaagggcg ccagcttttc tccccccagc ctgaggccca ggctcctgtg
    25801 cactgtctgt aaagtccagc ctcccacgcc cgtccacggc tcccaggccc agccccgtcc
    25861 acccctcccc acgttggaca ggccctctgt ccacccgggc catccccgcc cccctgtgtc
    25921 caccccagtc ccgtccaggg gggactttat gtgacccttg ggcctggctc cccatagact
    25981 cccatgtaag cctgcctcga gtaggtgcct ccagagcccc ttttgccccc ctggcggccc
    26041 agcccgaccc ccgggcgccc ccaaactttg tccagatgtc caggggtccc cgagggcgag
    26101 gcccagcccc ctcccgcccc tgtccactgc cccggtcccc ccagaagccc ccaaaagtag
    26161 aggctcaggc catgcgcgcc ctgtcaccag gcctgccaaa gagccagatc taaggccggg
    26221 agaggcagcc ccaaagcggg tgcagtaaca ggtaatctct ggtagtgatt tggacccgaa
    26281 atctgacact ttagagctct ggaggacttt aaaactctaa aaatcaaaac tttagaggcg
    26341 aatgggcgcc attttgtccc cacgcgcgca taatggcgga cctaggccta aaacccccag
    26401 gaagcgggtc tatggttggc tgcgctgctg ctatctttag aggggaaaag aggaataagc
    26461 ccccagacag gggagtgggc ttgtttgtga cttcaccaaa ggtcagggcc caagggggtt
    26521 cgcgttgcta ggccaccttc tcagtccagc gcgtttacgt aagccagaca gcagccaatt
    26581 gtcagttcta gggaggggga ccactgcccc tggtataaag tggtcctgca gctatttctg
    26641 gtcgcatcag agcgccagga gtccacacaa atgtaagagg gggtcttcta cctctcccta
    26701 gccctccgcc ccctccaagg actcgggccc agtttctaac tttttcccct tccctccctc
    26761 gtcttgccct gcgcctgggg ccaccttcat caccgtcgct gactccgcca tccaagccta
    26821 ggggagaccg aagtgaagtc cctggaccag cccggcccgg gccccccggt atcgggccag
    26881 aggtaagtgg actttaattt tttctgctaa gcccaacact ccaccacacc caggcacaca
    26941 ctacacacac ccacccgtct cagggtcccc tcggacagct cctaagaagg caccggtcgc
    27001 ccagtcctac cagagggggc caagaaccca gacgagtccg tagaagggtc ctcgtccagc
    27061 aagaagagga ggtggtaagc ggttcacctt caggggtaag taacctgacc tctccagggc
    27121 tcacataaag ggaggcttag tatacatgct tcttgctttt cacaggaacc tgggggctag
    27181 tctgggtggg tttaggctgc ctcaagttgc atcagccagg gcttcatgcc ctcctcagtt
    27241 ccctagtccc cgggcttcag gccccctccg tccccgtcct ccagagaccc gggcttcagg
    27301 ccctgcctct cctgttaccc ttttagaacc acagcctgga cacatgtgcc agacgcctgg
    27361 gcctctaagg ccctcgggtc cccctggacc ccggcctcag caaccctgct gctcccctcc
    27421 tgccacccca gcctcccccc ctccccgtcc cccttcgctc cttatcctcc cccggtcccc
    27481 agtagggccg cctgcccccc tgcacccagt acctgcccct cttggccacg caccccgggc
    27541 caggccacct tagacccggc caagccccat ccctgaagac ccagcggcca ttctctctgg
    27601 taacgagcag agaagaagta gaggcccgcg gccattgggc ccagattgag agaccagtcc
    27661 aggggcccga ggttggagcc agcgggcacc cgaggtccca gcacccggtc cctccggggg
    27721 gcagagacag gcagggcccc ccggcagctg gccccgagga ggcgcccgga gtggggccgg
    27781 tcggctgggc tggccgagcc cgggtctggg aggtctgggg tggcgagcct gctgtctcag
    27841 gaggggcctg gctccgccgg gtggccctgg ggtaagtctg ggaggcagag ggacggccta
    27901 ggcccgggga agtggagggg gatcgcccgg gtctctgttg gcagagtccg ggcgatcctc
    27961 tgagaccctc cgggcccgga cggccgccct cggcccccca gacagacccc agggtctcca
    28021 ggcagggtcc ggcatctcca ggggcagcag gctcaccacc acaggccccc cagacccggg
    28081 tctcggccag ccgagccgac cggccccgcg ccgggcgcct cctcggagcc agcccccggg
    28141 gttggttctg cccctctctc tgtccttcag aggaaccagg gacctcgggc accccagagc
    28201 ccctcgggcc cgcctccagg cgccctcctg gtctccgctc ccctctgagc cccgttaaac
    28261 ccaaagaatg tctgagggga gccaccctcg gggcccaggc cccagagtcc agaggtcagg
    28321 ggcacctcag ggtgcctccc cgggtcccag gccagccgga gggaccccgg cagcccgggc
    28381 ggccccagag gccggttcct cgccccttcc ccgggcttca gagcccaggg tgtcccccag
    28441 aagggaccct aggcgtcccc tctcctcccc tccaggcccg agcctctccc tcgcggagag
    28501 gggcctcttc gagccctcaa gtccagtccc accgagaccc gagtggcccg gatcccccac
    28561 cggcccttct ctttccccct actcctctcc aaccttcgct ccaccctaga ccccagcttc
    28621 tggcctcccc gggtccacca ggccagccgg agggaccccg gcagcccggg cgagtcgcct
    28681 tccctctccc ctggcctctc cttcccgcct cccacccgag ccccctcagc ttgcctcccc
    28741 accgggtcca tcaggccggc cggagggacc ccggcggccc ggtgtcagtt ccccctgcag
    28801 ccgcccagtc tctgcctcca ggcaagggcg ccagcttttc tccccccagc ctgaggccca
    28861 ggctcctgtg cactgtctgt aaagtccagc ctcccacgcc cgtccacggc tcccaggccc
    28921 agccccgtcc acccctcccc acgttggaca ggccctctgt ccacccgggc catccccgcc
    28981 cccctgtgtc caccccagtc ccgtccaggg gggactttat gtgacccttg ggcctggctc
    29041 cccatagact cccatgtaag cctgcctcga gtaggtgcct ccagagcccc ttttgccccc
    29101 ctggcggccc agcccgaccc ccgggcgccc ccaaactttg tccagatgtc caggggtccc
    29161 cgagggcgag gcccagcccc ctcccgcccc tgtccactgc cccggtcccc ccagaagccc
    29221 ccaaaagtag aggctcaggc catgcgcgcc ctgtcaccag gcctgccaaa gagccagatc
    29281 taaggccggg agaggcagcc ccaaagcggg tgcagtaaca ggtaatctct ggtagtgatt
    29341 tggacccgaa atctgacact ttagagctct ggaggacttt aaaactctaa aaatcaaaac
    29401 tttagaggcg aatgggcgcc attttgtccc cacgcgcgca taatggcgga cctaggccta
    29461 aaacccccag gaagcgggtc tatggttggc tgcgctgctg ctatctttag aggggaaaag
    29521 aggaataagc ccccagacag gggagtgggc ttgtttgtga cttcaccaaa ggtcagggcc
    29581 caagggggtt cgcgttgcta ggccaccttc tcagtccagc gcgtttacgt aagccagaca
    29641 gcagccaatt gtcagttcta gggaggggga ccactgcccc tggtataaag tggtcctgca
    29701 gctatttctg gtcgcatcag agcgccagga gtccacacaa atgtaagagg gggtcttcta
    29761 cctctcccta gccctccgcc ccctccaagg actcgggccc agtttctaac tttttcccct
    29821 tccctccctc gtcttgccct gcgcctgggg ccaccttcat caccgtcgct gactccgcca
    29881 tccaagccta ggggagaccg aagtgaagtc cctggaccag cccggcccgg gccccccggt
    29941 atcgggccag aggtaagtgg actttaattt tttctgctaa gcccaacact ccaccacacc
    30001 caggcacaca ctacacacac ccacccgtct cagggtcccc tcggacagct cctaagaagg
    30061 caccggtcgc ccagtcctac cagagggggc caagaaccca gacgagtccg tagaagggtc
    30121 ctcgtccagc aagaagagga ggtggtaagc ggttcacctt caggggtaag taacctgacc
    30181 tctccagggc tcacataaag ggaggcttag tatacatgct tcttgctttt cacaggaacc
    30241 tgggggctag tctgggtggg tttaggctgc ctcaagttgc atcagccagg gcttcatgcc
    30301 ctcctcagtt ccctagtccc cgggcttcag gccccctccg tccccgtcct ccagagaccc
    30361 gggcttcagg ccctgcctct cctgttaccc ttttagaacc acagcctgga cacatgtgcc
    30421 agacgcctgg gcctctaagg ccctcgggtc cccctggacc ccggcctcag caaccctgct
    30481 gctcccctcc tgccacccca gcctcccccc ctccccgtcc cccttcgctc cttatcctcc
    30541 cccggtcccc agtagggccg cctgcccccc tgcacccagt acctgcccct cttggccacg
    30601 caccccgggc caggccacct tagacccggc caagccccat ccctgaagac ccagcggcca
    30661 ttctctctgg taacgagcag agaagaagta gaggcccgcg gccattgggc ccagattgag
    30721 agaccagtcc aggggcccga ggttggagcc agcgggcacc cgaggtccca gcacccggtc
    30781 cctccggggg gcagagacag gcagggcccc ccggcagctg gccccgagga ggcgcccgga
    30841 gtggggccgg tcggctgggc tggccgagcc cgggtctggg aggtctgggg tggcgagcct
    30901 gctgtctcag gaggggcctg gctccgccgg gtggccctgg ggtaagtctg ggaggcagag
    30961 ggacggccta ggcccgggga agtggagggg gatcgcccgg gtctctgttg gcagagtccg
    31021 ggcgatcctc tgagaccctc cgggcccgga cggccgccct cggcccccca gacagacccc
    31081 agggtctcca ggcagggtcc ggcatctcca ggggcagcag gctcaccacc acaggccccc
    31141 cagacccggg tctcggccag ccgagccgac cggccccgcg ccgggcgcct cctcggagcc
    31201 agcccccggg gttggttctg cccctctctc tgtccttcag aggaaccagg gacctcgggc
    31261 accccagagc ccctcgggcc cgcctccagg cgccctcctg gtctccgctc ccctctgagc
    31321 cccgttaaac ccaaagaatg tctgagggga gccaccctcg gggcccaggc cccagagtcc
    31381 agaggtcagg ggcacctcag ggtgcctccc cgggtcccag gccagccgga gggaccccgg
    31441 cagcccgggc ggccccagag gccggttcct cgccccttcc ccgggcttca gagcccaggg
    31501 tgtcccccag aagggaccct aggcgtcccc tctcctcccc tccaggcccg agcctctccc
    31561 tcgcggagag gggcctcttc gagccctcaa gtccagtccc accgagaccc gagtggcccg
    31621 gatcccccac cggcccttct ctttccccct actcctctcc aaccttcgct ccaccctaga
    31681 ccccagcttc tggcctcccc gggtccacca ggccagccgg agggaccccg gcagcccggg
    31741 cgagtcgcct tccctctccc ctggcctctc cttcccgcct cccacccgag ccccctcagc
    31801 ttgcctcccc accgggtcca tcaggccggc cggagggacc ccggcggccc ggtgtcagtt
    31861 ccccctgcag ccgcccagtc tctgcctcca ggcaagggcg ccagcttttc tccccccagc
    31921 ctgaggccca ggctcctgtg cactgtctgt aaagtccagc ctcccacgcc cgtccacggc
    31981 tcccaggccc agccccgtcc acccctcccc acgttggaca ggccctctgt ccacccgggc
    32041 catccccgcc cccctgtgtc caccccagtc ccgtccaggg gggactttat gtgacccttg
    32101 ggcctggctc cccatagact cccatgtaag cctgcctcga gtaggtgcct ccagagcccc
    32161 ttttgccccc ctggcggccc agcccgaccc ccgggcgccc ccaaactttg tccagatgtc
    32221 caggggtccc cgagggcgag gcccagcccc ctcccgcccc tgtccactgc cccggtcccc
    32281 ccagaagccc ccaaaagtag aggctcaggc catgcgcgcc ctgtcaccag gcctgccaaa
    32341 gagccagatc taaggccggg agaggcagcc ccaaagcggg tgcagtaaca ggtaatctct
    32401 ggtagtgatt tggacccgaa atctgacact ttagagctct ggaggacttt aaaactctaa
    32461 aaatcaaaac tttagaggcg aatgggcgcc attttgtccc cacgcgcgca taatggcgga
    32521 cctaggccta aaacccccag gaagcgggtc tatggttggc tgcgctgctg ctatctttag
    32581 aggggaaaag aggaataagc ccccagacag gggagtgggc ttgtttgtga cttcaccaaa
    32641 ggtcagggcc caagggggtt cgcgttgcta ggccaccttc tcagtccagc gcgtttacgt
    32701 aagccagaca gcagccaatt gtcagttcta gggaggggga ccactgcccc tggtataaag
    32761 tggtcctgca gctatttctg gtcgcatcag agcgccagga gtccacacaa atgtaagagg
    32821 gggtcttcta cctctcccta gccctccgcc ccctccaagg actcgggccc agtttctaac
    32881 tttttcccct tccctccctc gtcttgccct gcgcctgggg ccaccttcat caccgtcgct
    32941 gactccgcca tccaagccta ggggagaccg aagtgaagtc cctggaccag cccggcccgg
    33001 gccccccggt atcgggccag aggtaagtgg actttaattt tttctgctaa gcccaacact
    33061 ccaccacacc caggcacaca ctacacacac ccacccgtct cagggtcccc tcggacagct
    33121 cctaagaagg caccggtcgc ccagtcctac cagagggggc caagaaccca gacgagtccg
    33181 tagaagggtc ctcgtccagc aagaagagga ggtggtaagc ggttcacctt caggggtaag
    33241 taacctgacc tctccagggc tcacataaag ggaggcttag tatacatgct tcttgctttt
    33301 cacaggaacc tgggggctag tctgggtggg tttaggctgc ctcaagttgc atcagccagg
    33361 gcttcatgcc ctcctcagtt ccctagtccc cgggcttcag gccccctccg tccccgtcct
    33421 ccagagaccc gggcttcagg ccctgcctct cctgttaccc ttttagaacc acagcctgga
    33481 cacatgtgcc agacgcctgg gcctctaagg ccctcgggtc cccctggacc ccggcctcag
    33541 caaccctgct gctcccctcc tgccacccca gcctcccccc ctccccgtcc cccttcgctc
    33601 cttatcctcc cccggtcccc agtagggccg cctgcccccc tgcacccagt acctgcccct
    33661 cttggccacg caccccgggc caggccacct tagacccggc caagccccat ccctgaagac
    33721 ccagcggcca ttctctctgg taacgagcag agaagaagta gaggcccgcg gccattgggc
    33781 ccagattgag agaccagtcc aggggcccga ggttggagcc agcgggcacc cgaggtccca
    33841 gcacccggtc cctccggggg gcagagacag gcagggcccc ccggcagctg gccccgagga
    33901 ggcgcccgga gtggggccgg tcggctgggc tggccgagcc cgggtctggg aggtctgggg
    33961 tggcgagcct gctgtctcag gaggggcctg gctccgccgg gtggccctgg ggtaagtctg
    34021 ggaggcagag ggacggccta ggcccgggga agtggagggg gatcgcccgg gtctctgttg
    34081 gcagagtccg ggcgatcctc tgagaccctc cgggcccgga cggccgccct cggcccccca
    34141 gacagacccc agggtctcca ggcagggtcc ggcatctcca ggggcagcag gctcaccacc
    34201 acaggccccc cagacccggg tctcggccag ccgagccgac cggccccgcg ccgggcgcct
    34261 cctcggagcc agcccccggg gttggttctg cccctctctc tgtccttcag aggaaccagg
    34321 gacctcgggc accccagagc ccctcgggcc cgcctccagg cgccctcctg gtctccgctc
    34381 ccctctgagc cccgttaaac ccaaagaatg tctgagggga gccaccctcg gggcccaggc
    34441 cccagagtcc agaggtcagg ggcacctcag ggtgcctccc cgggtcccag gccagccgga
    34501 gggaccccgg cagcccgggc ggccccagag gccggttcct cgccccttcc ccgggcttca
    34561 gagcccaggg tgtcccccag aagggaccct aggcgtcccc tctcctcccc tccaggcccg
    34621 agcctctccc tcgcggagag gggcctcttc gagccctcaa gtccagtccc accgagaccc
    34681 gagtggcccg gatcccccac cggcccttct ctttccccct actcctctcc aaccttcgct
    34741 ccaccctaga ccccagcttc tggcctcccc gggtccacca ggccagccgg agggaccccg
    34801 gcagcccggg cgagtcgcct tccctctccc ctggcctctc cttcccgcct cccacccgag
    34861 ccccctcagc ttgcctcccc accgggtcca tcaggccggc cggagggacc ccggcggccc
    34921 ggtgtcagtt ccccctgcag ccgcccagtc tctgcctcca ggcaagggcg ccagcttttc
    34981 tccccccagc ctgaggccca ggctcctgtg cactgtctgt aaagtccagc ctcccacgcc
    35041 cgtccacggc tcccaggccc agccccgtcc acccctcccc acgttggaca ggccctctgt
    35101 ccacccgggc catccccgcc cccctgtgtc caccccagtc ccgtccaggg gggactttat
    35161 gtgacccttg ggcctggctc cccatagact cccatgtaag cctgcctcga gtaggtgcct
    35221 ccagagcccc ttttgccccc ctggcggccc agcccgaccc ccgggcgccc ccaaactttg
    35281 tccagatgtc caggggtccc cgagggcgag gcccagcccc ctcccgccca agctgctttg
    35341 attcctggga tatttttggg aatggtgtta actttctccc cttgtatttg ctattcaatc
    35401 aacctgattc cccctgctca tacctccact cacaaccaag ccactacggc cacgtccaca
    35461 acctcccgca caggtaagtg cttttccatt tttagcccca gccccgcctc tataagttct
    35521 aggcaaacct ccaatcacca gccaccttcc aatgtagtct cttagagagt ggctgctacg
    35581 cattagcgag agatttgacc cacacccagt agccacccga cgccaatctg tctacataga
    35641 agaagaagag gatgaagact aagtcacagg cttagccagg tgatttgtga atttcagttt
    35701 atttactttc ttccaatcaa gctttcccag cctccgcttc tcaggtccca gttatgggtt
    35761 ttccatgggg gacctagtat ccgttctatt agattaactc gcaagatact aaaattaacc
    35821 aaggtcagcc caagtgacgc gtgttatgcc aggctgccca ccctgaggat ttcccccaaa
    35881 aatgggctgt tagtagggtc ctcctacccc ctctttaggc caggtgtgtt attttgttgt
    35941 gttagtgcta tgtaatgtgt tgccgccagg tggcagcttg tttgtagatg tgcagcgccc
    36001 cttaatggta ggtctgcttt agggctgcca ggtggcgcaa actaggatta attcacctgt
    36061 atccctttcc ctccacccgc agtaactcag cgctggcgtg tgacgtggtg taaagttttg
    36121 cctgaacctg tggttgggca ggtacatgcc aacaaccttc taagcacccg cgcttgtgtt
    36181 ttgctttatc tgctgccatc atgcctacat actatcttgc gttacatggg ggacagtcat
    36241 ataatctaat tgttgacact gatatgtctg gaaacccgtc actctccgta attcccacga
    36301 atccttacca ggaacaacta tcaaataatc cattaattca actacaaatc gttgtcgggg
    36361 aaaacactgg ggcacccgca ccgccccaac cacccccccc accccctcca cctcctccac
    36421 ctgagcgcag ggatgcctgg acacaagagc ccttaccact ggatatgaat cccctgggca
    36481 gtgacgccag tcaaggccct ctggcatctt ccataagaat gctttgcatg gctcaatacc
    36541 ttcttagaaa cgcacggggc caacaaggcc ttcttaggcc actaggacca caaacacgct
    36601 ctcaggtcac cttggaacgt caacctgtcc acaaccctcg ccaggaggca cccatcattt
    36661 tgttacagag tcccgcgccc ccccgattca caccagtgcc catggtagcc ttaggacata
    36721 ctcttcaacc cacaccacca ccaaggccta ctcttcctca acccagaata ccactgataa
    36781 taccaccaag gcatactaat caaccagcca caacaccacc cacggcgcca caaaggctca
    36841 cactagggca tcaactaagt ctaccaccgc atcctccccc gcatcagagc accccacatt
    36901 gtagttctga tagtacagga ctccctccac ctcccacatc ttacagcatt ccttctatga
    36961 cattatcccc cgaaccattg ccgccaccag cagcaccagc acaccccctt ccaggtgtca
    37021 tttatgacca acaagcactt cctccaactc cagggccacc atggtggcca cctgtccgcg
    37081 accccacgcc aaccactcag actccaccaa caaatacgaa acagggcccg gaccagggcc
    37141 agggaagggg caggtggcgg ggcaggggca gaagcaaggg caggggcaga atgcacaaac
    37201 ttcctgaacc acggagacca gggccagaca cttccagtcc tagtatgcct caattaagtc
    37261 cggttgtcag tcttcatcag ggacaggggc ctgagaactc accaaccccc ggcccgtcta
    37321 cggccggccc cgtctgtaga gtgacacctt cagcaacccc tgacatttca ccaatacatg
    37381 aaccagagtc ctctgatagt gaagaacccc cctttctctt ccccagtgat tggtatcctc
    37441 caacgttaga acctgcagaa ttagatgaaa gttgggaggg catttttgaa acaacagaat
    37501 ctcatagctc tgatgaagag aatgtagggg ggcctagtaa aagacctcgc acctccactc
    37561 agtaaaagac cttactctct ccagtaatca atgtatccca aataaatgtt aatgattttg
    37621 ttcttaacta ttgacccgcc tgtcattcta ttaattaaac aagggaagct atgtttagct
    37681 attccaccaa cactgcacca atggacagcc aaaattggtg ccttgctcac agctcttttt
    37741 gccagtggct tacagcccag taggcagctc agaaaagttt agctattcca ccaacccggc
    37801 cccaatgaat gcttgccaaa attggggcct tgctctcagc actttgccag cgacttatag
    37861 catggtaggc cgctcaactc ggcctgtctt actgcccagc ctactctcca cttccagtcc
    37921 atgttcgcac tcctatgcat ttccttccct cccactttta tcccagtccc aacccaaaac
    37981 cacacacaac acatagaatt gttagtttaa acagtttatt gatacatggc tgcttttagc
    38041 ctaattgtgt attgctctcg ttgccaaaac ctggtgtaag ggccggcacc cgcaacatgg
    38101 ggaaaacata accgccgcca tcccatgggg agggtagagg cggttgacat gtaggtgagt
    38161 agtgtaagaa gcatggcgaa gtagacaggt tacttttaga gtgtagtgta cagggccggg
    38221 cgcaacagtg ccaccaaccc ggggtctgag cattccatgg gcagcaggga cactgcacta
    38281 ccgccaggtc caggggcagc cggggttcct ggcgctccgg ggggcagcca ggcggccgcc
    38341 ggtgggtccg ctgggccgct gccccgctcc gggtgggggg tggccccgct gggcaccgct
    38401 gcgccgccgc caggtccagg ggcagccggg gttcctggcg ctccgggggc agccgggcgg
    38461 ccgccggtgg gtccgctggg ccgctgcccc gctccgggtg gggggtggcc ccgctgggca
    38521 ccgctgcgcc gccgccaggt cctggggcag ccggggttcc tggcgctccg ggggcagccg
    38581 ggcggccgcc ggtgggtccg ctgggccgct gccccgctcc gggtgggggg tggccccgct
    38641 gggcaccgct gcgccgccgc caggtcctgg ggcagccggg gttcctggcg ctccgggggc
    38701 agccgggcgg ccgccggtgg gtccgctggg ccgctgcccc gctccgggtg gggggtggcc
    38761 ccgctgggca ccgctgtgcc gccgccaggt cctggggcag ccggggttcc tggcgctccg
    38821 ggggcagccg ggcggccgcc ggtgggtccg ctgggccgct gccccgctcc gggtgggggg
    38881 tggccccgct gggcaccgct gcgccgccgc caggtccagg ggcagccggg gttcctggcg
    38941 ctccgggggc agccgggcgg ccgccggtgg gtccgctggg ccgctgcccc gctccgggtg
    39001 gggggtggcc ccgctgggca ccgctgcgcc gccgccaggt cctggggcag ccggggttcc
    39061 tggcgctccg ggggcagccg ggcggccgcc ggtgggtccg ctgggccgct gccccgctcc
    39121 gggtgggggg tggccccgct gggcaccgct gcgccgccgc caggtcctgg ggcagccggg
    39181 gttcctggcg ctccgggggc agccgggcgg ccgccggtgg gtccgctggg ccgctgcccc
    39241 gctccgggtg gggggtggcc ccgctgggca ccgctgcgcc gccgccaggt ccaggggcag
    39301 ccggggttcc tggcgctccg ggggcagccg ggcggccgcc ggtgggtccg ctgggccgct
    39361 gccccgctcc gggtgggggg tggccccgct gggcaccgct gcgccgccgc caggtcctgg
    39421 ggcagccggg gttcctggcg ctccgggggc agccgggcgg ccgccggtgg gtccgctggg
    39481 ccgctgcccc gctccgggtg gggggtggcc ccgctgggca ccgctgtgcc gccgccaggt
    39541 cctggggcag ccggggttcc tggcgctccg ggggcagccg ggcggccgcc ggtgggtccg
    39601 ctgggccgct gccccgctcc gggtgggggg tggccccgct gggcaccgct gcgccgccgc
    39661 caggtccagg ggcagccggg gttcctggcg ctccgggggc agccgggcgg ccgccggtgg
    39721 gtccgctggg ccgctgcccc gctccgggtg gggggtggcc ccgctgggca ccgctgcgcc
    39781 gccgccaggt cctggggcag ccggggttcc tggcgctccg ggggcagccg ggcggccgcc
    39841 ggtgggtccg ctgggccgct gccccgctcc gggtgggggg tggccccgct gggcaccgct
    39901 gcgccgccgc caggtcctgg ggcagccggg gttcctggcg ctccactgca cctggaatgc
    39961 agggtggggg cgtggtcccc tggaccccag ccccgccgat ccctccccca gggcgtaccc
    40021 ggcttgcctg gttctggggc tcctctgggg gtcgctgcat ccgccggtag ggttcgaatg
    40081 ggcgtggtcc gcttgctctg ctggcccggt acgcctggat tgccggctgg gggctggggt
    40141 cccgggacgc cccctccctg ctcccacccg gttccctccc ccagggcgtg ccccgcttgc
    40201 ctggtcctgg agctcatccg gggatgctgc atccgctagt ccgacctggg tgggtgcggt
    40261 ccgctggccc caccctgggg gtcgccgccg ggtctgctgg tccggtgcac ctgaaaggca
    40321 gggggggggc agtgagggag gggcgtggtc ctgggacccc gcgccgactg gcagggggtc
    40381 cccatggcac aggcctaggg gtccaggggg cagccgcggc ccagcgcgcc ccgttcacgg
    40441 gggaggaccg cggccgagcc accaggggcc cggcgggggt ggggggtgcg ctcccaggcc
    40501 ggaccctggt gccaggcagg gaccccgcgc cacccgcttc atgggggggg aggccgccgc
    40561 aaggacgccg ggccggctgg gaggtgtgca ccccccgagc gtctggacga cgctggcgag
    40621 ccgggccggc tcgccttctt ttatcctctt tttggggtct ctgtgtaata ctttaaggtt
    40681 tgctcaggag tgggggcttc ttattggtta attcaggtgt gtcattttag cccgttgggt
    40741 ttcattaagg tgtgtcacca ggtgggtggt acctggaggt tattctattg ggataacgag
    40801 aggaggaggg gctagaggtc cgcgagattt ggggtaggcg gagcctcagg agggtcccct
    40861 ccatagggtt gaaccaggag ggggaggatt gggctccgcc ccgatatacc tagtgggtgg
    40921 agcctagagg taggtatcca tagggttcca ttatcctgga ggtatcctaa gctccgcccc
    40981 tatataccag gtgggtggag ctaggtagga ttcagctagg ttcctactgg ggtacccccc
    41041 taccctacct taaggtgcgc cacccttcct ccttccgttt taatggtaga ataacctata
    41101 ggttattaac ctagtggtgg aatagggtat tgcagctggg tatataccta taggtatata
    41161 gaacctagag gaagggaacc ctatagtgta atccctcccc cccctacccc cccctccctt
    41221 acggttgcct gagcccatcc cccaccccag caccccgggg tgacgtggca ccccgcgtgc
    41281 cttactgact tgtcaccttt gcacatttgg tcagctgacc gatgctcgcc acttcctggg
    41341 tcatgacctg gcctgtgcct tgtcccgtgg acaatgtccc tccagcgtgg tggctgcctt
    41401 tgggatgcat cactttgagc cactaagccc ccgttgctcg ccttgcctgc ctcaccatga
    41461 cacactaagc ccctgctaat ccatgagccc cgcctttagg aagcaccacg tcccggggac
    41521 ggaaggggac ttggggtgat tttctatgtg ggggtggaaa tatgagcaag aataaggacg
    41581 gctccttatt aacctgatca gccccggagt tgcctgtttc atcactaacc ccgggcctga
    41641 agaggttgac aagaagggtc aaggtttcgt ctgtgtgttg aagggcaggg gctgttgggt
    41701 gcatctggaa cggcttacct cgggtaactg tttgccatta aaaggttggg gattaggttt
    41761 agccccttta gctgccattt cgaaccgggg tgtgcagatg caggtctccg ggtgggcagg
    41821 cagtacgaga tgtcacgttg tgttgtcttt cctcccaccc ctgtcctggc tgtggcaaat
    41881 gcgaccctca tagagttgtg tttcaggtct gtgtcctgtt ttgcggtggg ttatttcccc
    41941 cctcagtgtt cgccagctta tttccccagt ccccacgtac tggggcctgt ggacacctga
    42001 gggagcggcc gttggtgggc atgtgttgga attgctccca ccctcaattt tcgcttgcct
    42061 tcttcccttg ttaacctgat agcatagcct ctaggtttcc ttgtaggtct gtttgggttt
    42121 gttggttcac gtggtgctaa cttgaatttt ttggttttct agttccctct taattacatt
    42181 tgtgccagat cttgtagagc aagatggcct attcaacaag ggagatactg ttagccctgt
    42241 gtatacggga cagtcgtgtg catggaaatg gtaccctgca tcctgtgttg gagctagcag
    42301 caagagaaac acctctccgc ctttcgccag aggacactgt agttctgcgt tatcatgtgt
    42361 tgcttgagga gataattgaa cgaaattcag agacatttac agaaacttgg aacagattta
    42421 taacacacac cgaacatgtg gacctggatt ttaactcagt atttttagag atatttcacc
    42481 gtggagaccc aagccttggg cgcgcgttgg cctggatggc ctggtgcatg catgcctgca
    42541 ggacattgtg ttgtaaccag tctactcctt actatgttgt ggacctgtca gttcgtggga
    42601 tgttagaagc cagcgaaggc ctggatggtt ggattcatca acagggcggc tggtctacat
    42661 taattgaaga caacattcct ggatccagaa ggtttagctg gactttgttt cttgctggac
    42721 tgactttgag tctgttagtt atatgtagtt atttatttat ctccagagga agacactaat
    42781 ctatacattt tctcagcact ttatatgaat cagggtcatt gggcctgcgg ggaactgagc
    42841 cagtaggata ttaggcaagg gtgacacagt gcccatgcat tataatttaa ccaaacagtg
    42901 gtcgtgagtt ttaggccggc catgggggct tacaagaata acatgccaat gacccggccc
    42961 ccacttttaa attctgttgc agcagatagc tgatacccaa tgttatcttt tgcggcagaa
    43021 attgaaagtg ctggccatat ctacaattgg gtgtcctagg tgggatatac gcctgtggtg
    43081 ttctaacggg aagtgtgtaa gcacacacgt aatttgcaag cggtgcttca cgctcttcgt
    43141 taaaataaca caaggacaag atactaaaga aataactgag gtgagtgtgg gaagatggga
    43201 atactatgtg ttatgttaac gggtgagagc ctatactgca gcccagactc ggggggagga
    43261 ggaaatggta agagttatac tctacttatc ttttttgaca ctacatttaa ctgttatgta
    43321 acaatgtttg cttattttca tgttcaataa acgctatgtt aatgatgaag aacctgtgtt
    43381 ctttggaagt gggcccaatg gggtagtagg ttttgggagg gtgccgtgct agatatttca
    43441 actgccacag accccatttt gtcccacctg ttaccacatt ctaggtcctg catccagtgg
    43501 gccaggtgtc tcaccatggc tctttctagg tggataccac agtccaggcc cccaaggcta
    43561 ccgtgctaat tacctcctca tgtccacccc caccctgtgt tactgtcgcc tgattatcct
    43621 ggcttagcag cctccaagtt ttacaagacg tcccattgcc ctgcccttgg tccaagtctc
    43681 gcctgttttc agcagcctgt tgtagcctgc ccccaagttt cgcaggtttc ccccatgctt
    43741 ccacccgtta acccaatagc atgacagcca atccaacacg aggcaagttt taagagttaa
    43801 aagcaactac tgtttatttt ccaaaatgag ctgggtatag ttgatgatct gtaggcgcag
    43861 ctcatcccca cattccaggt ccttgatggc ctcgtagatg gcatcttcgt cgacattgac
    43921 agccttctca tataccgtgt ctctggggct gacctttata cagaaggcgt cccctactag
    43981 gtccacggcc agctcgtagg tggggcctat gttttcacat aacagtttca agcaggtctc
    44041 tgggatgtga agggaggtgc cctggagcag gagatgcatg attaggcgcc cttttccatt
    44101 tgtgctgaag atggggcaga tggtgccaca aaagtgtccg gtgaccaggt aagcgtagag
    44161 aaggctgggt tgggaaagtc cagcctttac tgcactggga gagctgctga gcagagacac
    44221 atagaaggtc ttgttgggta ttatcttgtg gacattgttg aagaaggaga gctgggtgga
    44281 gctaaactcc tgaggcacat gaacctggga cctattgatg cagatctcgc agtgagaccc
    44341 cagagtcagg ctgtggccga agggagacag gcgaaggcag cgcccggggg agagagtgca
    44401 cagtgacagt gggagaaaca cggcctctga gacatgtatg ggggtgttca tctcacgcag
    44461 aaaatctttg cccagctcaa agttggcaga gattcccctg aagaagtccc gtagtgaaaa
    44521 atgggatctg tctacaccat gtctggtgtg ccgggaacat attgatcggg ccacactgcc
    44581 aaccctttcc attcttccca gctctgagcg agattttcca cacctggaca ccgacttcac
    44641 gctatgcgcc gaggcctttg aggccgtgta gtttctgtgg tgcggatgca ttaggcggcg
    44701 caatgcggga tctgccggtc gctgttggcg tgcattcacg gcatctgggg tgaccggggc
    44761 catcgggttt acttttcaca cgtagacctg ggaagtttga taggactgta ccaggtcaag
    44821 gccgtggatg cgcaggacca cgtccagttc cttagtgaca tccacgagga ttgttttgcc
    44881 cactctggcc acttgtgtgg atttaaatat gtacacaagc gtaattaacg agtcacagac
    44941 cccctgttcc agattctgac cggctgcaag cgctgcctta aaggcctgga agctgggtgg
    45001 gtaaatctga ccaaacagca cgctcggatt cgtgatgctg tggttgatgg cacacagggg
    45061 gtcgcagaac aggtgcttgt ggaagtcttg cggggtgcac atctgcagcc aggcccttag
    45121 cctggggcat ggcacatcca gcagcgtgtt ttgggtcttg atgaggaaca cgatcctgtc
    45181 taggattttg atgttgttgc cgaacgagtc aagaatcagg ctcttgaagc ggtcaagggt
    45241 gtccttggcg tccgggtggg ccccgaggct ctcgcagagt gggcagatgg tccgtgaggc
    45301 attcttgtgc cttagtccaa acatgggggc caggaggcag gggccctgcg aatggtcgcc
    45361 agcctccggt ctggtgatgg ccagggccaa ctccgccagc tcatcgccgc tgtattccgc
    45421 gtttaaaccg atagcatggt ggcctggccc cccgagcagg tccgtcccct gccacgtacc
    45481 taatagtagt ccacagtagt cggccttggt tgtaatttta ggagagagtc ctcccttttc
    45541 ggccctgaga aatggatgct gaactcggtt tctggtaggc aggtggcagc acagggcggt
    45601 gtacaggccc ctgccgacgt cccctgggac atcctgggaa tctttgcagg ttctgggtcc
    45661 agggagggta agaaaagtgg gggtggttct gggccacatg gacttgaagc agaagttggc
    45721 cggggactgg ccggtgagga tggatttcag aaactccaat ttgtagtagc cgaggttggc
    45781 atttctaatc atgtcagaag aggacacagg gaggaagcac cggcaaatgt aaaagtgaag
    45841 ctggatgtca atggcaagaa tcctggaggg catgaagagg gaatccaacc ccccggccat
    45901 ggggaagtat tttatcagga tgtgtaaaaa gtccatgcct gtgatgaggc tagagatcca
    45961 ggctcgtggg gcatttagac agtagtagca gagcagggca tagtcctcaa agaaggccac
    46021 gggggcatct gagtgattga ccagggtgtc gagcagatca caaactcggc aggtgctggc
    46081 tggagagagg gactcgtagg tgtggacgag tggtgggtag gctatgcctt cttccgcgtt
    46141 ggctggaaga taggagtggg ccatcaaaag gccgactgcc tcgaactggc ttttcagatt
    46201 gtccacggtc cagggcacaa agtcctccat ctttggagtt ctgcccgcga tctgtgccac
    46261 ctctgttacg ccactcctcg tgagggggca gctggacagt ctttttccgg tcagggggtt
    46321 tggctcgttt gcgctcgtga ctttgtgagc catgacacat ctgggtggca aggtgaggtc
    46381 ttctgggttt ttaataccgg ggtcggcacc agtttctggg acaccgccac aaggacaagg
    46441 tgggctagca agttctcgag tctacgaaga ctccgggggc agtcttttga gtttctcgcc
    46501 tatgatccac cccaatctcg cccccctaat tgcgccatct gcctacgcga ggctgaacct
    46561 cctgaatcac tgcatctttc ttgaggcgtt taaagaagag aatagtggcc agggcctcgg
    46621 tggggtccag cgtgaggtct tatttttgaa aagggatatt ataaaacagg tcattgctcg
    46681 gattgtggca gccgatagca ccctagatct agtgaatcat ggcgagcccg gaagagaggc
    46741 tcctagacga gctcaataac ttaattgtgt catttctgtg tgactctggg tctctggaag
    46801 tggagagatg ctccggggcg catgtgttct ccaggggcag ctcccaaccc ctctgcaccg
    46861 tgaagctgcg ccacggacag atttaccacc tggagtttgt ctacaagttc ctggccttta
    46921 agctgaagaa ctgcaactac ccttcctcgc ccgtgtttgt gatatccaac aacggcctgg
    46981 ccaccaccct gaggtgcttt ttgcacgagc cgtcgggtct cagatcgggc cagagcggcc
    47041 cttgcctggg tctctcaacg gatgttgacc taccaaagaa ctccatcatt atgctgggcc
    47101 aggatgactt cattaagttc aaaagccccc tggtcttccc tgctgagctt gatctcctga
    47161 aatctatggt ggtctgccgg gcctacatca cggaacaccg gacgacgatg cagtttctgg
    47221 tgtttcaggc cgccaacgcc cagaaggcct cgcgggtcat ggatatgatt agtgatatgt
    47281 ctcagcaact gtctcggtct ggtcaagtcg aggatacggg cgccagagtc acaggtggag
    47341 gaggtcccag gcctggcgtc acgcactcgg ggtgtcttgg ggactcacac gttagggggc
    47401 gcggtggttg ggacttggat aacttttcag aagctgagac cgaagacgag gcgagttacg
    47461 ctccttggag ggacaaagac tcgtggtcgg aatccgaggc ggcgccgtgg aagaaggaac
    47521 tcgtgaggca ccccatccgc aggcaccgga cacgcgagac tcgccgtatg cgcgggagcc
    47581 attcacgggt ggaacacgtg ccccccgaga cccgggagac ggtggtgggg ggagcatggc
    47641 gttattcttg gcgcgccaca ccttatctgg cacgggtgct ggctgtcacg gccgtggccc
    47701 tgctcctgat gtttctgagg tggacctgac gttgcaggcc cttggggagc gggggttctc
    47761 caggctcctg gatctggggc tggcctgcct ggatctgagc tatgtggaaa tgagggaatt
    47821 tgtggtttgg ggcaggcccc cagcttctga ggcggctgtg gcctctacgc caggctcgct
    47881 tttccgaagc cactcgtccg cctactggtt gtcggaggtg gagaggcccg ggggccttgt
    47941 ccgctgggcc aggtcacaga ccagcccctc atccctgacc ctcgcgcccc atcttggccc
    48001 gtccctcttg tccctttcag tggtcaccgg tggtgggtgt ggagccgtgg ccttttgcaa
    48061 cgcctttttc ctagcttatt ttttggttgt gcggtctgtt ttccccgcgt tttccgatag
    48121 aatagctgcc tggatctgcg cccagtcccc tttctgcgaa aacacccggg ccgtggccag
    48181 gggttaccga ggcctcgtga agaggttctt ggcattcgtg tttgagcgta gtagctatga
    48241 cccccccttg ttgaggcaaa actctaggcc tgtggagcgc tgctttgcca tcaagaatta
    48301 tgtcccgggc ctggactcac aaagctgtgt gacggtcccg agcttctccc gctgggccca
    48361 gtctcacgcc agcgagctcg atccccggga gattcgcgac agagttacac cagcgactgc
    48421 accttcgttc gtggctgatc atgcctcggc tctattggcc tccctccaga agaaggcctc
    48481 cgacaccccc tgtgggaatc ccattcagtg gatgtggtac cgcctgttgg taaactcgtg
    48541 cctgaggagt gcccactgtc ttctgcctat acctgccgtc tctgaggggg ggagaaagac
    48601 gggcgggggc gtaggggagg atctcgtggg ggccgggggg ccctgcctga gccgggatgt
    48661 tttcgtggcg atcgtaagcc gcaatgttct ctcgtgtctg ctgaacgtgc ctgccgcggg
    48721 tccccgggcc tacaagtgtt tcagatccca cgcctccaga ccggtgtctg gcccggatta
    48781 ccctcccttg gccgtgtttt gcatggactg cggttactgc ttgaactttg gaaagcagac
    48841 aggtgtagga ggcaggctca attcctttag acccactctc cagttttatc cccgtgacca
    48901 gaaggagaag catgtgctga cctgccatgc cagcggccgt gtgtactgct ccaactgcgg
    48961 ctctgcggcg gtgggctgcc agaggctggc tgagccaccg agcgcccgct cgggctggcg
    49021 gccccgaatc cgggcagtgc tgccgcacaa cgcggcctac gagctcgacc gtggctcccg
    49081 cctcttggat gccatcatcc cctgcttggg acccgaccgc acttgcatgc ggccggtggt
    49141 cctgcggggg gtgacggtca ggcagctcct gtatttaact ttgcggacag aggccagagc
    49201 cgtttgctcc atctgtcagc aacgccaagc tccagaggac gcccgcgacg agcctcacct
    49261 gttctcctcc tgtttagagg tagaattgcc acctggtgag cggtgtgcgg gctgccgtct
    49321 ctatcagacg cgttatggca cgccggctgc ccaagcccac cctccagggg aggctggagg
    49381 cggattttcc agacagtccc ctgcttccta aatttcaaga gctgaaccag aataatctcc
    49441 ccaatgatgt ttttcgggag gctcaaagaa gttacctggt atttctgaca tcccagttct
    49501 gctacgaaga gtacgtgcag aggacttttg gggtgcctcg gcgccaacgc gccatagaca
    49561 agaggcagag agccagtgtg gctggggctg gtgctcatgc acaccttggc gggtcatccg
    49621 ccacccccgt ccagcaggct caggccgccg catccgctgg gaccggggcc ttggcatcat
    49681 cagcgccgtc cacggccgta gcccagtccg cgaccccctc tgtttcttca tctattagca
    49741 gcctccgggc cgcgacttcg ggggcgactg ccgccgcctc cgccgccgca gctgtcgata
    49801 ccgggtcagg tggcggggga caaccccaag acaccgcccc gcgcggggca cgtaagaaac
    49861 agtagagggc acgaaacatg gtgtatgcac tttattaata aacaattaca gatacaaaaa
    49921 cttgagtctc tcgaggtctg cgatgaggcg gtgggtggaa cgctccagct tgcggcgaag
    49981 ctggctcacg aagcgagaca gtactcggct agcctgacta agggtgaggc tataacgcag
    50041 gtcctgttcc ggggcggcgg tggatagaga ggagggggat ccggagggga ccactaggtc
    50101 gccggaggtc gaccctcctg tcaccacctc cctgataatg tcttcaatag acagaaattg
    50161 ggtgaccact gagggagtgt tccacagtaa tgttgtctgg tcgctagatg gcgcgggtga
    50221 ggccacgctt tgcgaaaacg aaagtgcttg aaaaggcgcg ggatagcgtg cgctaccgga
    50281 tggcgggtaa tacatgctat ccttacattt tggcattttg ggcagctggg aggcggcgga
    50341 tgggggtgct tcttttcgca cggtgtatgt ttggggaccc gcatgccggt actgggatag
    50401 gcgcacctcg ggccgcgcgc caggctccga gccggaatgc attgggggca atgggattgc
    50461 gggggattgt tgctgtctgc tcctgacagg gagagacacg cgcggcggag atgcagccga
    50521 cggcggggcc gcggtgggct gcccccgagg acgggcgccg gccgccagcg cccccgtggc
    50581 ctttggcacg ggcctggcac ccaccgcttt aattgtgggg gtgggcaggg cagctgcatc
    50641 ttggggcctt tgtgcttgcg ttttttgggg gcgcggtgcc aatgcaccaa ctggggtgtg
    50701 cgccggggcg gccaagccgg accccagggc gggtgcctgg gggatgggaa agccggacgg
    50761 cgcttctccc gggtcgaacg ctggagtagc ggaggctgct gcgccggcgg ccaccacggg
    50821 cgcacggggt cgcagcccga cggccgtggg gaggcgggtg gcggagggcc gaatctccgc
    50881 ggcttcttcc cggcccccct gctgtttctt ctcccgttgc atgatagaat ggccataggg
    50941 tgggtcctga gaggaggctt gtgtgtcctg gggctggagc ccaaaagtcg ttaaagacgc
    51001 tgctgatggt gtgggagcta tgcctcccgt cgactggccg ggcttgtagg gggctgaggg
    51061 tggataactg ggcttctgtg aaggcaccaa ccctggaatc tggatggtat gtttcttctg
    51121 tgaccccgag gcagtcgatg gtgtagagtt tggagacaat gtgtagacga tgggcccttg
    51181 ttcagaagcc cagggacttg aggggggctg ttgtggtgct ggttggggaa ggagctccag
    51241 ggaatctttg ggccatggcc ttggggaggt tcccggagac cggtctgggc tctcggaagc
    51301 cctcgtttcg gccccgaaat agggccttgc catcaatcgg gggcctggga gagtgatggg
    51361 ggcggccaat cccggggtaa ctgtcacgtc ccggggggag gaggtaggag acagccagtc
    51421 cctgggcctg ccaggggcca ccttctctaa gagggggctc tgtgggctgg gagggccaga
    51481 ggcctcagat tcagcagtag tgctcccctc ttccccctgg tccgtctccc ctcctcccaa
    51541 ctgctggagc cggtcggagg aggccggggt gttatctgct gactgaaacc cgtccccgct
    51601 gaccagtccg tgccccaccc ttggggggaa accggagaac agctcctgga cgttgcgtgg
    51661 attcggggga agctggtatc caaccggcag tggaggatct tcgtgctcgt agaaggaggg
    51721 gttgagtaca tcggtcggcc atcgtgaggc cccggccgcg ttaaagtaga actgcacgtc
    51781 cggcagattg tgccgatagg tgaaacactt ccagatgatg ttttttctgt tggccaggat
    51841 ggccacggtg gggggcctgg cctccttagg tttggcggcc ctggcctcgg tgagaagctc
    51901 gcgtagccac acggcctggc gtgcaaagat ggacatctct ggctcgaaag actcggagta
    51961 gccgtccagg tcctgcagaa aattcagcga gatggtctcc accagggacc ggaagggctc
    52021 agagtgcccg tcgcagtaga ggaggggagc aacgaccctg acctgtccca gggtcttcag
    52081 gttaaacaga tattgagagg agacaaagag agttaggggc cgaccgagga aggccgccgc
    52141 cacggccgcc tcaaaaacgg agacggggat ggtgtcaccg gagcccctct taggaccggt
    52201 aatgggagtg ccataaggca taagatttct cagggcccgg ccggtaacgg tgccgtagga
    52261 agacggggtt tcgcggggga cctcgagtcc ctccgccctg gggagctctt ctccgcgtgt
    52321 ataggcctgc ttcacaaagt cgcgcaggta gtcctgaaat gcgaccgggc cctccagcgg
    52381 gcgcaatgag tgccagagct gctgaagggc ctcgggggcg aagcaccggc gtgcgaggag
    52441 cagcatgcag gctcgggcgc gggccgtact ttggttgtgg accaggccca agaactcggg
    52501 gtgcggccag agggcggccc gggtatccat ctcctcccag gcgtcctgga agaagatgaa
    52561 gccggtgggt ggaccggcga tgcggtggcg ggtgaggcgg cgcgcgtctt ccccgtcgtt
    52621 gctgccgcgg gtggttgagg gcatgccccc cctcccggag gctggactcc tgaccagcct
    52681 gtaggtgagg accgagtccg acaggaggtc tcccaaaccc ccatctctcg ctagagccga
    52741 gaccaggccg agtcctgcgt agaacgatgg ggcgcccagg aaggcggcag cgtaggccgg
    52801 atgtgtgccg accagcagcg ccatcatctc ccgttgttcc aatagaataa cttcccggtc
    52861 tgtggccggg gctggataag gggggtgatt cctagaggcg atgagactgg cgtgcgctaa
    52921 aagcgtcatg gccacaatgg ggttgtctgc caggtcttcc atcagggctt tgggcgcaga
    52981 gacgtattcc cgaagcagct ccccggcgtt ggactccacg tcgggccagg tgtcccagta
    53041 ggagtcggcg gcggcggcgc tgaggcgggc ggaagctaca ctggccaggg ttcttctcct
    53101 cctctcttgg tcatcctgcg ggggaccaat agcttggggg cgtccggctg gggtcaggga
    53161 aaaggcctct gggttctcca gcacggtggg catgacatat tccagaaagt tgtggtagac
    53221 ggggatgtag ttgagcggct cctgggtgtc tgcggagacg taggccgggt taagggggtc
    53281 gcagggagac tctgtttcca gccagagggt gccggcgtat ttcgccggcc ctgccgccgc
    53341 cagaaattgt gcccgccggg tcggggctcc attgccccat ccagttggtg gtgccgaaat
    53401 cgtgatgagg aggggcaggt tgttggtcaa gggatgctta acgaaaacgg taggctgggc
    53461 ggtctcgtaa aaagccagga aactctgctt ggccgaggca tagcgcagca gcttgtcctt
    53521 gaggagtgca tactgggagc cagccgaggc cccaagcgcc aggcccctgg cagcctccac
    53581 cacgatcttg agctggcgcg ggtcggtgtg gcccctggcc tgggtgacca gatcctgcag
    53641 cgttccctgc agctgggact cttcctgggc ctcctggatg atggcctcca gtcgggagag
    53701 gcgccttttc cagtctgcga cggtctcctt gccccccgcg acccgcttgg ggtccaacgt
    53761 ggccagagcc aacctcagct cctccatgcc atccatggag ttctgggcca tgccctcgac
    53821 ttccaggagc cgtgttagct catgaatttc accgtcagcc gcagcggcta ggttcagcca
    53881 ggcacccaca cccccagcta aggccagggc tccttcggaa agaccccgca ctgcctcgca
    53941 gatgccccgg atccacttgg cggctgccag ggatttccgg tagggccacg agccgttccc
    54001 ggccgctgcc cgggccaggg cggcctcgag gggagcctgg acaggggctt tgggcgggga
    54061 ggggagcagg ctccggagtt catcgtcggg ggcttcgtcg cgtgacctgg agaggacggc
    54121 ctccagagcc gtgtgaaagc cccgccgagt gcttgccgcc atctcgtggg ccttcgccat
    54181 cagggtctgg ctctcccgga cctgctcttc cagcgcccgg acctcggccg cctcggcctc
    54241 ggtcagcagc tctgagaaga agtcccccgt ggcctggagg agatcgtccc gctctcgcct
    54301 tgtcagcagc tggggcttct taggccagag cgccgagtcc gaggccagcc tgggcggggc
    54361 ggttgcctgg gggatagttg gaggaggagg caggttagcc tggcctgggt cattagtggc
    54421 ttcgggtagc gtccgatcca cgtactcgct cacgatggcc gtcagggcag cctcggctga
    54481 tcgtcttttt tccagaagcc cggccagccc ccgctcgtac tccgcgtagg gggcctccag
    54541 atccgtgttg accaccgctg atttcatgtc cggggactgc agggcctggc gcgtctgcgc
    54601 gagggccgaa cggatggcat cggccgccgt cctggcacga aagagggccc cggccgcttc
    54661 ctccgctcct cgccctcctc ctccttcttt ggcggtagcc gcgggggtgg cgggccaagc
    54721 gtccagtctg gccagagggc cggtctcgat ctccgtgaac cagccgggtt ccacggcctc
    54781 cattctctcc gccgcaccac catcgtccac gagcagggat cgcagtctct ccctcctcac
    54841 cctcgttatt cccaatagca tagcggcaag gatctgtgtg agggagtcca agatgtccgt
    54901 gtttctggct actgccgccg ctgctgccgc ggctgagtcc gtattgtctg gcagcaggga
    54961 ggccagcagg gtgttccagt catcgggcga agtgggagcg ggctctgggc gtgcccccag
    55021 cgccttccta attctggccc aggcctcatt cgcctctcgc gctcgccgct cccgcctctc
    55081 cttgtcttcc tgttctcgga gcttctcctt ttccttgcgc ccggtctcca taagctgccg
    55141 cagcttcttc tcatactgtc gcttgagctc tttgttgggg gcagtgtcca gaaaggcctc
    55201 gagctgttcc tcggtggcgg gcttaaagcc ttcggcctcc aggcgccagg cctgcacctc
    55261 cttctgtctg agctgatcgt tgttgttatt cttcaatttc tgcaggtaac ttaggaagcg
    55321 tttcttgagc ttccctggga tgagcgtttg ggagagctga ttctgcagcc cagagagtag
    55381 tctcagggca tcctctggag cctgacctgt gaccgtcgca tcatagaccg ccagtagacc
    55441 tgggagcaga ttcaccgccg cggccgtctc ctttaaggtg ctgtgagtag caaaattctg
    55501 caaggccact aggcgcgctg gctccagcgt cagccggttg cccatctcga atgtgtgcag
    55561 ggcctctgag accatggggt ccaggatgcg gtcaatgcca tcctgcacct cagggtcaag
    55621 gaccggcaag tcacgataga ggtggtctat gctctcctcg aaggaggcaa tgtagttatc
    55681 gatggtgtag aaggtgatgg atttcaggat gttcatcagg tactttttgg agcggacaat
    55741 ctgctgtata gtgtcacgta ggcggatgta cgtggggttc tttgcggccc cgactatcga
    55801 ccctgcattt gcgatgtact tttctatgac ggggatggtg agggccgcgg tgtcggccag
    55861 tggtggcgtg gcttcggggt tgtcgtggtt ggcgggtgtc gcagagggag aggcgggaga
    55921 gatgggggcg cctggggccg aggccacacc ggccaggccc aacattgcct cgatgtcgtc
    55981 caggatggtg cggaggcgct tttcgttttc tctggtggtc tcgagctcct tctgtttttt
    56041 cgcgactgtc tcaaactctg gaaggggggc aatgctgggg tcgtcctcct caactcgctc
    56101 caggggccag gggataccgc tcatatcact aagggcggtg cccaggtaga ggagctcgcg
    56161 atagtcccat tcaatggacg tgtaccggat gtttaggaga ggcagggagg cgatgatctg
    56221 gcatgtgtgc cgcaggtgtg tcaggaggtc gtcaaaatcc atcaccgttg ggaggcttgg
    56281 gtcctcaagg taggagagat aatcggaggc cgccgaggcc accttgtccc tgatgtccgc
    56341 cgtacacctg cgcacgtgca gggccgcatt cttggaccgg acgggcacgt tgtggacaaa
    56401 ggggggcact gaggcggcgg gaggggcccc atactctatc gctgtcaaca gcgccaaaaa
    56461 gcggacgtcc tcctcatcta ccccagcctg ttgtctggcc acggccgttc gggcggcctc
    56521 cgccagggat aggaggcgct tccagctctc gtcgtccagg accaagggga catccacgtg
    56581 cgggcccctg tagatggaat gatcctcggg ttctcctcct ccttcctccc cctcctgatc
    56641 tccgcccgag agcaggtcgg tcaggcgtct acgggccgcc tccaggtcaa attttccgtc
    56701 gccgctctcg gccagctggg gaatttcagc cagcatctta gcaccggcat ctacacggac
    56761 cgcgtccttc gtggccaggg acggcaggca ggcctccagc tttgcggcca ggtgctcatg
    56821 gaactctccc gctcttccct tgttttctga tagcatgttt gcgaggtttt ggatgttaag
    56881 ttcggaagtg agcagttgct ccaggtccag cgtggggacc tgcagatgtc ccgaccagtc
    56941 ctttaagaat tccagcagat ttagcacagc cgatcggtcc ctactcctta ttagcccctg
    57001 ctcgaggacc actgtcacaa gaagatagtc tatcatgctc aaggcatctg cctctggcac
    57061 ttccctgtta gaggccgggt cgtagacgat ggcctgttcc tggtaggtat gtccggctat
    57121 tctcgcaatg ttgctctcga ggggcacaaa gtccatctca ggagtctcta tgtcaaaggt
    57181 ggtctgatag tattggctcc tggcggtgtc cagtgtgatg ggggacgtgg gggcactgga
    57241 tcccgattcc aggctgttgg agaacacttc atcttcaaac atgtcttcat cctctgtggt
    57301 ggggatatcg gaggctaagt cgctctccgc ttcttcagag tcggacatgg ataggaaagg
    57361 ctcctctagg tcagacaggt agcggacgag gccagaaccc ccagatgcat catccccaaa
    57421 ggagggctgc tgcccgaagg gaggtgatgg ggatatctcc gttccagccc tgtcagcggc
    57481 cgagggattg tttttttctg gttcgagtgt cgtggctgat ggtgggagct gctgagcatg
    57541 aggaggagcc ggggtagctg atggcagggg ctgctgctga ggaggaagag gagaaggagc
    57601 ccgggcggct gacggcgggg gctgctgctg aggaagaagt ggagagggag ccggggcggc
    57661 tgattgcggg ggctgctgct gagttggagg aggagaagga gccggggcgg ctgattgcgg
    57721 gggctgctgc tgagttggag gaggagaaag agtcgtggcg gtgggggctg ctgctgcagt
    57781 cggggaaggg gatggggtgg tcagagggat ttctgggttc gagggagctg cctgtggcag
    57841 agggatgggt atttgcaaag ggaggcgagg agatggagtg actgaaggag cgatagttga
    57901 gactggcgcg gggcggggtg tcggggaggc gggtggtgat tggtgaggga tggggattac
    57961 tggaggggga aggcgagctg ctgaaggggg gcgatggggc ggaacgtggg tgcgtggcag
    58021 ctgatcatcc tctgtgtcag tggtggagga cagagggagg cggcggccgg aggtgggctt
    58081 cttgtggggg ctatctttgc ccaatccctt tttcctcttg ggagtctgag gcgctgcgcc
    58141 gcccgacgcc cttggtggcg tggagggagc ggggaccccg ggggtgtgac ctaggccggg
    58201 gatggggatg aagaggggag ggctggaggc cggggccgcg gaggccgggg ccgcggaggc
    58261 cggggccgcg gaggccgggg ccgcagaggc cggggccgca gaggccgggg ccgcggaggc
    58321 cggggccgca gaggccgggg ccgcagaggc cggggccgca gaggccggag acgacggcgg
    58381 ggagttggtc tttgcaggac tatacctggc ggcagggaat gagtcggatg tgaaagatcg
    58441 agagggcagt ggcctgaggt tatacggtat tattcgccgt tcaaacggta gcatgacggg
    58501 agggctgcta tcagcaccgg gcgtccccgc cgcctcccca tcactggaca caagctcggg
    58561 ccccaccagg tcaaagccgc tgccgttggc ctcataaaag tcatacacgc catagtgttc
    58621 cagcataaag atgcgggggt cctctgtctc aaaggcctcg ggtagaaaat agagatgcac
    58681 gcaagtgtac tgggcccctg gtgcccccac gtactgcagg atgtcgtgcg cataggtgct
    58741 gactctgaca tgggcggggg tgcccggggc cgcatccttc tggcagtggg ggtcaaacaa
    58801 gtagaaggag ccatctgtct cgatgatgat ggcccccgcg tagatgtcgc agatgtagag
    58861 gatgaactgg gccaccccgt tgtaactgcc gtgcaggacc tcggccaggg actgaacaac
    58921 tgccgagttt gcgatctggg cagggaatag gacgaggcca aagatctccg ccgagcggta
    58981 tatgtgcacg cgcccaccgc ccctcaggac cacggagctg ggcacgtccg tcaactgggc
    59041 catctcgtgc cccttgagga tgccgctctg gcgcatgagg gcatccagcc gcgccccctc
    59101 gtccaggacc tcgtccagct cagggcggga ggtcaggggg cggccggcca ggaagctctt
    59161 gaccaggtag aggacgcagt tgctgacgca ctggatgccg gcaaagcggc caaacttgca
    59221 gtgggcctgg ttgcacgagg ccgtgcctag gatgcggagg gccgagcctc cactcccgcc
    59281 cccgggggca ttcacatcca tggtcctgat tccgcgcacg gggccggttc cccgggtgcg
    59341 ctggctttgc ccccagtcgc cgttactcat cttcggcggt ggggcgggga ggacgccttg
    59401 tcgcccccct tctggtccgg ggtcttacgc ggctggcggc ggcagccgcc gagagataag
    59461 gggggtacgt gtgtgcctcc gcctctcctc tgtctgggcc gccgccgccg cttgcccgcc
    59521 ttgaaggaga gggggtagtc cgcggactgc gtctgcgggg gcaggaggtc tcaaccttct
    59581 gggctcgggc cgcggtgtcg atatccgatg gcctttccct gtcttcctcg tatgctcctt
    59641 ctcctcctcc tcccggcacg cccctgagat ctgcctcccc tccctctccc tcgtcctggt
    59701 cggaaaagtc tgaggaggag aaggagaatg gggaggagtc caaaacggca cgccacctgc
    59761 cgtggggcgg tggtgacagg tcccggctgg cccggcgctt gctcgcgttc ctgccgttac
    59821 ccaggagaat ggccgcgagt tttttggcgg ggaggatgcg gaatggcggg ggcgtttgtc
    59881 ccacgggtga gggggaatcg tcggttaggg ccggcacgag gtggtgggtc tggacccggg
    59941 ccgtgcgagc aaaggcggcg agaaccgagg ggcttctggg ggtgactgtg atctgttccg
    60001 gatttaggtc catggcgggt gtgtatgttt taataggggt ggtctctggc gcggcaggat
    60061 gatggtcgag gacgtccacc agggccttgc agatgctctt gcctagatac aggatgtcgt
    60121 ccatgctgag gggaggtggg gtgtctgctc ccccctgcgg aagccgcctg ggtgcggggg
    60181 tgaagacagg tggtgggcgg gcgtctcgcc ggactatggc ctcggcacgc tcggcgtcga
    60241 tggcgggtgg ctggaacagg cgggcgaatg tgtaatcccg gaaccggtag gcgacgctgc
    60301 gcctgagggc gcccgtcagg ctgtatccca gctccagggc gtgctccacc cgctcgttga
    60361 gctcctcgag atccggacgc aggggctcgc tggtgtgggc ccagaggggg tgatccgcga
    60421 tgccccggct ctccctgagg gccggcacca ggaggcgcct tctgagggtg gccgtgtcgg
    60481 ccgtggccag ggcccacctg gcggcggcgt cccggcacac atcctggatg ccctccacga
    60541 cgctctttag cgtctggagg tccgtggagt agtggcgggg ggaggatgaa acgctctttt
    60601 ccttcaccgc taccaccgcc tcctcctcct cttccgtcgc cagagggatc tgcaccctcc
    60661 cggtctctgc gtcgtacagg agcgggcggg agcacagcct ccaagctgcc cccgtcaagc
    60721 gcgagatgtc ctccgagagg gtctcacccg agaccagaaa gcggcgggtg gccaggccca
    60781 acgactccgc cgtcgtgctg tatctcaggg tgaagaggag tgaaaagagg gaggtgggcc
    60841 aggcaagcgg tggtgcttcc gccgcccgct ctgaagctga gatagtctcg gagatgatgc
    60901 ctgagacctc tcggacggcg tccatgatcc taaggactgc gtcgtgggac gacagccccc
    60961 aggggccccc gccctcttcg tcttctgcac cctcggctcc tgcgtccccg gccttgcctt
    61021 ccccctctaa gttgaggggg cgcagtccga ccgcctgggg ggactcccca ggcatcggag
    61081 gggccccgtc atagatctcc cagacggtgg cgtatatgag ctcgagagga cggcgggccc
    61141 gggtcagctc gggggaaggg agggccaggt cgctgccgaa ggagaccagc cagcgcaggg
    61201 cggccagaga gcgggttttg ggcagctcgt tggagaggac ccggcgaagg gcgggccaga
    61261 tttggaactc gatgaaggcg gccgggaaga aggggctgcg gacataggcc ggatccgcgc
    61321 gcgccgtttg gccggccctc agggaccggc agtatgcctc gacgtctgtc cgcggggccg
    61381 ccgccaccgc cgccgtccac tgccttctcc cctgctcgcc ggggagtagg gggggcttac
    61441 aggggagggc cggagccggg gccggggcct gccacaggcg gctgtagcgg acccatagca
    61501 gagacctgag gagttcggat gaaaggtccc ccgccacctg ctcatactcg gccgcgggag
    61561 gagggacgat gaagatgcgc agaggggtta cggcgtccca agggtccgcc gccgccccca
    61621 cacccacagc cgtcgcggcg ggggcggcgg cgggcgtaga ggggccgctg gtgcgccggg
    61681 ctcgtctgtc cacggcctcg gcctccgccc tcaggtaggc cgcccgggcc acacgggcga
    61741 agcggctcgt ggggctcgcg gtgggcagca gtcggaaaaa gtgcagggca aagcccgata
    61801 gactctctag gagggcggcg gtggcctcga gccacctcca ccgcgagcgg gacacccggg
    61861 gcacagaggc cagcatcatg gcgtagtccc ccgccacggt ctcgttgagc ccggccgaga
    61921 gcagaaccgt ggccacctgc tcgatggcgg ctggagagaa ggatgcccgg ctccccgccg
    61981 cctcctgcac acgagcggcc agggcctcca tctctgccgc catcccggcc aggaaggcct
    62041 cgatgaccga gtctgggacg ccgtaagtct ggtcccagag cagggcctcg tacacatagt
    62101 cgtaaaagag ggcccctgag ggctccaaaa gccggagccg ggcggcgtca aaggccagga
    62161 cgggcacagc cgcgacgggg ggcgtttgtc ccccgctggc ctccgcgtac acgcccagga
    62221 tctctaccgc ccgccgccgg gccaggggca gtgaggccac cacgctggaa agtgactcgg
    62281 ggcggtgaaa gagaccgcca ccgccgcttt cttcaccctc tcccccgccg gccccgcccc
    62341 cactgtgctc caccagctcc acggccatgg ccttgatgtc cgcggccgtg ggctgaccct
    62401 gccctgcagc cgcccagggg tagcggttgg tctccgcgta tacggtgacc agccatctcc
    62461 ccagcgtcgt tttcgccgcg ttaaaagcgt agaatgacag cccctcccgc gggaaggcgt
    62521 cccaccgggc cagataagtg tcggccacca gctcttccac gaaggcaaag gtggccgttg
    62581 ggccagagac cgcgagcacc tccccgctgc cctcttcgat gatgcgccgg tacgtggccg
    62641 ccagggcccg ggtctctgcg atgagccgag agccgtccag cggatcgtcg gtggccggag
    62701 aggctgtcgt ggggggcagt gaggaggcca gcacgtccag ggccgcctcc agatggccga
    62761 ggccgaagct gcgcctggaa aaggaggccg cccggagtag gtagtaggcg tggtggcgga
    62821 ggaccgccgc cgggtaagcg tggccgctca tgagggtgag agtatttaaa aaatcgcgca
    62881 ccagcaccgg ctgggccaaa tctcccagtc caaagatccc cagctccaga ggcatcagcg
    62941 cgcgcaggcg ggcagcgggg tcgtccccag acagcagcaa ctgacgcgtc acgcgggcga
    63001 gccccccgtc cacctctgcc aggggcggct gggcgtctgc ccctccgcta ccgccgccgc
    63061 tgtcactctc catagcggac gccatgaagg tccaggggtc cgtcgatcgc cgccgtctgc
    63121 aacgccgaat cgcggggctg ctgccccctc cggcccggcg tctaaatatt tcccgggggt
    63181 ccgaattcac gcgggacgtt cgtgggctgg ttgaggaaca cgcgcaggcc tcctcgctga
    63241 gtgcggcggc cgtctggcgc gcagggctgc tggccccggg ggaggtggcg gtcgccgggg
    63301 gtggcagtgg aggggggagc ttcagctggt ctgggtggcg gccgccagtc tttggggact
    63361 ttctgataca cgccagctcc ttcaacaacg ccgaggcaac tggaacgccc cttttccaat
    63421 tcaagcagag tgacccgttc tcgggcgtcg acgcggtatt cactcctctc tccctgttta
    63481 tcctaatgaa tcacggccgg ggtgtagccg cccgggtcga ggcaggtggg ggcctgacgc
    63541 ggatggccaa cctgctgtac gacagccccg caaccctggc tgacctggtc ccggactttg
    63601 ggcggctggt ggccgaccgc cgcttccaca acttcatcac ccctgtgggc cccctggtgg
    63661 agaatataaa gagcacctat ctgaataaaa tcaccacggt ggtccacggg cctgtggtca
    63721 gcaaggccat ccctcgcagc accgtcaagg tgacggtgcc ccaggaggcc tttgtggatc
    63781 tggacgcgtg gctctccggc ggcgccgggg gtggcggtgg aggatgcttc gtcggggggc
    63841 tgggcctgca gccgtgcccc gccgatgcgc gcctctatgt cgctctgacc tatgaggaag
    63901 ccgggccgcg gtttacgttt ttccagtcgt cccgcggcca ctgtcagatc atgaatatct
    63961 taagaattta ttactcacca tccatcatgc accgctacgc tgtggtccag cccctacata
    64021 tagaggagct gaccttcggg gcggttgcct gtctggggac atttagtgct actgacggtt
    64081 ggaggaggtc tgccttcaat taccgtggct ctagcctccc cgtggtggag attgacagct
    64141 tttattccaa cgtctctgac tgggaggtga ttctctagac ttaacgggag gaaacaggag
    64201 gaggaggggg acaagagcac aaaagtggtt cagtggacac ccaccacaca gcatggcaac
    64261 gaccagtcat gttgagcatg agctcctctc caaattgatt gatgagttaa aggtcaaggc
    64321 caactcagac cccgaggctg atgtcctggc agggcgcctg ctccaccgcc ttaaggccga
    64381 gtcagttaca cacacagtag ccgaatatct ggaggtcttc tctgacaaat tctacgatga
    64441 ggaattcttc cagatgcacc gggatgagct ggagacccga gtctctgctt tcgcgcagag
    64501 cccggcctac gagcgcatcg tctccagcgg ctacctgtcg gccctgcgct actatgacac
    64561 ctatctgtat gtggggcgca gcgggaagca ggagagtgtg cagcactttt acatgcggtt
    64621 agccggcttc tgtgcctcaa ccacctgcct ctacgcgggt ctcagggcag ccctgcagcg
    64681 ggccaggccg gagattgaga gtgacatgga ggtgtttgat tactactttg agcacctaac
    64741 ctcccagacg gtgtgctgct ccacgccctt tatgcgcttt gccggggtgg aaaactccac
    64801 tctggccagc tgcatcctca ccacccccga cctcagctcc gagtgggacg tgacccaggc
    64861 cctctatagg cacctggggc gctacctctt tcagcgagcc ggggtgggtg taggggtgac
    64921 gggggctggc caggatggga aacacatcag cctcctgatg aggatgatca acagccacgt
    64981 ggagtaccac aactacggct gcaagcggcc ggtcagcgtg gcggcctaca tggagccctg
    65041 gcacagccag attttcaagt ttttggaaac gaagctgccg gagaaccacg agaggtgccc
    65101 gggcatcttt acggggctct ttgtccccga gctcttcttc aagcttttta gggacactcc
    65161 ctggtcggac tggtacctgt ttgaccccaa ggacgccggg gacctggaga ggctctacgg
    65221 ggaggagttt gagcgcgagt actatcggct ggtgacagcg ggcaagtttt gtgggcgggt
    65281 ctccatcaag tccctgatgt tctctatcgt caactgcgcc gtcaaggccg gcagcccctt
    65341 catccttttg aaggaggcct gcaacgccca cttttggcgc gacctgcagg gcgaggccat
    65401 gaacgctgcc aacctgtgcg ccgaggtgct gcagccctcg aggaagtctg tggccacctg
    65461 caatctggcc aacatctgcc tcccgcgctg cctggtgaat gcgcctctgg cggtgcgggc
    65521 acagcgggcc gacacgcagg gggatgaact cctgctggcc ctccctcgac tctcagtcac
    65581 cctacctgga gagggggcag tcggtgatgg attctcgcta gcccgcctca gagatgccac
    65641 ccagtgtgcc acctttgtgg tggcctgctc cattcttcag ggatccccca cttatgattc
    65701 cagggatatg gcctccatgg gcctcggggt gcagggcctg gccgatgtct ttgcggacct
    65761 gggctggcag tacactgacc ctccctctcg ctcgttaaac aaggaaatat tcgaacatat
    65821 gtactttacg gccctctgca ccagtagtct gattggactt cacaccagga agatttttcc
    65881 gggtttcaaa cagagcaagt atgccggggg gtggtttcac tggcacgatt gggcaggaac
    65941 agacctttct attcccaggg aaatttggtc tcgcctctct gaacgcattg tgagggatgg
    66001 gcttttcaat tcacagttta tcgccctgat gcccacctca ggctgtgccc aggtgacggg
    66061 ctgttcggac gccttctacc ccttctatgc caatgcgtcc accaaggtca ccaacaagga
    66121 ggaggccctt aggccaaacc ggtctttttg gcgtcatgtg cgtctggatg acagggaagc
    66181 tttgaatctt gtcgggggcc gtgtctcctg cctcccggag gctctgcggc agcgctacct
    66241 gcgtttccaa acggcctttg attacaacca ggaggacctg attcagatgt cccgggacag
    66301 ggcccccttt gtggaccaga gccaatctca cagcctgttt ttgcgtgagg aagatgccgc
    66361 gcgggccagc acgctagcca acctactggt gcgcagctac gagctgggcc tgaagactat
    66421 catgtactat tgtcgcattg agaaggccgc cgatctgggg gtgatggagt gtaaggccag
    66481 cgcggctctg tcggtgccgc gggaggaaca gaatgagcgg agtcccgctg agcagatgcc
    66541 gcctcgtccc atggaaccgg cgcaggttgc ggggccggtt gacatcatga gcaagggccc
    66601 aggggaggga ccaggtgggt ggtgtgtgcc cgggggattg gaagtgtgct ataagtaccg
    66661 tcagctcttc tcagaggatg atctgttgga gactgacggt tttactgaac gagcctgtga
    66721 atcttgccaa taaacgttta ttgccatgtc caagttgttg tacgtgcgtg atcatgaggg
    66781 ctttgcctgc ctaacggtcg aaacccaccg caaccgctgg ttcgcggctc acattgtcct
    66841 caccaaggac tgcgggtgtc tcaagctact caatgagagg gacttggagt tttacaagtt
    66901 cctctttacg ttcctggcca tggccgagaa gcttgtgaac tttaacattg atgaactggt
    66961 caccagcttc gagagccacg acattgatca ctactacacc gagcagaagg ccatggagaa
    67021 cgtccacggg gagacttatg ctaacatttt aaacatgctc tttgatgggg acagggcggc
    67081 gatgaacgcc tacgcagagg ccatcatggc cgacgaggcc ctgcaagcca agatttcctg
    67141 gctccgtgac aaggtggcgg ccgccgtcac cctgccggag aagattcttg tgttcctgct
    67201 gattgaaggc atcttcttca ttagctcctt ctacagcata gccctgctgc gggtccgggg
    67261 cctaatgcct ggcatctgcc tggccaataa ctacataagt agggatgagc tgctccacac
    67321 ccgcgctgcc tccctgttat acaatagcat gacagccaag gctgaccgac caagggccac
    67381 ctggatccag gagctgtttc gcactgcggt ggaggtagag actgccttca tcgaggctcg
    67441 tggagagggg gttaccttgg tggatgtgcg agccataaag cagtttctgg aggccacggc
    67501 cgatcgcatc ctgggtgaca ttggtcaggc tcccttgtat ggcacaccac cccccaagga
    67561 ctgcccgctc acctacatga ctagcatcaa gcaaactaat ttctttgagc aagagagttc
    67621 cgattacacc atgctggtgg tagatgacct ttgagtcagg gtggctactt gctcaggttt
    67681 ctgggcataa attctcctgc ctgcctctgc tctggtacgt tggcttctgc tgctgcttgt
    67741 gatcatggaa accactcaga ctctccgctt taagaccaag gccctagccg tcctgtccaa
    67801 gtgctatgac catgcccaga ctcatctcaa gggaggagtg ctgcaggtaa accttctgtc
    67861 tgtaaactat ggaggccccc ggctggccgc cgtggccaac gcaggcacgg ccgggctaat
    67921 cagcttcgag gtctcccctg acgctgtggc cgagtggcag aatcaccaga gcccagagga
    67981 ggccccggcc gccgtgtcat ttagaaacct tgcctacggg cgcacctgtg tcctgggcaa
    68041 ggagctgttt ggctcggctg tggagcaggc ttccctgcaa ttttacaagc ggccacaagg
    68101 gggttcccgg cctgaatttg ttaagctcac tatggaatat gatgataagg tgtccaagag
    68161 ccaccacacc tgcgccctga tgccctatat gcccccggcc agcgacaggc tgaggaacga
    68221 gcagatgatt gggcaggtgc tgttgatgcc caagacggct tcctcgttgc agaagtgggc
    68281 acgccagcaa ggctcaggcg gcgttaaggt gacactcaat ccggatctct acgtcaccac
    68341 gtatacttct ggggaggcct gcctcaccct agactacaag cctctgagtg tggggccata
    68401 cgaggccttc actggccctg tggccaaggc tcaggacgtg ggggccgttg aggcccacgt
    68461 tgtctgctcg gtagcagcgg actcgctggc ggcggcgctt agcctctgcc gcattccggc
    68521 cgttagcgtg ccaatcttga ggttttacag gtctggcatc atagctgtgg tggccggcct
    68581 gctgacgtca gcgggggacc tgccgttgga tcttagtgtt attttattta accacgcctc
    68641 cgaagaggcg gccgccagta cggcctctga gccagaagat aaaagtcccc gggtgcaacc
    68701 actgggcaca ggactccaac aacgccccag acatacggtc agtccatctc cttcacctcc
    68761 gccacctcct aggaccccta cttgggagag tccggcaagg ccagagacac cctcgcctgc
    68821 cattcccagc cactccagca acaccgcact ggagaggcct ctggctgttc agctcgcgag
    68881 gaaaaggaca tcgtcggagg ccaggcagaa gcagaagcac cccaagaaag tgaagcaggc
    68941 ctttaacccc ctcatttaac accatgttct cgtgcaagca gcacctgtcc ctgggggcct
    69001 gtgtcttctg tctcggcctc ctggccagca cccccttcat ttggtgcttt gtctttgcca
    69061 acctgctctc tctggagatc ttctcaccgt ggcagacaca cgtgtacagg cttggattcc
    69121 cgacggcatg cctaatggcc gtcctctgga cgctggtacc cgccaagcac gcggtgaggg
    69181 ccgtcactcc agccatcatg ctgaatattg ccagcgcctt gatcttcttc tcccttagag
    69241 tctactcgac cagcacgtgg gtttctgccc cctgtctctt tctggccaac ctgcctctct
    69301 tatgcctgtg gccccggctg gccatcgaga ttgtttacat ctgcccggct atacaccaaa
    69361 ggttctttga acttgggttg ctcttggcct gcaccatctt tgccctgtcc gtggtctcca
    69421 gggccctgga ggtgtcggct gtcttcatgt ctccattttt catctttctg gctttgggct
    69481 ctggaagcct ggccggtgct cggcgtaacc agatttacac ctcgggtctc gagcggagac
    69541 gcagcatttt ctgcgcccgg ggagatcatt cggtggcatc cctgaaggag accctccata
    69601 aatgcccgtg ggatctgctg gccatctctg ccttgaccgt tcttgtcgtc tgtgtgatga
    69661 ttgtgttgca tgtgcacgca gaggtgttct ttggactctc tagatacctg cccctctttc
    69721 tctgtggggc gatggcctcc ggggggctgt acctgggcca ttccagcatc attgcatgtg
    69781 tcatggccac cctctgcacc ctgtcatctg ttgtggtata tttcctccat gaaacccttg
    69841 gacccctggg caagaccgtg ctgtttatct caatctttgt ctattacttt agcggggtag
    69901 cggccctgag cgcagctatg cgctacaagc ttaagaagtt tgtgaacgga cccctggtcc
    69961 atctccgtgt ggtatacatg tgctgttttg tctttacttt ttgtgaatat ctgttggtga
    70021 cattcattaa atcctaacga ccggagtcct gtctctttgt gttcttgggg gacttgagtt
    70081 agctgtcttt cctcttatta cattgggcta acgggaggaa atgaacccag gggtggcagt
    70141 ggatggggtc atttatgggc aaaactcaca ggacatgttt ggggagttag cattggcgtc
    70201 gggaaacaca gctctggcag ttataaccgc accagctaac aggacatgtt tgggggagtt
    70261 ggcattggcg tcaggagaca cggctctgtc agttatcacc gtaccatgag tgccatgtgt
    70321 gtccagtgcc taatcaccgt tcctcatttt gtgtgcctcc tcaaatgttc cagaagtcgg
    70381 ccacagggga ggtggctgaa ttagggcctt ttccctcatt cccccatgag acccacgtgg
    70441 caggcctagg ggctacattc gcctcccacg tttcccttcg cgtgaggcat ccgatatgac
    70501 tgaattttcg cagtctcttt tccctcttcc cttgttattc ccatagaatt acagtgaggt
    70561 tacacaggtg gagattcagt ttaaccattt attgatttaa tccaggaaca aaaaacagtc
    70621 ctagtgaccc agtgcccgga gagagaatgg ccctgacaag tcggctgcat gatgcacttc
    70681 ggcagtcacg tgtgtgagtc tccacggcct ctgtcaaaag ggagcttagc gtgccagggt
    70741 tgtaattctt gatgtagtgg cccaggaatt caacttcatc gtgtctccgt ctgcagttgg
    70801 cgttaatgta ggctggggct actgccgcat atgctgccaa gagacagagg ggctgcttca
    70861 catatgagct gctcagggtc tccaccacct tgttttgacg ggccgtggca caggtgatgt
    70921 agaagagttg cttcacaaag ttgtagtctc gcgtgttagg aaggaagcag ggtgccagct
    70981 ctttgagctt ggtcaggatc accttgctaa gactcatggc gcaggccagg aggatgtctt
    71041 ccgcgggagc taggggcagg tcgccgtggt aggtgatctc ctggagccaa aagatggtct
    71101 cttctagcat ggccaccagg gtgcagagcc ccgcgttctg gatcgcctgc atgcgtgcat
    71161 ccagccatgt gtccttgttg gttgacttgg tgaaaaactc acgtagtgtc ttgtagctcc
    71221 tgcgcagctc gtgtctgggt tgcactttct gccaggctcc aatctctgga tgggcggcca
    71281 ccgccagcat cgactgtagg aacgggtctt ggatgggctc tagggtcaga gaggccaggg
    71341 ggctgggcaa ggtgacaaat gtaatcttgg agacaggctt aaccagactc atgtcaaacc
    71401 acggtttgtt gggcaggggc ctctggctgc gttcttgcct cgcctgcttc cttgtgctcc
    71461 tgccggcccc tcgagattct gaccggggac ctctggttgc tctgttgctt cggggagctc
    71521 ttggagacct cggtgctcta ggcaccctgg gggcccttgg ggctctgggc gctcttgctc
    71581 ccgggggcag gtgtcggcgc ttgccataac tttcatcggt gcagccatgg acctctccgc
    71641 gtcgcctttt gtggcctctg gtgtaagagg agttgccagt ctcctccttc tcgtcctcgt
    71701 ccctgcacag gggtgagcga tgcaatgtga ctgtcttgtc ctgtaggtcc cacttctttc
    71761 tgggaatcac aaacgatgcc gaggtagggg ttatgaccac gctggagggc cgtgcaggta
    71821 tggtgtgggc cggagttgga tcttcatcct cctcctctga ggatgaaatc tctccatctg
    71881 tggagtgttc ttcgctgccc tccatagggt ccatatcgca gtctgtgttg gtgtctgaga
    71941 ccgcttcgag ttccagaatg tggctctctg cagaggggag acaaaaggtg gagactgcct
    72001 tgagcacctc tgtctcaggc accggatgcc cccggctcca cggccccggc cactggccgg
    72061 tgtagcttct tacctgcggg atcctcgttg gaggaaatgc tgctagttcg ggagagtctc
    72121 tgagaaggaa ccatcttgtc tgtctctacg acgggctagc tgggatgtag tgctgtcttg
    72181 actggcctca gccctattta tgattctgga ggcgggcacg ctgatggaga aatgggcggt
    72241 cggttgattg gccccacagc gaccggcgaa gcactgactc atgaaggtga ccgtgatggc
    72301 ctgtgatgtg tagtagagta ccagaaacac cctcacattc ttggagctgg ccctgtgggt
    72361 atgcctcagg cacgcaaagt tcctgccccg ggcatggcac acctgaacta agtttggccc
    72421 ggtttgctca aacgtgacat ggagaaactg ggggaatttg tcttctggca cagctgttgc
    72481 cagggtgctc atgagcgagg gccagatgca ggagctgacc caggcgacga gatccaggcc
    72541 cagatgtccc tctatcatgg cgcagacatt ctccacggtg gggggcaggg tctcgcgggt
    72601 cctctggatt agatagtcac gcccatcatc cgcgatgtgg tagcagaagg ttttgggggc
    72661 cggccagccc acgtgcagtg agtgatgtaa gaggttttga atgttgaggg cattcttaac
    72721 atagctgtgc ttgtcttcct cttccggatg acagacaaag aggcgcagct gccggctaag
    72781 accaccgccc ctgtccacct tgtaggtatg cggcagccgg atgcaccgcc cggcgtgata
    72841 cacgccgctg tcaaaaagcg gggccccaat ctctttgatc ttgtgacgca tgcggcgcag
    72901 gcaggccgtt aggcccatga gcttctgcag cacagacaca aacccttgta ctgcgcttgt
    72961 tcccacaata gcatggcctc taggtagggg ggtgatgacg cgaaagccca gttttcccgt
    73021 gcatatgcaa aaggggagca catcttccat attatccggg tcggcgggtg gacaagctga
    73081 tttgaaaaaa tagactgggt gggccctgga cactggaccc aggcggcgca tgaggcgcag
    73141 tacctcacgc cgcacggtcc ggcacaggtc atagatttcc tccagcgacc agggggcccc
    73201 cttgatcttt agatccaggt ccaggaccag gttgcagacc ggaagccggg gattaaagta
    73261 ttcatgccgg gagacaaaga gctgctcgct caggctgttc tgtgaatagt acactggggt
    73321 gtaggagagg gccctggtga gacacgtgtc tgggaggcgg cagttggtcg gggtggagac
    73381 gacctccgcc aggtgggacg agaaggggtc agcggctgtc attacaaagt agtgcctgtc
    73441 tgcaaaatgg cagaggaaga ccggtagccg ctgcaccctt cgaaggacgg tgggtgggag
    73501 gaattgttcc ttgggattcc actggccccg gcaggtggcc tggccggcca agcatagaaa
    73561 cccttgaagc gtgggggggt atgtgggacc ctcatccgcg tgccagcgcg cgagctccac
    73621 cagctcccgg gccacgtcca cactgagccc ggcccaagcc cgcatgagtc cgtcatcggg
    73681 gtcggggtcc cacgtgtatg gggccggggg ctccatgcgg attttcagct gctggacacg
    73741 cacatgctca gccaggtaag tctcccgggt gaagtaggtg cgcatgtgct ccgcaaagcc
    73801 cctgtccagg agcgagggga gcacgacgcc ccccgaaggc agacacccaa tttctcccac
    73861 gctcgttaac tgagagtatc gcttaaaggt tccctcgttg aagcactgtg cgtgggccaa
    73921 atagacgtag cgcacgagat cggccgaggc caggggaagg cgccccctgt aggcgtctat
    73981 cgtccttgcc acagcgcgga tctctcgtga gtcccgccgc agcttctcgt gtgcaaagtg
    74041 ggcaaaagcc tcggtctgct ccgcccatgc cgaggagcca aagacctccc ccagctcggc
    74101 cagggacgtg acggcggcca ggctctgacc agactcggaa gtaaatagct ccgtgaggtg
    74161 cgccagggtc tcaatcgtac aaggaatgcc ccaaaaatag taagcagccg tgactagcac
    74221 gaactgggcc tcgtgggagc caaaggtgct aatgaaccac ctggccgaga tgttaacgcg
    74281 gtagatgcgg cgcagacagc ccacgatctt gggacgcagc cacgccacgc ggcctctggc
    74341 atccccctgt ggctgcttct tagcgctcag tgtgagcagt tccacgaggg gcgtgagcga
    74401 gcgcagggcc cccgcgcgat ctaggtaggt ggatagacgg tccgcggtga gcggcgtgag
    74461 gccgcgcagg aaggggaagg cctcctccgc cggcaggtgc agcgtcagaa ccaggccgca
    74521 gcggctctgt gaggtcagcc gcttcttggg caggtgaagc tgcagttcca cgagagaacc
    74581 cgccacgtgg tggaggggcg aggcgttgtg gcacaaacaa aacaggcgga agccctcgtc
    74641 aggccgcgag aggatggcat cgaggatggc ctccgcaatg tcagtgtttg aggccacaag
    74701 ggccttgatg acgacggggg cggacattat ttaagaccgg gaggccccaa cggcgggcta
    74761 aacagaacga tggccttcta tctcccagac tggtcgtgct gcgggctctg gctctttggc
    74821 cggcccagga atagatacag ccagctccct gaggagccgg agacctttga gtgcccggac
    74881 cgctggcgag ccgagataga tctgggcctg ccccctggtg tgcaggtggg agatttgcta
    74941 agaaatgagc agacgatggg ctcactgaga caggtttatt tgctcgccgt tcaagccaat
    75001 agcatcacgg atcacctgaa gcgctttgac gccgtccgcg tccctgagag ctgtcgtggg
    75061 gtggtggagg cccaggtggc caagcttgag gccgtgcgct cagtcatctg gaataccatg
    75121 atctctctgg ctgtaagcgg catcgagatg gacgagaatg ggctcaaggc cctgctggac
    75181 aaacaggctg gcgacagcct ggccctgatg gagatggaga aggtggccac ggcgctcaag
    75241 atggacgaga ccggtgcctg ggcgcaagag atctcggccg ttgtctcatc ggtgaccgcc
    75301 ccctcagcct cggccccttt catcaactcc gcctttgagc ccgaggtgcc cacccccgtc
    75361 cttgcaccgc ctcccgtggt gcggcagccg gagcactctg ggcccacgga gctcgcgtta
    75421 acgtagcaac cagactccac accaaataaa cattttattg gtaaaacaag ggatatgaag
    75481 gtgtcattga cccgaggatc caaaccccct cccctgtctc ccctcgagcg cctcgctcag
    75541 cccactatca cccatggcca ggcccggcac ctcctcgaag gcgcagctgg cccacctaaa
    75601 gagagatctg gggccaagga cccccgcgtc actgtggggg ctgtagaagg aggtgaggtg
    75661 gtgcttgtga aggtaaacaa gctgacagaa gcgccggtac ttgttaagga acacggtctg
    75721 gtcactaaag ttggtcaggc tgacgtccac cccaccccgg cgccacctgc agggcttcac
    75781 tagaataccc tgcatggcca ggcccgacct gccaaagatt gtcggcctgt ggtgagggat
    75841 agaagggggg ggcacggtga gtgtcactga gacggtctga tgggggaaga gggccaggtc
    75901 ctttggcaaa gagacgtcca ggcccacgtc cccggggtac tgggggtggt tgatgggacc
    75961 cttgtcctcc tccatctggg gggtggcata tctgaaggca gccaggtgga ttttgagctc
    76021 cgatggacgc agcgtggagt tgtagcgccg ctgattctgg aggattagcc ggagttcccc
    76081 cgtgtagccg ggatcgatga tgccaacatg agacgtgacc ggacgggagg tgctgcccca
    76141 cagcatgagc ccatgaccct cgggtgggcg ggcatagagg cctaggtcca cagttgtggt
    76201 cttcatcggg cgcagcagga tggtggtctt gttgaccaag gtgagccgcc ctacactagc
    76261 ctgctggagc aacagcttgt cattctggaa ggcgtagcgt atgtgtggac aggcctccat
    76321 ggtgatgatc taacagacag ggacggcggc gctatatata agagcccaag acccggctct
    76381 ctttactgcg aaatggggaa ggtcctaaga aagccgtttg caaaggctgt gccactgctc
    76441 ttcctcgccg ccacctggct tctgaccggg gtgctgccgg ccggcgcttc cagtcccaca
    76501 aacgcggcgg cggcttccct gactgaagcc caggaccagt tctactccta cacatgtaat
    76561 gcggacacat tctcgccttc tttgaccagc tttgcctcca tctgggcact tctgacgctt
    76621 gtcttagtca ttatagcctc agccatctac ctgatgtacg tctgctttaa caagtttgtg
    76681 aacacgctgc tgacggatta gatggggata tttaaaaggg gcagcaatct cggctgtctg
    76741 tacttcttct ctgctcgtta aaccaatagc atgtcagctc cacgcaaagt cagattgcct
    76801 tctgttaagg ctgttgacat gagcatggaa gacatggccg cccgcctggc tcgcctggag
    76861 tctgagaata aggctctgaa gcaacaggtc ctcagggggg gtgcctgtgc ctcgtctacc
    76921 tctgttcctt ctgctccagt gcctccgcct gagccgctta cagctcgaca gcgagaggta
    76981 atgattacgc aggccacggg ccgtttggcg tctcaggcta tgaagaagat tgaagacaag
    77041 gtgcggaaat cagttgacgg tgtaactacc cgcaatgaaa tggaaaatat attgcaaaat
    77101 ctgaccctcc gcattcaagt atctatgttg ggtgcaaaag gccaacccag ccctggtgag
    77161 ggaacacgac cacgagaatc aaacgaccct aacgccaccc gacgtgcccg ctcccgctcc
    77221 cggggacgtg aagcaaagaa agtgcaaatt tctgattaat aaatctttat tgactttata
    77281 cataggtctc ggcgtcatca tatggtgggg tggtgtaggt atgggatgtc gacaagttac
    77341 gcctgaaggc gcagtccgcc atgaccagca gcagcagaag ggtcagcaca gccagagagg
    77401 cccactgcag tactagcatg gagaggtttg agaatctggg ctgggacgtt ggcgggacag
    77461 gcacggtggc ttgggctgtg gtaaccggtg ggctcgtaaa agtccagcgg ggccgcagtt
    77521 tgctagaagt gctgggaggt agataggtgg tcgcattgta tctcgttctt ggcgtagttg
    77581 aatcaccgcc gtaatctgtg gtgggctctg tacttgtccg ggctccatgt cctgtggtgt
    77641 gctttccacc ggtggtagaa ttggcctttc cacctgttga ggtgaccgtg ggaaccgccg
    77701 tcttttggcc actgggggcc tggggcgacg ttgcattttt ggggggcgtg cctttggtga
    77761 cattaacctc ccccggtttt gtggatgtgg aactgtttcc agggcctgac gcttggctgg
    77821 tggtgcctgg gcggggcgct ggcgaactgg tggacacatg atgtgtgctg gtagaggctg
    77881 gtgtcacctg tgttatattt tcaccacctg ttgggtgagc ggaggttagt aaaggcatat
    77941 gtgacgttga attgtcactg gtggaggggc tgagtgtctc tgagattgaa ctgggtctca
    78001 gtgacatgga agaggttgaa cttgaagtta tgttatgttg gcctgtggta acagcactgg
    78061 ttgcattttt tggtgggctg gtaactactg gggtggaact tgttcctcct aatgtgtggt
    78121 tggtggtatt tgcctgtgga cttgtttctc ccacggtagg gctggtggca tttggggttg
    78181 gggtagtcac tgctgaggtg ggacttgttt ttcccaaggt ggggatggtg gcatttgggg
    78241 ttggggtagt cactgctggg gtggggctgg tggcatttgg ggttggggta gtcactgctg
    78301 aggtgggact tgtttttccc aaggtggggc tggtggcatt tggggttggg gtagtcactg
    78361 ctggggtggg gctggtggca tttggggttg gggtagtcac tgctgaggtg gggctggtca
    78421 tgtcgggggc cttactttct gtgccgttgt cccgtggaga tggacttggt gtcaccggtg
    78481 atgcgcctga cgttgtgccg gctggtgttg ggctggtgac atccgcggtg gatacagtgg
    78541 ggcctgtgct tgcaggtgcg gtgaggttgg taggcacgtg agtagagctg ggtagacctg
    78601 tcgttgtatt gggagcagca aatccagttg tattcaaggt aggggaggtg gtggtgctct
    78661 cgggtgcctt ggagaatata accttgtggg ttgttgtggt ggcattggta gccgttcgtg
    78721 tgataatgag tgtcttgggg gccgtgccaa gacccgagac agtaatgtca aatgtccgat
    78781 tgctcgcaaa tgcaccagaa atattttcac aacccgaagg tgtccccgag gtgagagtcc
    78841 atttgcactt aaagtcagtt tcagtgttgt ttggccaggc ccaaaaggca gtcactgtaa
    78901 catttggcga gtttgcgtcc tcagaagtga ccattggcac tgaataggta gcattgtcac
    78961 ccacatatgt gatgtctgtg gtgtttgtcg gcatgtcctg tgaagctgga atctcatcag
    79021 agaacacaat gttggactga atgcagtaat ctcccccgct cgccttcggt ccattcccag
    79081 agtaaaacac gtacagtata ctgttattgc caagaaatcg tgacactgga cgtggtgtca
    79141 gacgcaggct gtatgcatac cctgtaccag gtattggggt ggccacggga ctcgttgatg
    79201 tgagaattcc gccgctggga acatggctct cgtatccact gcaggtgatg ttaaatttgt
    79261 tgtctccggg cagaacttgt gaaatttcgc catcctccat aatacactca atatctatct
    79321 cattaccgag catttctgtt tttacgctga aattcgagtc ttgagctgat gttggcaaac
    79381 ttaagggtag cgtgacatcc agcccctgtg cccttactac tgccgttata ttggtagaat
    79441 tacagttatc ccactttatg tatggcactg tttctggtat taggtatact gggttttgca
    79501 tttctgcatg gtggcaccac atggtgccaa acacatcttg aaagtagaca tctacagatt
    79561 ccaggcttac ttgttgctcc tctccggtgg tgatgttaat tggaagcttc ttagaccgca
    79621 tagttagagc caattctcct gcaccaagga gctccagtag aaagagattg gtggcatttt
    79681 ctgagccacc aaatgcacct cgaggttggt agacagcctt tgtatggggt gtcagcaggc
    79741 caaagtcaag attaagttta tgctttttgc ccccgacatc gaaattgata gttgcattga
    79801 catctgccgt gcaaacattg cacgctgggt aaaatgggaa ttccagaatc tcaacattga
    79861 aaaaaccagg atcatcacgc gtgagttgga taaggctctg gatggtgtac tgacacacaa
    79921 gcaaggctgc ctccattgtc tcagcaccga tttctaggca gcaccctctt taataggtgc
    79981 aaggggggtg cggtgttggt gagtcacact ttcgttgcag acaaaatgga caaggacagg
    80041 ccgggtctcc cggccccgga tgacaacata gaagaagtac catctacctc gggtgttcag
    80101 gaacgggcgt ctgagggaga ttgggaaaat gtcctcatag agatatcaga tagcagctca
    80161 gaagaggaag cagaagatgc ccacctggag ccatcccaga ggggtaaaaa gagaaaacgg
    80221 gtcgatgatg atgccggtgg ttcagctcca gcacaacacg tgcccccccc tcagctggat
    80281 caccctggtc gagaagccat tctctacagg tttccgctag atttaagaag gtttattcaa
    80341 gcaattggag ccgcagctac ggtgagcttc cctatggccc aggtgtgtga tgtgtgtttt
    80401 tgcccatcgc acaacaaggt aagtgatttg ttgccgttgg tttcagcacc ccgacacgcg
    80461 agccatagac cagtttttcg gatcccagat ttcaaatacc gacctgtacg taatgtatgc
    80521 catggccatt cgacaggcca ttagagatcg tcggaggaat ccagcttctc gtagaagtca
    80581 ggtcaaatgg agaatgacca ccctggccgc tggttggcct atgggttacc aggcatacag
    80641 tagctggatg tacagctaca ccgatcccca ggtgactgcc acgatcatac atctgcaggc
    80701 gactcttggg tgcgcaagtg gccgtaggtg tcatgtgacc ttttctgccg gcacctttag
    80761 gccgccgcga tgtagtcccg gggatcgcca gtggttgtat gttcagagcc gcgtgggtga
    80821 ccttgtgcag agttctaatc catgctacag tattttcttt gactacatgg ccatacatag
    80881 gagcctcacg aaaatctggg atgaagtggt aacacctgat cagcgtgtta catttatgga
    80941 attcctgggc tttttgcaac gcacggagtt ggtctacatc aagagctttg tcagctatgc
    81001 cttgggcacc actagtatcg aaacaccgtg gatggatgag aatcctagca cagagacggc
    81061 acaggcttgg aatgccggct tgctccgggg gcgtgcgtac gggcaagact tgcttagaac
    81121 tgaaggagaa catggcgaag gtgctacctg tgaaacacgg gaagaaagtg aggacacaga
    81181 gagcgatggg gatgatgaag aacttcctcg tgtagtgtcc agggatggaa ctaagcacag
    81241 acgaccccct atatttttaa gacgcctgca caggttgctg ttgatgagag cgggcaaagg
    81301 aaaggaacgg gccagggaga cactggcgaa ggcccctagg cgcacttatg gcacacctag
    81361 gccgccagtt cagaaaccaa gaccagaggt cccgcaaagc tatgagacag ctaccagtca
    81421 cgggtcggcg caagtcccag aacccccacc cacccaccca ttacatcagc aacacagcat
    81481 ggccccgtgt atggtagctc agaacccacg tgcaccctta ggggaccaac tcccaggtgt
    81541 tcctaaagat ggacgagggg cgtgtgcacc ggtacccgcc ctggccgggc ctattgtccg
    81601 gccctgggag tcatccctgt tacagtctcc gggaagggcc tttgcacccg ttagcccaca
    81661 acccatgcca gtagaacccg tccctgtccc tactgtggca cttgagcgac cagtttgtcc
    81721 cgcacctcct gagattgcta tgcagggccc gggggaacct tctggcatta aacgcacacg
    81781 ggagcgttgg aggcccgcac cgtggacgcc aaacccaccc cgctctccca gtcagatgtc
    81841 cgtgcgtgac cgtctggctc gtttgcgtgc tgaggcacag gcccgtcagg ctagtgttga
    81901 ggtgcagccc acccagttga cccaagtatc ccctcagcaa ccaatggaga ggccgttgga
    81961 accagagcag cagatgttcc ctggttcccc ctttagccag gtcgctgatg ttgcccggga
    82021 atctggggta cctgcaatgc agcctcagta ctttgacctc cccttaactc aacccattag
    82081 ccagggggca cccgcggccc cgttgagggc tagtatgggc ccggtacctc cggtaccggc
    82141 aacacagcca cagtattttg acatcccctt aactgaaccc attaaccagg gggcatccgc
    82201 ggcccatttt ctccctcagc aaccaatgga ggggccgttg gtacccgagc ggtggatgtt
    82261 ccaaggtgcc accctgagcc agagtgttag gccaggggta gcgcagtcac aatattttga
    82321 cctcccctta actcaaccca ttaaccatgg ggcacccgca gcccatttcc tccatcagcc
    82381 accaatggag gggccgtggg tacccgagca gtggatgttc caaggtgccc cccctagcca
    82441 aggcactgac gtggtccaac atcagctgga tgatttgggg tatccactcc atgatctcaa
    82501 ccatcccggg gttcccgtgt ctcctgccgt taaccaatat catttcagcc aggctgcctt
    82561 tgggttacct attgatgagg atgagagtgg cgagaggtcc gatacctccg agccgtatga
    82621 agctcttgat ttgtcaatcc atggcaggcc ctgccctcag gcccccgaat ggcctgttca
    82681 aggggagggt ggccaggatg ccaccgaggt tcttgatttg tcaatccatg gcaggccccg
    82741 ccctcggacc cccgagtggc ctgttcaagg ggagagtggc cagaatgtca cagaccatga
    82801 acctagaagg gtggtggtgt cagctattgt tcacatgtgt caggatgacg agtttccgga
    82861 tctacaagat cctccagatg aggcctaagc aaaggtgtag aagtgtgtcc ccctccattc
    82921 cacccactga tatacgcccg acaataaagt tgatgatatt gaattccaca cctactcgtg
    82981 tttgtgattt tatttcatat tccatgagag agacctcgca tatttgcaga gggtcactga
    83041 aacattttat cttaaaacag ttacacctga aaaatgaaga aagcgtggct cagcagagca
    83101 cagcaagccg atgccggggg ggcatctggc tccgaggacc caccagatta tggagatcaa
    83161 ggtaatgtgc aacaggtggg atctgatcct atttcacctg cgattggccc ctttgaactc
    83221 tctgcggcca gtgaggatga tcctcaatct gggccagtgg aagagaattt agatgccgct
    83281 gcaagagagg aagaggaacc tgatgagcag gagcacaatg gtggtgatga tcccttggaa
    83341 gtccatactc ggcagcctag atttgtggat gtgaacccaa cgcaggctcc agtgatccaa
    83401 ctagtccatg ctgtttatga ttccatgttg gtaagaggca cctagaacat ttccagatgt
    83461 ttagcttgga tattttggcc agtcttaatt tattgtcatt ggtttcagca atcggacctc
    83521 cggtctctag gcagtttatt ccttgagcaa aacctgaaca tcgaagagtt tatatggatg
    83581 tgcatgacag tgcgtcacag atgtcaggcc atcagacaaa aaccattacc gattgataag
    83641 cagaggcggt ggaagctcct gtcaccttac agaacctggc gtatgggtta ccgtacgcaa
    83701 accctcaatg taaacagttt tgagacaggg ggagataaag tccacccact ccttgtgact
    83761 gctacgctag gatgtgaaga gggcctgcgg catgcaataa cttacagtgc tggcattgta
    83821 cagctaccac gaatgtcaga ccaaaaccaa aagatagaaa cagccttctt gatggcacgt
    83881 cgtgctaggt cactttcggc agaaagatat actttgttct ttgatttagt atcctctgga
    83941 aacaccctgt atgccatatg gattgggctg ggcacgagaa accgagttgc atttgtcgag
    84001 tttgtaggat ggctatgtaa gaaggaccac actcatatac gtgaatggtt ccgccagtgc
    84061 accgggagac cctcaccatc caagccatgg atgagagcgc atcccgtcgc cgttccttat
    84121 gacgatccat taacaagtga ggagactgac ctggcctatg cccgtggact ggccatgagt
    84181 atcgaggctg ctagactgcc agatgatcca ataattgttg aggatgacga tgaaagtgag
    84241 gaaattgaag ataaatgtga taaggatgaa gaggaaagtg gaacggaaga tgttacaagc
    84301 ataccgcaaa cactgccgca cagtccaaca gtatacggca ggccctcggt gttttaccga
    84361 aagccagata ctaaatcaac caaaaaatgc agggccatag tgactgacct tagtataatc
    84421 aaggtcattg aagatgaaca cagaaagaag aagacagcca gaacagagca accaagagcc
    84481 aagcctgatt cccctgcccc cacagtggtc cttcggcgac cacccacgca aaaggtgact
    84541 ggccctgccg gttcactgag tgtccaggct cagctggagc catggcaacc tttgtcctgg
    84601 ccacatgaga caagagttat acttcacgga ccacccacgc agggtgacca agcacacggt
    84661 tccatgctag accttcttga aaaggacgac cagcacatgg agcagcaggt tatggcaacc
    84721 ctactgccac cagaaccaca ccagccccgg tctgggagaa gagccccttg tgtctacacc
    84781 gctgacctag acatagaaag tgatgagccc gccacgtcag agccggttct tgatcagcta
    84841 ctgcccgccc caggacttgg acctcttgca attcaaccat taacgtcccc caccacgtct
    84901 caactccgca gttcagcacc gagccacgca caaactccat ggccggttac ccacccaagt
    84961 cagactccag gtggcccaac gacacagtcc ctggcaccgg aaacagaagc cccgcgccag
    85021 tggccaatgc cactgcgacc tatccctctg caccccttgc ggatgcagcc aatatcattt
    85081 aatcctgcag tgagacccac tccccatcag ccacctcagg tggagcccac tttctatcag
    85141 tccacttggg tgaaaccccc tcaacaatac cagcctcaga tggggcacat tccatatcag
    85201 ccccgaccaa cgggtcactc tactatgctc cggccccagt gggcacccac caccatgcag
    85261 ccaccaccaa gggcgcccac tcccatgccg ccacctcagg ggccacccac cgctatgcag
    85321 aggcctcagg gggcgcccac tcccatgccg ccacctcagg ggacacccac cgccatgcag
    85381 aggcctcagg gtgcgcccac tcccatgccg ccacctcagg ggacacccac cgccatgcag
    85441 aggcctcagg gtgcgcccac tcccatgccg ccacctcagg ggacacccac cgccatacag
    85501 aggcctcagg gtgcgcccac tcccatgccg ccacctcagg ggacacccac cgccatgcag
    85561 aggcctcagg gggcgcccac tcccatgccg ccacctcagg ggacacccac cgccatgcag
    85621 aggcctcagg gggcgcccac tcccatgccg ccacctcagg ggccacccac cgccatgcag
    85681 aggcctcggg gggcgcccac tcccatgccg ccacctcagg ggccacccac cgccatgcag
    85741 aggcctcagg gggcgcccac tcccatgccg ccacctcagg ggccacccac cgccatgcag
    85801 aggcctcggg gggcgcccac tcccatgccg ccacctcagg ggccacccac cgccatgcag
    85861 aggcctcagg gggcgcccac tcccatgccg ccacctcagg ggccacccac cgccatgcag
    85921 aggcctcggg gggcgcccac tcccatgccg ccacctcagg ggccacccac cgccatgcag
    85981 ctgtcaccaa gggcacttac cggccagaag gggccagcaa agcacattct gcgccagttg
    86041 ttaacggggg gcgtcaagag tgggagacca tcacttaagt ttaaggctgc ccttgagcgt
    86101 caagccgctg cgggcttgcg accttcacca gggtctggaa cgggtgccaa gattgtgcag
    86161 gcacctgttt tctatccacc cgtcctacag cccatacaag ttatgtggca agtgggttcc
    86221 tcaaaggccg tggccgcctc aacggtgaca caggcaccca cggaatatac cggggaaagg
    86281 aggttagggg ggcctatgtc tcccactgat attccgccgt ctaaacgggt gaagaaaaag
    86341 gcctatccag agcgcaagac gccgcatggg gggccctcac actcttccac cgttatgtgg
    86401 gagaatgtca gccagggaca acagcagact ctggagtgcg gaggaactga taaacaggaa
    86461 aggaacatgt tggggatggg ggacattgca gtttcttccc cttcctcttc tgaaacatcg
    86521 aatgatgagt gatttcaacc acgtaacaag aactgggatg aaccctcggg cagtatcaga
    86581 ctgcggggag gggcagtgat aagtcatgac aattttagat gaggtagaca ttttgcatat
    86641 tttcagaccc accatggaat catttgaagg agagggggac tctatacagt cacctgacaa
    86701 tgcgcgggga gatgatgtac agaatactgg tgagcatatt caggaccccg ggccggggcc
    86761 ttcaaccggc ggggcttctg agggattggt gcagaacgag ccggactcaa gagatcaaca
    86821 gtcccggggg cagagaaggg gtgatgaaaa cagaggctgg atgcagcgca tcaggcgaag
    86881 gcggagaaga cgggccgcat tgtccggcca tcttttagac atggaagaca atgtgccgcc
    86941 gtggtttcct ccacacgata tcacaccata tgtcgcaagg aatatcaggg acgctgcctg
    87001 ccaggctgtc aaggtgagca tgcctctaac tgggttcatg ggggccatct aaggcccacg
    87061 tgtgacccat gtttccatta attttagcac tcgcacctgc aagcgctatc aaacctgata
    87121 ctcgatagtg gtttagacac acaacacctc ttgtgcttcg tgatggcagc caggcagcgt
    87181 cttcaggaca ttcgacgtgg acccttggtt gtagagggag gtgttggttg gcgacattgg
    87241 cttctgacat ctcccagccg atcctggtcc atgggatatc gcacagcaac actacgcaca
    87301 ttaactcccg tgcctaacag ggttggggct gacagcatca tgttaactgc cacgtttgga
    87361 tgccaaaatg gggcactagc tataaacacc ttctccgcca ccgtgtggat accaccccct
    87421 gctggaccaa gagagcaaga aagatacgct cgggaagccg aggtgcgctt ccttcgtggt
    87481 aaatggcaga ggcggttccg aagaatcttt gatttgatag aactgtgtgg ctctctgcac
    87541 cacgtctggc aaaacatgct gcagaccgag gagaaccttt tagatttcgt gcgtttcatg
    87601 ggtgtcatgt ccagctgcaa tagttcatct gtgaattact ggtttcacaa gacaatcgga
    87661 aactttaagc catattaccc gtggaatgca ccacctaatg aaaatccata tcacgcacgg
    87721 agaggcataa aagaacaagt aatccagaaa gcatttctaa aggcacaaag acagggttta
    87781 tcaatgttag caacgggagg tggacccaga ggtgatgcta ctagtgaaac gagcagcgat
    87841 gaggataccg gtagacaggg ttcggatgtg gagctagagt catcggacga tgagctgcca
    87901 tatatcgatc ccaacatgga gccagttcag cagaggcccg tcatgtttgt gagccgtgtg
    87961 cctgtaagga aaccgaggac actgccgtgg cctacaccca agacgcaccc agtgaagcgc
    88021 acaattgtta agacctccta tagatctgat gaggcagaag aagcacagag cacccctgaa
    88081 aggccgggcc cttccaaaca accatcagag cccgtggagc ccgcccacac aaccccagcg
    88141 gggaggtcaa cggtgattct ccacgaacca cctcgagagc ccgaagctgt ttccttcaag
    88201 cctccgccac caccttcccg gaggagaagg ggagcgtgtg ttgtatatga cgatgatatc
    88261 atagaggtga ttgatgttga aaccaccgaa gaggagacga cgtcaatgca aagacagcct
    88321 ccgctcgggc aacaaccgcc cccccccgtg atttctaccg ggagtgccat gtcttccagt
    88381 cacacggatc catcagtaac acagccaagt aagccacatc ggaaacctca agacggattt
    88441 caacgttcag gccgacgtca aaaacgagcc atgcctcccc cagtgagtcc ttctgacgct
    88501 gggcctcctt ccaccaggcc tcgtgtcatg gcgcctcctt ccaccgggcc tcgtgtcatg
    88561 gcgactcctt ccaccgggcc tcgtgacatg gcgcctcctt ccaccgggcc tcgtgacatg
    88621 gcgcctcctt ccaccgggcc tcgtgacatg gcgcctcctt ccaccgggcc tcgtgacatg
    88681 gcgcctaccg tcgtacatat gtttacgagg gagcgcctgc tcacccagtc caccggccct
    88741 gcacctcgga gcttctggga aatgcgggcc ggccgtgatg ctcccaaaat tcaacaagaa
    88801 ccaagttcac aacagcagcc agccactcag tctacaccgc cttgccaatc atgggtccca
    88861 tctgtctatg tcctcccggc agtggatgct ggtaatgccc agcccctaca aatatcacac
    88921 ttgagctcca tgtcgcccac gcagccgata tcgcatgaag aacaaccccg gtatgaggat
    88981 cctgacactc ctctggattt gagtttacat ccagatactg caactctgcc gcccacccag
    89041 gatttatacc ctggacgcga ggatctgcag gccacccagg ctccataccc gggatacgag
    89101 gagccacggc ccccccaggc tccttttgta ggtgactatg gttttgttca aattccctcg
    89161 gctcaatggg agccacaccc ctctcagggc acataccagg gccacattga tccccagctt
    89221 ccggctgctc tagatttagg gccagagcag ccccggttcc cacaagatcc atatgtgtat
    89281 tccgggggcc aattgtcttc atgtccaggt tatgcaggtc cctggccctc gaggcctcaa
    89341 catccaagat ataggcacac cttggcattg tggcctcgag aacccaggca tgggcactct
    89401 cagggcccat ggaaaccctg gtcagcacat ctcccacctc agtgggatgg atctgcagga
    89461 catggccagg atcaggtctc ccagttccca catctgcatt cggagacagg cccaccacgt
    89521 cttcaacttt catcggtgcc acaggtgctg tacccgcagc cactggtctc atcctctgca
    89581 ccatcgtggt catctcccca gccccgagcc cccatacgcc ccattccaac aagattcccc
    89641 cctcccccta tgccgttaca agatagcatg gccgtggggt gcgactcatc aggtacagca
    89701 tgcccaagca tgccctttgc cagtgattac agtcaaggtg catttacccc actggacatt
    89761 aatgccccca cgccaaaaag tcctcgagta gaagaaagtt ctcacggacc cgcccggtgt
    89821 tcccaagcta cttctgaagc acaggagatt cttagtgaca attctgagat ctccgtgttc
    89881 ccaaaagatg caaagcagac tgactatgat gcatccactg aaagtgagct agattaaggg
    89941 gatccaaggt gacccctgtt agctatttga tctttgactg acacataaac atggtttaag
    90001 gaatgaacac tcatggtgtg agactggaac tgtactaaat ttgctgacat atgtacaatg
    90061 agagccaaaa atttgataaa ccttaaaagt ccccccatct aatgatgtcc agttcccttc
    90121 tcccaccctg tacaccccga cccaaaggga ctcaatggca ttcagatttc tagttaccac
    90181 aggtagaata tcgggcgttg gcccataaaa ataagtgcat ggatatagct ctgcacaggc
    90241 ttggaaacac ccattccagg tgtgcttctt tttggtgaaa taaaaacagc gttctttata
    90301 tgaaaatgtg tattctcttg tgttgcagta tgtacagtta gctttggtat agtttttggg
    90361 tacctgaaac gtgtgcaggg tgggtgtcca atgtggcagt tttatctctt tgtccccata
    90421 ctcctgctcg gccgtcttgt taaagttaac cggcggtgga ggatccaccg gccagacctc
    90481 tacatttggt ttgggtaccc aggtgatggc cgctgccgac acccgccctc ctcctcttac
    90541 cctgggtggc aaaaagtatg ccaggagtag aacaataaca agtgcgatgg cggtaaacaa
    90601 tggcaccctc acctgcttaa acgaaaccat ggcaaccact tcaaagagag ccaacaggaa
    90661 gatatttatt aatattccat tagtaaacga ggcgtgaagc aggcgtggtt tcaataacgg
    90721 gagttagaaa tttaagagat cctcgtgtaa aacatctggt gtccggggga taatggagtc
    90781 aacatccagg cttgggcaca tctgcttcaa caggaggcgc agcctgtcat tttcagatga
    90841 tttggcagaa gccacctgcg gacaaaaatc aggcgtttag atggggcatt ttatgtttgg
    90901 gccattagcc acctgggcat tcgtgttact gtatactgac ctcacggtag tgctgcagca
    90961 gatgcttaaa cttggcccgg cattttctgg aagccacccg attcttgtat cgctttatat
    91021 ctagttcaga atcacattcc tccagctgcg agcaagggaa tgcgttacta caagtggtgc
    91081 ctagtcagtt gaaacaggcc ccaccgtccg ctgccgccct ccttgagccc caccatccgc
    91141 tgccaccctc tttgagcccc accgtccgct gccaccctct ttgagcccct tcttaccgat
    91201 tctggctgta gtggtttcct tgtacgtcgt gccggggcag ccgctggtgc aggctgtgga
    91261 gcaccaatgt ctgctagctg ttgtccttgg ttagccccgg gacaagcaaa caccactgct
    91321 gctgctggtt gaacagtaga attgtctcca ggttgaggtg cttctccccc ggcttggtta
    91381 gtctgttgat tctgggttat gtctgagact gggaatagct gaggtgctgc ataagcttga
    91441 taagcattct caggagcagg ctgaggggca ggaaaccacg acccagttgg agcggctgaa
    91501 acatgatagg cagtgagctg gccttgtggc agaggctctg gcagcaccgg ccacagcaca
    91561 caaggcaaag gagcttgtga tggccctccc aggtcctgat agactctggt agcttggtca
    91621 aaagcttgta caaaaggcac ctggtatggg tcaggtgtaa attttacatc ttcagaagtc
    91681 gagtttgggt ccatcatctt cagcaaagat agcaaaggtg gccggcaagg tgcaatgttt
    91741 agtgagttac ctgtctaaca tctccccttt aaagccaagg caccagcctc ctctgtgatg
    91801 tcatggtttg ggacgtgcta aatttaggtg tgtctctgag gcacattagc aatgcctgtg
    91861 gctcatgcat agtttccaaa agaggaggag gcagttttca gaagtgtcta aaataagctg
    91921 gtgtcaaaaa tagacagccc agttgaaata tgcatggcat gcagcagaca ttcatcattt
    91981 agaaatgtat ccaagatttc attaagttcg ggggtcaggg gggagtccag attcaaatcc
    92041 tctgtcatgg actctagtgt tgtggtcagt tcgtccaaat ggccacgagg gggcgggtgg
    92101 ttcaggtcca tctgtccaca tatggctgct tcctccttct ggggaataac agtgtcagcc
    92161 atctccctta gggccttcac ggcctgactg gtttcctcat cagggtcctc caacagatga
    92221 cttgcctcgg gggttactgc gggggccggg tcaagtggcc ggggcactgg ggctggcgtt
    92281 agggatccga ccggttcatg gacaggtcct gtgggggtgg gagccaaaga ggcaggcagg
    92341 ggccggttgg cccacgggga tccgggtgga tggaagggcc tgatcctctt tggctgacac
    92401 acctctcgcc cctcgaacac gtcagatatg gcactgcccg cttccggctt tggcaggaac
    92461 ataccttccc ggctatccct gaggcccttc ttccttttaa cgggaggaag aaaggtgggc
    92521 tttgaggggt gggggaatat gggtctctca tcgctctctt ggtggaccgc tgctatccaa
    92581 ggctgttcag gttcctccgc gttggaagga catggagttt gaccacggtt gggcctggat
    92641 gtccggcgcg actttggggc ccgcaggcgc ggggcctcgg ccctggcctc ttcccgctcg
    92701 ctctgctcgg tgtcactgtt gcccgagtca ctgctgctgg aactgctgtc accgcagtcg
    92761 gcgctttggg caccgggctt caggggcatg gtcgggctcg ggagactttc gagttcatct
    92821 gtaaaagcat gaaactgtcc ggactccgag tagcgggcct cggtgtgaga ggcaccccca
    92881 tcattcccca tgagctcctc gtccatcctg tcggctccgg acacgaggat aggagtttcc
    92941 actgccttgg acttggttga cagcaggcac gcgggaagca cgccgctcac gtagctcctc
    93001 tgtccggcgt ggctggagta ggaggcccgg ggcagtgtct taatcagagc cctgacatcc
    93061 ttaacatcgt ccgtcagatg gcctgtcttg gacgagacca tagtctggaa catctcctcg
    93121 aggacgggat aggtgaacac ccacttgcaa aaggccttga acttggagct taggaggcct
    93181 tccttctcca tcctgttcag gtgttccact acctgcttgc cggaggccat gatggccgcg
    93241 cggtccacgc ccagcacctt gctgtaggtg taggcccgca cccgactgtg ttttaggagc
    93301 ttgtacatag cggtgcctat ggtggcagga atcatcaccc ggttgctggg ggcctggatg
    93361 aagaatctgt cagtgaccac tatcaggtgg tctaacacgt agcgcatcac tatagggcac
    93421 gcgatggaac atgcgtcgtt gccggcattc tcagcccgtc ttcttaccct gttgtttcgg
    93481 agaatggccc aaaaattgca gatgttgagc gtggccatta gcccgcccca ttctcgcccg
    93541 tgggccttgg cctcatttat aaatgccttg catattttgt aggatctcag agtaatctcc
    93601 acactcccgg ctgtaaattc cttgttgagg acgttgcagt agtcagagac cagagagccc
    93661 agctgctttt tgatttcagg agttagcctc agaaagtctt ccaagccatc ctttttaggc
    93721 ctcatggcta gtagtaacag aggaaatgcc cgaccattaa aatctttcct ccatgagctt
    93781 tacctgaaac actatcccga agtgggggat gtggtgcatc tactgaacac catcggggtc
    93841 gactgcgacc tcccacctag ccacccactc ctgacagccc agagggggct gttcctggca
    93901 agagtcttgc aggctgtaca gcagcacaag ctgctggaag acaccatcgt ccccaagatc
    93961 ttaaagaagc tggcttattt cttagagctg ctaagctact actcccccaa ggatgaacag
    94021 cgtgacatcg ccgaggttct tgaccacctc aagacgaatc gggacctggg gctggacgac
    94081 agactctggg ccctgattag gaaactgcgc caagacagac accatgcctc tgtaaatgtc
    94141 ctcatgccag gaagcgacta cacagccgtg tcgctgcagt actacgacgg catctccata
    94201 ggtatgagga aggtaatcgc ggatgtctgc cgcagtggct atgcctccat gccctccatg
    94261 acggccacgc acaacctctc ccaccagctc ttgatggcgt ccgggcccag tgaggaaccg
    94321 tgcgcctggc gcgggttctt taaccaggtc ctcctctgga ctgtggccct ctgcaagttt
    94381 cgcagatgca tttactataa ctacattcag ggatctatag ccaccatctc ccagcttctg
    94441 cacctcgaga tcaaggccct ctgcagctgg ataatatccc aggatggcat gcgcctcttt
    94501 caacacagca ggcctctcct caccctctgg gagagcgtgg ccgcaaatca ggaggtcacg
    94561 gatgccatta ccctgcctga ctgcgctgaa tacatagacc tactaaagca cacaaaacat
    94621 gtcttagaaa actgttctgc catgcaatac aaataaattt ctcttacctg cgtctgtttg
    94681 tgtagtgagg tgttgtgtcc tgtatggtat tctactttaa aaatgccggc tgacatggat
    94741 tactggtctt ttatgagcca ttggcatggg cgggacaatc gcaatataaa accctgacca
    94801 tcacatgggg cattaggcga ctctgcatca gcatcgctta agtatgagtg ggcagcagag
    94861 aggctcggtt attttggttc ctgaacatct ggctggggca ttaactaagc ttatgagcga
    94921 ttttatcaca ggacaagatg tcactctttc tggaggaaat attgcagtca aaattcgcga
    94981 tgctataaac cagacccccg ggggtggtga tgtagctata ctttcttccc tgtttgcttt
    95041 atggaatgcc ctcccaacat ctggtagaca atcctccagg gacgatttaa tcccagccgc
    95101 cgtgcaggcc ttaaccacgg cccacaactt atgtctgggt gttattccag gtgagacctc
    95161 acacaaggac acacccgagt cattgctccg ggctatcgtg acgggtctcc aaaaattgtg
    95221 ggtggattcg tgcggatgtc cagagtgcct acaatgtctt aagggattga aggcaattaa
    95281 gcccggcctt tatgaaatcc ctaggataat accacacact aagcagtgta gtcctgtcaa
    95341 tctcctgaac atgttggtcc acaagcttgt ggctttacgt ggtcatgtgc agcttgcata
    95401 cgacgcccgt gtcctgacgc ctgactttca cgaaatccct gacctcgatg actccgatgc
    95461 tgttttcgca cgcaccttat tggcagcctt atttcacctc aatatgttct ttattctcaa
    95521 agattacata acacaagact ccatgagctt gaagcaggcc ctcagtggtc attggatgtc
    95581 tgccacgggc aaccccctgc ctgcagcacc ggaaaccctg cgagactact tggaagcttt
    95641 ccgaaattcg gataatcact tttatctccc gacgacaggg cctttaaaca ccttcaaatt
    95701 tcccgaagag cttctggggc gcgttgttgt gattgattcc tctttgtgtg ccgccagtca
    95761 cgttcaggac gttatcaccc gtggtgttgg ggcgggtgtt cctcgtcctc agtttttggc
    95821 cctgcctccg gccccatccc gtaagcccca gcagacatgc tctcagttaa cgagcagagg
    95881 aaatgaaagc tcacggcgaa acttgggcca gcccgggggg acctcccctg ctgttccccc
    95941 agtttgcccc atcgtttccc tgacggcctc aggggccaag caaaaccgcg ggggcatggg
    96001 gtccttgcac ttagccaagc ctgaggaaac ctcccccgcc gtctccccag tatgccccat
    96061 cgcttcccca gcggcctcca ggtccaagca gcactgcggg gtcactggat cctcacaggc
    96121 cgcacccagc tcttcttccg ttgccccagt agcatctctg tctggtgacc ttgaagagga
    96181 agaggagggg tcccgagaat ccccatccct accgtccagc aaaaaggggg ccgatgaatt
    96241 tgaggcctgg cttgaggctc aggatgcaaa ttttgaggat gttcagcgag agttttccgg
    96301 gctgcgagta attggtgatg aggacgagga tggttcggag gatggggaat tttcagacct
    96361 ggatctgtct gacagcgacc atgaagggga tgagggtggg ggggctgttg gagggggcag
    96421 gagtctgcac tccctgtatt cactgagcgt catctaataa agatgtctat tgatctcttt
    96481 tagtgtgaat catgtctgac gagggaccag gtacaggacc tggaaatggc ctaggacaga
    96541 aggaagacac atctggacca gacggctcca gcggcagtgg acctcaaaga agaggggggg
    96601 ataaccatgg acgaggacgg ggaagaggac gaggacgagg aggcggaaga ccaggagctc
    96661 cgggcggctc aggatcaggg ccaagacata gagatggtgt ccggagaccc caaaaacgtc
    96721 caagttgcat tggctgcaaa ggggcccacg gtggaacagg agcaggagga ggggcaggag
    96781 caggaggggc aggagcagga ggggcaggag caggaggggc aggagcagga ggggcaggag
    96841 caggaggggc aggagcagga ggggcaggag caggaggggc aggagcagga ggggcaggag
    96901 caggaggggc aggagcagga ggaggggcag gagcaggagg ggcaggagca ggaggggcag
    96961 gagcaggagg aggggcagga gcaggaggag gggcaggagc aggaggaggg gcaggagcag
    97021 gaggaggggc aggagcagga ggaggggcag gagcaggagg aggggcagga gcaggaggag
    97081 gggcaggagc aggaggaggg gcaggagcag gaggaggggc aggagcaggc ggggcaggag
    97141 caggcggggc aggagcagga ggaggggcag gagcaggagg aggggcagga gcaggaggag
    97201 gggcaggagc aggaggaggg gcaggagcag gaggaggggc aggagcagga ggaggggcag
    97261 gagcaggagg aggggcagga gcaggaggag gggcaggagc aggaggaggg gcaggagcag
    97321 gaggaggggc aggagcagga ggaggggcag gagcaggagg aggggcagga gcaggaggag
    97381 gggcaggagc aggaggaggg gcaggagcag gaggaggggc aggagcagga ggaggggcag
    97441 gagcaggagg aggggcagga gcaggaggtg gaggccgggg tcgaggaggc agtggaggcc
    97501 ggggtcgagg aggtagtgga ggccggggtc gaggaggtag tggaggccgc cggggtagag
    97561 gacgtgaaag agccaggggg ggaagtcgtg aaagagccag ggggagaggt cgtggacgtg
    97621 gtgaaaagag gcccaggagt cccagtagtc agtcatcatc atccgggtct ccaccgcgca
    97681 ggccccctcc aggtagaagg ccatttttcc accctgtagc ggaagccgat tattttgaat
    97741 accaccaaga aggtggccca gatggtgagc ctgacatgcc cccgggagcg atagagcagg
    97801 gccccgcaga tgacccagga gaaggcccaa gcactggacc ccggggtcag ggtgatggag
    97861 gcaggcgcaa aaaaggaggg tggtatggaa agcatcgtgg tgaaggaggt tccagccaga
    97921 aatttgagaa cattgcagaa ggtttaagac ttctcctggc taggtgtcac gtagaaagga
    97981 ctaccgagga tggaaattgg gtcgccggtg tgttcgtata tggaggtagt aagacctccc
    98041 tttacaacct caggcgagga attggccttg ctattccaca atgtcgtctt acaccattga
    98101 gtcgtctccc ctttggaatg gcccctggac ccggcccaca acctggccca ctaagggagt
    98161 ccattgtctg ttatttcatt gtctttttac aaactcatat atttgctgag ggtttgaagg
    98221 atgcgattaa ggaccttgtt ttgccaaagc ccgctcctac ctgcaatatc aaggtgactg
    98281 tgtgcagctt tgacgatgga gtagatttgc ctccctggtt tccacctatg gtggaagggg
    98341 ctgccgcgga gggtgatgac ggagatgacg gagatgaagg aggtgatgga gatgagggtg
    98401 aggaagggca ggagtgatgt aacttgttag gagacgccct caatcgtatt aaaagccgtg
    98461 tattcccccg cactaaagaa taaatcccca gtagacatca tgcgtactgt tggtgtattt
    98521 ctggccacct gtcttgtcac cattttcgtc ctcccaacat ggggcaattg ggcataccca
    98581 tgttgtcacg tcactcagct ccgcgctcaa caccttctcg cgttggaaaa cattagcgac
    98641 atttacctgg tgagcaatca gacatgcgac ggctttagcc tggcctcctt aaattcacct
    98701 aagaatggga gcaaccagct ggtcatcagc cgctgcgcaa acggactcaa cgtggtctcc
    98761 ttctttatct ccatcctgaa gcgaagcagc tccgccctca cgggccatct ccgtgagttg
    98821 ttaaccaccc tggagactct ttacggttca ttctcagtgg aagacctgtt tggtgccaac
    98881 ttaaacagat acgcatggca tcgcgggggc tagacctctg gctggatgag cacgtgtgga
    98941 agaggaaaca ggagattggt gtgaaaggag aaaatctcct tctccccgac ttatggctag
    99001 atttcctaca actcagcccc atcttccagc gcaagcttgc tgccgttatt gcctgtgtcc
    99061 gacgactgcg gacacaggcc accgtctacc cggaggagga catgtgcatg gcctgggccc
    99121 gcttttgcga cccctctgat attaaggtgg ttattttggg ccaggacccc tatcacgggg
    99181 gtcaagcaaa cggcctggca ttcagcatcg catacggctt tccagtcccc cccagcctga
    99241 ggaacatcta cgcggagctg caccggagtc tgccggagtt ttctccccca gatcacggct
    99301 gtctagacgc gtgggcctcc cagggggtgt tgctactcaa caccatcctg accgtgcaaa
    99361 agggcaagcc cggctcgcac gcagacattg gctgggcgtg gtttactgac cacgtaattt
    99421 cattgctctc tgagcggtta aaagcgtgcg tgtttatgct gtggggtgcg aaggcgggag
    99481 acaaagcttc actaatcaac tccaagaagc atctggttct gacctctcag catccctctc
    99541 ccctggccca gaacagcacc cgaaagagtg cccagcagaa gttcctgggc aacaaccact
    99601 ttgtcctcgc taacaacttt ttgcgtgaga aggggctcgg tgagatagat tggaggctgt
    99661 agaggggtca tcactatggc catgtttctg aagtcgcgtg gggtccggtc ttgcagggac
    99721 cggcgcctct tgtcggacga ggaggaagag acttcacaga gcagcagcta cactctgggg
    99781 tctcaggcct cccagtctat ccaggaggag gacgtgagtg acactgatga gtctgactac
    99841 tcagatgaag acgaggagat tgatttggag gaagagtacc ccagtgacga agacccatct
    99901 gagggcagtg atagcgaccc ctcgtggcat ccttcagatt cagacgagtc tgactacagc
    99961 gagagcgacg aggatgaagc aacccccggc tctcaggcct cacgatcttc aagagtctcg
   100021 ccatctaccc aacagtcttc aggtctgaca cccacgcctt cgttctcccg accacgcacc
   100081 cgggcacctc cgaggccgcc ggctcccgcg ccggtcaggg gacgggcctc agcacctccc
   100141 aggccaccag ccccagttca gcaatccacc aaagacaagg gtccccatag acctacgcga
   100201 cctgtactta gaggcccagc tccacgccgc ccccctccac cttcaagtcc caatacatac
   100261 aataaacaca tgatggaaac cacccccccc attaagggca ataacaacta caattggcca
   100321 tggctgtaaa taaaatgtca taacctggag tctgcatgtc tgttgtttta ttcagtaaac
   100381 cagtagtgcg cgtgagttct ttagggcatc cacgatgtag ccgctcgcgg ggttcccctc
   100441 cccagtgatc atctcggata ggggattcct gtccatgacc acgcaattag agtgccgggc
   100501 ccgggacagc gccacataca catggccggg tttgatgttt ctgtggctgc cgaagcagat
   100561 ggcgactttg tttagggaca gaccctgggc cttggctatg gtcatggcca gctttgagct
   100621 aatgccatag tcacggatgc tgcagaggtt cagggacttg tcctctatcg tctcatacag
   100681 cttgttagta ttgtgttcca ggcagcacac gaagcctgcc tcatccttga ccattagcct
   100741 gggcatgcgt gaactgccag cgtcctgagg ctgctgcttt cctcggatgc caaagaagac
   100801 gttgagatgc gtgtagccca gaagcgtgta gttctcggtg gtggaggcgt agtccaggag
   100861 gccgtgaagg agaggctcgt ctgaggtgaa ctctatgttg tcgcgaatca gcatgttgtt
   100921 ggtaaatgtg cagaagggga ggtccctgaa ctcccttctg ccatagcgga cggccacatc
   100981 caggcattgc ctgaaatagg ccctgaggtc attatatatg tttaacaggg agcagagggg
   101041 ggcagaattt gcggccgggg gagccagtac tcgggcatag aagacagcgg cggggctccg
   101101 ctccccatcc caggcaacct ccagcggcag ttcacccagc tccatcccag cagtcacctc
   101161 cggatcccac gtacgcccgg gcaggggcac agcaccaagc tccgccacgt attccccgtt
   101221 ttcacagaga gaatgtcctc cgtggctaaa agcgtagatg ccgccgtaga tgagtcgggc
   101281 caggaagctg tagacatact cgggctgctc atgcccgtgg gcctccacga agctgtccgc
   101341 ctcgagcgtg tccataaagt ccccgaaggt gccggtatag ccacagatgg actttttggt
   101401 cttgcagttg accgacactg agctgtgctt cacgtaggtg acattgtagg tgaccttgac
   101461 ccgttcttca tcctgctcgg ttcccaccgg gaccatgtct tggtcggcga actgcgagta
   101521 gttaccgagg cgtgcataat tcttttggag ccaggtgtgg gccgtgaggc ccggaagacc
   101581 gaccagggtc ttgtactggg ccaggggctc gaggaagacc tcgcactcca ccgggcaggt
   101641 aaacatggtc accccgcccc catctccccc agttccccgc gcggcgcgcc cctgcccggc
   101701 agtcttgagc gtggcgtgga gggtggtgag gaaggtcttg acctcggcgt gggagaggaa
   101761 gagccgggtc cagcccacgt actgcgtggg gtccattatg gccgccctgg ggacgacgaa
   101821 gcggtcgacg taggccagga tgtccggcga gagctcgagg ccgtactcga gggtcttcat
   101881 gaggtgtcca aactggacgt cggtgcagcg cttgttgttg atgaagaggg cccagttgcg
   101941 ggccacgtcc acgtaggtcg cggccctggg gttgcccacc aggaaggtga ggatgttgtc
   102001 gcactcgcga atcttgttta cctgggtctc gtggctaaag gaggactgaa aggcgtctgt
   102061 ctgggtggga gagcccacgc agacgatgca gggaatgcgg ccccggcggt agagtggggt
   102121 gcgcagccag gcgttgaaga accagtagca aaagaccacg gctgttagaa tgtgcacgga
   102181 aagcgttcca gcttcgtcca ccacgatcac attggtggtc catagctgcc cctggtgcat
   102241 gtctctcagg acctcaaagg cggggccaga gactcccgag tatagccccc tgggcttggt
   102301 tcgcctgaac tcggcggcaa tgtcggagag taccggccag tatttggcca tgtcccgccg
   102361 ctggagttcc tctagggcgg cgtccgtaga gcgaccatga ctgctgaccc gctgcgtcat
   102421 atttatgtgg cggctcttga acccaaaggc gctatagacg gttgggcagt aggctcggag
   102481 tgtctgggag aggttctgtg cggccacggt tgtggctccc gtgaccaggc agtccatcgt
   102541 gtggtggagg cagctaacgc tggtgctctt gccagccccc gccgttcccg taattacata
   102601 ggctgaaaag ggcaggaagg ggggctccga gatctccggg tcaaactcgg gggagaacgt
   102661 ctccatatcc gggagttgtt ggacgcggcg cttagccagg gtccctatcc tcctgactat
   102721 acgcctcacg gaggcgtctg aggtcatgtt caacatgaac gtggacgaga gcgcctctgg
   102781 cgctctcggc tcctcggcca ttcctgtgca ccccacgccg gcctcggtcc gactttttga
   102841 gatcctgcag ggaaagtacg cctacgtcca gggacagacc atctacgcca acctccgtaa
   102901 ccccggagtc ttctcgaggc aggtgtttac ccatttgttt aaacgagcca tctctcattg
   102961 cacgtacgat gacgtgctac atgactggaa caagttcgag gcctgcatcc agaagcgatg
   103021 gccgagcgat gactcgtgtg cgagccggtt tcgtgagtcc accttcgagt cgtggtccac
   103081 gaccatgaag ctgaccgtgc gtgacctgct gaccaccaac atctaccgag tgctacacag
   103141 ccgctccgtg ctctcctatg agcgttatgt ggactggatc tgcgccaccg gcatggtgcc
   103201 cgccgttaag aagcccataa cccaagagct ccactccaag ataaagagcc tgagggacag
   103261 gtgcgtctgt cgggaattgg ggcatgagag gaccatcagg agtatcggga cggaattata
   103321 tgaggcaacg agggaaataa tagagtcgct caactccacg ttcatccccc agtttacgga
   103381 ggtgaccatc gagtaccttc cggggagcga cgagtatgtg gcctactact gtggccgccg
   103441 catcaggctg catgtgctct tccccccggc catctttgcc ggaacggtga ccttcgacag
   103501 cccggtgcag cgcctatacc agaacatttt catgtgctac cgcacgctgg agcatgccaa
   103561 gatctgccag ctcctgaaca cggcccctct caaggccatc gtgggccacg gggggcgaga
   103621 catgtacaag gacatcctgg cccatctgga gcagaactca cagcgcaagg accccaagaa
   103681 ggagctgctg aacctgctgg tcaagctctc ggagaacaag accatcagcg gggtcacgga
   103741 cgtggtggag gagttcataa cggatgcctc caacaacctg gtggaccgca accgtctatt
   103801 tggccagccc ggggagacgg ctgcgcaggg cctaaagaaa aaggtctcca acacggtggt
   103861 caagtgtctg actgatcaga taaacgagca atttgaccag attaatggcc tagagaagga
   103921 gagggagctc tatctaaaga agatccgctc catggagtct cagctgcagg cctccctggg
   103981 tcccggcggc aacaacccag cggcgtcagc ccccgccgca gttgcggcag aagccgcgtc
   104041 tgtagatata ctgacgggca gcaccgcctc cgcaatcgaa aagctgttca actccccgtc
   104101 cgccagcctg ggtgccaggg tgtctggtca caatgaaagc atcctaaaca gtttcgtttc
   104161 tcaatacatc cccccttcgc gggaaatgac taaggatctg actgaacttt gggaaagcga
   104221 gctgtttaac accttcaagt taacacccgt ggttgataat caggggcagc gtctctacgt
   104281 cagatactcg tcagacacga tctctatatt attgggcccc ttcacctatc tggtggcaga
   104341 gctttcaccg gtggaactcg tgacagatgt ctacgccacc ctaggcatcg tggagatcat
   104401 cgacgagctc taccggagca gtcgcctggc catctacatc gaggacctcg gtcgaaaata
   104461 ctgccccgcg agcgcgaccg ggggagatca tggcatccgg caagcaccat cagcccgggg
   104521 ggacgcggag cctgaccatg caaaaagtaa gcctgcgcgt gaccccccgc ctggtgctgg
   104581 aagttaaccg ccataacgcc atctgcgtgg ccaccaacgt ccctgagttc tacaatgcca
   104641 ggggggacct taacatccga gacctccggg cccacgtcaa ggcccggatg atctcgtccc
   104701 agttttgcgg ctacgtcctc gtgagtctgc tggactccga ggaccaggtc gaccacctca
   104761 acatattccc ccacgtgttc tccgagagga tgatcctgta caaacccaac aatgtgaacc
   104821 ttatggagat gtgcgccctg ctctcgatga ttgagaatgc caagagcccc tccataggcc
   104881 tctgccggga ggtgctgggt cgcctgaccc tcttgcactc caagtgcaac aatctggact
   104941 ctctgtttct gtacaatggg gccaggacgc tgctgtccac cctggtcaag taccacgacc
   105001 tggaggaggg ggctgccacc cccgggccgt ggaatgaggg cctgagtctc tttaagctgc
   105061 acaaggagct gaagcgcgcc ccatccgaag cccgggacct catgcagagc ctctttctga
   105121 cctcggggaa gatggggtgc ctggccaggt cacccaagga ttactgcgcg gatctaaaca
   105181 aggaggaaga tgccaactcg ggcttcacat ttaacctgtt ttatcaagat tctttattga
   105241 ccaagcattt ccagtgccag accgtcctcc agaccttgag acgcaagtgc ctcgggagtg
   105301 acacggtctc aaaaataatt ccctagaata aactgagaac agtcatcagt aaatctgtct
   105361 ctcgcgtgat ttccatagga atggtgtagc cggggtggag ggccgatatc acatcaagca
   105421 gaaaggccat aatctctcga aagtaggcgg tggggctgag accatgctca gtggccgtct
   105481 ggcagggggc cgggcgcgct ccgtccttgt ccaggagaca cacgtggctt ccagagaggc
   105541 gcagcccagc cctccgcagc cgctgaagcc aggctcgcgg aagagcccaa aacctgtttc
   105601 ggcgccgccc gggggccagt ctccgggtca ggtcgcggac cagggtcaac aggtggtcgt
   105661 gggatggcgg ggccttgtct gcctcgggtc tcgccgctag ttggtccagg gtccaggaga
   105721 aggcttcgtg ccaaaccaaa aagggccccg agtgctccct acatccaccc acgtaaagat
   105781 ccccctgaaa gatggccatc agtaggcacc cgggcccgcg tcgagccttc acccgaatgt
   105841 gtctgcgggc cacggtggcc tctccaccca tcacatcccg gtcgagccgg ctggcatcct
   105901 ccgagtcttt cacgccttgc aggaaagcct aggagataca gcaacagaaa gctattagcc
   105961 ggtggttccc ccaccatcat tcttcctgtt aacgggaaga ataagagttg ggcaaacccc
   106021 gggggccgcg ctctcccacc cagccccgct tctcacctgt gctagtggct cctctgaagg
   106081 atgggcggag gttggtgcca caaagcccag gatgaactcg tctgcataag cccaggtcag
   106141 tcctaggtca gcggccgcgt gtaggagaac ccgggtgacg gcggtgtaga ggcccccgag
   106201 tgcccgtcgc gtgtctgagg tgccatagcg gtgaagggcc cgcagccagg tttgcgcgtc
   106261 ccgcgcctgc cctccgccat caggcgttcc cacgggggcg cccctggcag agaggtggca
   106321 gcgggccaat tcgtagagcc accaagtggc atcagcctca aggatggctg tggcctccgc
   106381 gcgcccgacc accgtcgtct cgtcctcccc ccctccctcg ccgccttccc gcgtgcaaac
   106441 gtggcgaggg ttaatctcct ttcgggtcgg gggccagatt tgttgtagga gcagcgagcc
   106501 gcgtcgttgc cctgaccgcg cgtcgaggcc caggagggcg tctgccaggg gcgtcccaga
   106561 gactcccagg ttcaggtcca gtagcaggag accctcgctg tgtggcgccc ggtgccagaa
   106621 ggccggcctc gcccgtccca cataatggat gggcaggaag ggaaagcccg ggacataggg
   106681 ctggaaatct gagccccctg ggcagagttc ggggtccagg aggtagaaga tgggcttggt
   106741 gcctctgtgg ttggcgtagc aggaggcata gatactgcgg aggaaggcgt agagcccgcc
   106801 cccggccata ctccaagagt tgacaagcca ggactcgaat cccccagccg gctcaagaat
   106861 tttcaggctg acgcggtgcc gtcgggcgtc cccaccacgg ccggtggccc cgtcggacga
   106921 caccagatct acttcataag tgaccggtcg caggatgtcc ctaaagggga cgggagaggg
   106981 gtcgtcggga gtctcggtgg aataggtgaa aacatcccca cgcggtgtcc tgatgtatac
   107041 gtccaactgt ccgggagact cagagtgcct ctgagcatgg gggcatgtct gttccccctc
   107101 catctcggac ccgaagccat caacaggtgg gggttgttgg tcccgcccat catcccccga
   107161 gcagctttgg cagaccacct gtgctggaaa gagaggctgg aagatgaggc cctgctcatc
   107221 ctccaccctg gcggcggaca agagtctgcg gtctcgggtt ctaaatgaaa ggtcaaatag
   107281 gtccttctcg gcggcatcgg cgagcatagc aatgagcccc ccgctgcgcc tgagctcccg
   107341 ctcccatcgc aaaaagttga gttcggtagt cgagggcgcg ttgaccacgg ggggctccag
   107401 ggagcctcca agcggcggct ggcaggcctg caccacgatc agagtctcaa cgtcctccct
   107461 tttgatgggc acgatgccca cgacccaaat cgcccaccac cgccctgcgg tctgggtgac
   107521 attataaaag gtaaccgagc tgacgcgggc cctgacgctc tccgcgggtg tttccatcat
   107581 tgtttgagat ctgaggagga ctggaccctt taaaacatcc ggtcacgccc tttgcaaatt
   107641 atttaaaagg tgaatgctca actgagacca tcgcaatcat gaagtcctcc aagaatgaca
   107701 cgttcgtcta tagaacgtgg ttcaaaacgc ttgttgtgta ctttgtgatg tttgtcatgt
   107761 cggcggtggt ccccatcacc gccatgttcc ccaacctggg gtacccctgc tactttaacg
   107821 cactggttga ttacggggca cttaacctga ccaattacaa cctggcccac cacctgaccc
   107881 ccacgctcta tctggagccg ccggagatgt ttgtctacat cacactggtc tttatcgcgg
   107941 actgcgtggc tttcatctac tacgcctgcg gcgaggtggc gctaatcaag gcccgaaaaa
   108001 aggtctcggg tcttacagac ctctcggcct gggtctcggc agtgggctcc ccgaccgtgc
   108061 tgtttttggc catcctcaag ctctggtcca tacaggtctt catccaggtc ctttcctaca
   108121 agcacgtctt tctctcggcc tttgtgtact ttttgcactt tctggcctca gttctacacg
   108181 cctgcgcatg tgtgactcgc ttctccccgg tctgggtggt caaggcccag gacaactcta
   108241 ttccccagga caccttcttg tggtgggtgg tcttctacct gaagcccata gttacaaacc
   108301 tgtacctggg gtgccttgcc ctggagacgc tggtcttctc gctcagcgtg ttcctggccc
   108361 tgggcaacag cttttacttt atggtggggg acatggtgct gggagccgtg aacctcttcc
   108421 tcgtcctgcc catattctgg tacattctga cggaggtgtg gctggcctcc ttcctgcggc
   108481 acaactttgg cttctactgc ggcatgttca tcgcctccat catcctgatc ctgcccttgg
   108541 tcaggtacga ggccgtcttt gtctccgcca agctgcacac cactgtggcc atcaatgtgg
   108601 ccatcatacc tatcctgtgc tcagtggcca tgctcatcag gatatgccgg attttcaaaa
   108661 gcatgcgcca gggcactgac tatgtccctg tctcggagac ggtggaactg gagctagagt
   108721 cagagccgag gcctaggccc tcgcgcacgc catcacccgg gcgcaaccgc cgccgctctt
   108781 ctacgtcctc atcttcctcc aggtcaacca ggagacagag gcccgtctct acccaagccc
   108841 tcatctcctc cgttttaccg atgacgacgg acagcgagga ggagatcttc ccctaatgca
   108901 ataaaaactt aaaacactga ggttactttc ccgtcattct ttcgggggaa cgaggggagg
   108961 cgggaattgg gttaagatag gggcgaaggg tgggggtggg tgcaagaatt ggggctggga
   109021 atggagaggg gagtgggcta ggtgccgaca ccggggtgcc aagataatgg attgagtaag
   109081 catggggctc tgatcgggtc cgccgggttc tcaggggtgt agtgggtggg cattgcatat
   109141 ttttgccgcg gtgctgttgg gccttggact cggggtgatc atccgtacca tcacccgcac
   109201 ccgcacccca gtccacagcc accggccaag gtcctgggcc tcccaccacc gttatgcctc
   109261 cccctttacc cattaattac aagagatgtt agtttggttt tttatttggc aaaaacagca
   109321 attcatcatt ttcagagtcc tcatcatatt cgagcccctc gttggtttcc ccgcaggccc
   109381 tcccttcttc ggccgctatt agcttagtag tctccaggtt aaactcctca tagtcattat
   109441 acaggttgat tattcccccg tccacgtcgc ctatggagtt gactcgtcgt cggcaaagag
   109501 accagagggc acccatggcg cggtgtcaaa agtattgtct gcgtacgctt tccaggagcc
   109561 agccgcggtg ctcaaggtct tacggatgac agagtccggc aggaccacgg gtgtcaccag
   109621 caccgccacg ggaatctcca ccgaggcgtc cagaagcagg tctgagccga gcgtgcaggt
   109681 cgccgggtct agaggcgacc gttttcgaaa gaaggccgtc acaatgttca cccggggtga
   109741 gcagtctctc ccgggcttgc cacccccact gtggcggacg tagtctccaa caattttgta
   109801 ttggaggagc acctggtaga agtagttgtg ccgtggattg atgaagatgt tgactgggac
   109861 ccggtcttta ataccaatgc gccccgcatt ttcgcttggg tccgtcatta cgtagagcat
   109921 agactccacc cccctgttgg cagctaggct gtctgccacc aggtcatgac cggggcccag
   109981 tttgcgctta cggacatctt taagattcca ggcctcatcc tgcgtcaaca gatagtcacc
   110041 ctccgagggc aaccgcccat ccgggacgta ctccacggta ggacgagcta tagaattgat
   110101 aaatctgata aatgacctct tgcatggcct cttgtaaagc gcagtgtagg atgggtagat
   110161 ggggtcaaat tctgacttgg aaaagaggta cttgaagcgg cacttaatct cataaatgca
   110221 gctccggtcg gtgaacagta taaagtctcc ctgtgactcc acattgacgc aaagatccag
   110281 agacacccca aaaatgccat ccgtgggact aatcataaag ccaaattgac ggttggcgga
   110341 tgcgtccccg cagatgagct tacagacaat gtccttgacc gtgtcctcac accgcaggcc
   110401 aaaggccaca ggtcccccaa agtagtgatt tgtggagatg ggagctggct caaacacctt
   110461 ggtgggtcca ttcttaatgg tggagagcag cttggaagag gaaattatgc catttcgcaa
   110521 tatgtcccac atcaggttct cagactgccc cctggtcatg gactccacgt acgagcagag
   110581 aacagtcctc tgctcgtcgg tggcctcctg tagcccccag taaatggatt tcagggaggg
   110641 accgtcctgg ctgtcattct cttggactaa cgaggagaca aagtcacaga agccagtttc
   110701 accagagaac tcttgtattt gttcacagag gcaatagaga tagacatagc gcatggccgg
   110761 catctgaggt ggacggtcaa ggttacggac aaaggcctca gtctccggac tgcggaggaa
   110821 gcgggcaaac gtgtaggagg tcatctcctc catgggatcc tcgagctcat ccacgtcggc
   110881 catctggacc aaagaagtcg tctgccaaga gttcagctac cagacctgga agatgagggt
   110941 gctcaaaccg tgggcgacag ttgaagaagt agctctcctt gaacctcttt ttaaggctcc
   111001 ggcaccactg caagaattga ctcatatgct ccgccgtgac atccacgcac ggactctcgc
   111061 cacacgaggt caggcccatg tctaagttca ggttccacat ctgcgacagc acctccaaca
   111121 gcaccacctt tggggctgca aattgcaaaa agtagagcgg gtcggatcgg tcaaatccca
   111181 tgtcagggtt ggggtagggg attttgtggg tggagtcagc gaggtgcatg ataccataga
   111241 gcagcgagta gccgagcgac tgcagatcca ggcgaagggc cgtctgcgcc cccacggggc
   111301 cacacgccga ggggtcaggg atgtgcccag cccccctcaa gatgtagcac ttgctcaaaa
   111361 ggcagagggg cttataggtg tccttggcta tagaaaatgg ttccctctgg caatagaggc
   111421 gatagagctg ccggccctta gaagacttta gccgcacatc cagcatcttg ttgcggtcgt
   111481 ggagggaagc agtcccataa tcagtcagga ccagcctacc catgccccac atggtgtctg
   111541 tgaaatccac caggatgttg ctggggctaa tgtccgaatg gaagaggccg cagtgccgat
   111601 tcagaaagta aacggcatct ttgaggccct gaaagccccg caccaggggc tcaatactac
   111661 catcatgcca gtggccataa tcctggagac tgcatctgaa ctggggcata aacagggcgt
   111721 ggcaggacgt gcaggccgac aggtagtcca ccagggcctt gtcctgccca tcctcggccg
   111781 tggccttccc aatctgaatc atgtcacaca ccatgagctc gtgatacagc tccgtcacag
   111841 agtcatagag tttgaccgtg gcattatctg catgtgcata cacggccccg tagctccccc
   111901 gccccagcag atactcgcag gtaatgggga ggtgatcaca gcgcgtcatg ttctccggca
   111961 gctttacata gagggtctcc gtcatgtcat caatgttggt caccttcagg tgtttgtgct
   112021 gaaaggtgaa gtaatcaatg acagtcacct tccccaaaaa ggcctgggtc tctcgagggg
   112081 gttctgggga gacactcaac tcgccactgc tggaggagtt cgtcgggctc aactccgcag
   112141 ccatattcac atccatgttc ctcaaatggc tcgagggcct gtcgcagctc gtctctggcc
   112201 tcaagctcct gctcacggag ctcctccacc cgctctagct gcttgtagtt gatttttgga
   112261 aattgagtct tggtcgcggt gaccaccctc tgataggtag aaattagctg tttggactca
   112321 aacgtctccc ttgcgcggcg cagggactct aaggcacccc gagcagatgt aaactgtgtt
   112381 tcaaacagag cgtggtccct cccaaatctg tcacgtgcgc tcacagccgc tctcttttct
   112441 accgaggctc ttagttgctg ggccaccaga tctcgcttag aactactcat cttcataagt
   112501 caccatgtcc gcaactatgg agcccagatc atacgtgggg tagagtacgg tagttccagt
   112561 ggaggcttcc cggtaatttc ccacagcgtc caccatatat ctttctgcct ctcccgttag
   112621 aattaggcaa ggatcatacg tgtccaccgg ccttttatac tgagcgttta ggttttgttt
   112681 atgtagcaag cacaaaaggc acacacgagt gatgcaaaag ggttcctgag gcagcaggca
   112741 gagctgtttt gccattttat tcaggcggct aacgtcaaag ggaggagcta tatcctcacc
   112801 cttccagtca cgcacgtcca agtacagggc atacacacac ctggtgaggt gtgccaggaa
   112861 tgcctctatg ttggcacatg gtgtataaac cgcagtgggt agcagaatag ggcccctctt
   112921 gccccgtgct gcagcgtaaa cacagtgacg ctcttcgcag tgggacctgg ggccgtagaa
   112981 gagggcccac atccaaggga gtgggtcttc aggcaccagg gaggtccagg tatgggagtg
   113041 ggccaatatt tgcaaggcct gacctataac ctcatctttg ttccaggcca gcgcaattcg
   113101 cataaggtcc ccatcaaaca cctcaaaaca cagacccatg cccatttcag gctgagaggg
   113161 ctccatccgg ctcgaccacc cttgtccacc aaactgccat tcttctggta aacggggatt
   113221 gaggggcaag agctccaaag ccaggctcga gaagtcatag tcatcctcgg ccacacggcc
   113281 ggagctccgg gcctcgtgcc agggcctgtt gtcctggggg aggatattgg acacgagcag
   113341 gaagctcttg agtggcgtct ccaccagctt aaattgctcg ggcgtgtcct ggcaggcctc
   113401 cagtgccagt tccagacact gcccatacct gcgggcgagc atcgggtcat cgggcatatc
   113461 ggccttgacc gcgttgaaca tgctgtatgc ctcgcagcgc ggccgtctga ccgagaacct
   113521 aagaaacgcc ctgcagcagg atagcaccac gcaaggctgc ctgggtgccg agaccccgag
   113581 tattatgtac acgggggcca agtcagacag gtgggctcac cctctggtgg gcacaattca
   113641 cgccagtaat ttatattgcc caatgcttcg agcatactgc cgccactatg gccccaggcc
   113701 cgtgtttgta gcttctgatg aatcattacc catgttcggt gcgagccccg cccttcacac
   113761 cccagtccag gtccagatgt gcctactacc agagctacgc gacacgttac agcgcctgct
   113821 gcccccaccc aatcttgaag actccgaggc cttgacggaa ttcaagacca gcgtgtcctc
   113881 tgcccgtgcc atccttgagg accccaactt tttggagatg agagagtttg tcaccagcct
   113941 ggccagcttc ctgagtggtc agtacaagca caagcccgcc cgcctagaag cattccagaa
   114001 acaagtagtg ttacattctt tttattttct gatctcaatc aaatctttag agattacaga
   114061 caccatgttt gacatctttc aaagtgcttt cgggttggaa gaaatgacgc tggagaagct
   114121 gcacattttt aagcaaaaag ccagcgtgtt tcttatcccc aggcgccacg gcaagacctg
   114181 gatagtcgtg gccatcatca gcctcatcct ctcgaatctc tccaacgtgc aaataggcta
   114241 cgtggctcac cagaaacatg tcgcgtccgc cgttttcact gaaattattg acaccttgac
   114301 caagagcttc gactccaagc gtgtagaggt caacaaggag accagcacca tcacgtttag
   114361 gcacagtggg aaaatctcca gcaccgtaat gtgtgccacc tgcttcaata agaatgtaag
   114421 acctgacgtt tcagtacttg gcaattgtag agcatagccc ggctgtaaag gtcagaaaat
   114481 cgcagcaggg tccaaggttg tgctgtacat gggacctctt tcccattagc aagaaccccc
   114541 tgcaggacgc gtgacatgtc cgggtgcatt ttgggtgggt taaatctcag tcccaccaca
   114601 aagggggcat cctccggttt gaacatcaga cccaacaaag cccgatgccc agttatgggt
   114661 acgtagtcgt tgttcagggc cgtgcatggt agcagacaag gacaggtgcc agatgtgcct
   114721 gggctatcgt cctccgtcca gccacgcagg atgttcacgt gggccccggc accatagcat
   114781 gtcacacatt ccccgttatc acatctggtt agcaggttga taaaatgggt cagtgatgga
   114841 aaggttggca tattggggca gcacatcagc atgtccatgt taacgaaaaa catgtacagg
   114901 gccccttctg cataccaggc accaccccgt cccagtggga tgatctccga gggtgtgata
   114961 tcttgcagtt cttctactgt tttaacggcg gttgaggtgg taaagacgtg ggccgtggtc
   115021 agatctgtgc aggtgactac agggtttccc ctaatctcca caggcaccgc ctcacccacg
   115081 gcatctgaga ataccccaaa gtacatgaga gtcaggctgt gtggcccctg gactgcctta
   115141 gtgaagagaa cctcgggcct ggccacggtg gctagggttc cattgatgta gacggtcaca
   115201 taggtgggct tcttcttggg cttcagcaca atgagggtaa cattcatgta ggttttagga
   115261 ggtccggcta tctgaggcac gtacacagct gacacggcgg ttgtggccgt atagactttc
   115321 atctggggcg tagaggcatc gctcagcacc cagaggcact ccttgttgag gaacttgcga
   115381 agctgttccc ggctactgtt cgcggcggat gccatgacgt gccagaatat atcccctctc
   115441 ctcgggggtg agtgccaatt ggcctttaat aacaaagccc ccaggcagca ccaaaaatgc
   115501 ctgcccgtcc gatgtggtgg ccaggtggac gcagtgcccg tcagttccaa gggctactag
   115561 ctgggaagca gccccaacca gcccaccggg gggcctggag tcgatcacct taccccaggc
   115621 cgaggcccct tcctcataca gcgggtggct atctatccat aggcaggcat ccggcgtctt
   115681 tggtgcattg gagatagctt tcacccaaca actttcccaa ctaacccgtg tctggacagt
   115741 gaagaacgct tccctgatca ggtctgaatt tttatagata cgggagtagg aggtgggaat
   115801 aacaactggg atttcttgtt gtgctgtcca ggcctgcatg gccagttttt ccctgaagct
   115861 agcagaaatt ctgagggcca ctgaaatgag gaagcgaaac tccctctctg gagctcccaa
   115921 aattgaaacc tcagcaagat ctgttgctgg ggaggcatgg gtgacagctg tcatcctgtg
   115981 cagtctgccc tgggcactca gctctggata tgtgacaaca tagagagcgt gggggctaaa
   116041 aatatgagca attcccctga ccagggccct ggactcacga atggcccgac gggtcttaga
   116101 gaaagaaaca ggcaccctcg agagtgcccc cgacccgacc cccacagtgc cgccagtccc
   116161 tgctcggcct ccgccgcctt ccccaccggc gctgccccgg atgttgctgg ggttctcgag
   116221 ggctgggtgg tgcttggaca cagaggtctc agcagccgcc ttggtctcgg ccccggccct
   116281 aagtctgagc cccaggcaaa gggccggact cccagcgtgg cccaacctct gctcccctct
   116341 attctcctct tgcgttatct ccaatagaat ttgcttgagg tcatacgttt tagggtgctc
   116401 gacctgggcc gcggccatcg gcatatgctc tatacccgcc cctccggggg gcccaggatc
   116461 tataggtatg ggctgcatag ccgcagcaga ctcctggacc ccagaggcct ctctgatcag
   116521 atgcccgtcg gtcagagccc ttttggcccc ctcaaagaga gacaggtaat aaatctgtag
   116581 ctccccaacc agccctcctt catcgtaaaa tcgaagggcg gccacgtgga aggggttgta
   116641 gagctctgga aggccctcct cgcagtacac tggcacactg gtaaacgtgc cccgatggct
   116701 aggccgtccg ggcagcatgc cccgagcagc aaacacgcgg cagaccctcg tgagacccgt
   116761 ccggtcactg aagagagtct ggcaccaggc cccctcgcag tttggcacgc gattggggca
   116821 aagctctgcc ataaccgtgt cgggaacaaa taggtgcacg aggagggggg tcccgaggcc
   116881 actcaacact tggttgtcaa tgtggacatc catagctctc tcatgcgttt ggctacagca
   116941 tcatagcgct tgtttctggt ggatttaaat aacagggccc cgtagacagt cttttgtgag
   117001 taaatagaga tgatgacatg gatgtagaga ctgaggacca catccaccac cttctcggag
   117061 gaggcccccc taaacagcat caggcagcaa gggaacacaa aggaaaccag ggccgggatg
   117121 tgaggcctca gcgccccctc ctgatcaaag agggcctcgc tgaccccgga gatgacattc
   117181 tcattcagaa agtagtgata gaggtgattg accacagtct taaccaggcc ctggacttgt
   117241 tcaggctccc acttgtcccg ctggtcctgt gtgtcttgtc ggatctcggt ccagggcctc
   117301 agcgccggct ggaaatgcgg ccccatgtag ttgcctgtaa gggcgcacac cactccctca
   117361 tgggtctcaa tcagggtgca ctcgctggat ccatcacata cgtggtactc gccacagccc
   117421 cagcaggcaa acacggaggc catgctctca ggtaacggga gatggaactc cagcttacta
   117481 tacgagcaca ggtggcgagg attgggctca tccgtgcccc cctccccccg cgggaggctc
   117541 aatcggcctt ggtctgacat tccaccccgg ccaggtccag gagggtgcaa atattctcca
   117601 ggcgctgcac ctcagagacc tcctgctcaa agaggcctcc caccgccacg tagacgcggg
   117661 ccaccgtccg gggaaggtca gtggggtccc agctcagcaa ttgtccaaat tctgtctccc
   117721 caatagtgac tcgcttctta tcctgtcttt cagagcatcc gggggcagac atttcacctc
   117781 ttgtttgtgg acgaggctaa ctttatcaag aaggaggccc tgccggcgat cctgggcttt
   117841 atgcttcaga aggatgccaa gattatcttc atctcgtctg tgaactcggc tgaccaggcc
   117901 accagctttc tttataagct gaaggatgct caggagcggc tgctgaacgt ggtaagttat
   117961 gtgtgtcagg agcatcggca agattttgac atgcaggaca gcatggtctc atgcccctgc
   118021 tttcgcctgc acatcccgtc ctacatcacc atggacagta acatccgagc aaccaccaac
   118081 ctctttctgg acggggcctt tagcaccgag ctgatgggtg acacctcctc gctgagccag
   118141 ggtagcctga gccgcactgt gcgtgacgat gccatcaacc agctggagct ctgccgggtt
   118201 gacaccctca acccccgagt agccggacgc ctagcctcct ccctctacgt gtacgttgat
   118261 ccggcctata ccaacaacac atccgcatca ggcaccggaa tcgccgccgt gactcacgac
   118321 agggcggacc ctaacagggt catcgtcctg ggcctggaac acttcttcct caaggaccta
   118381 acaggggacg ctgccctcca gatcgccacc tgcgtcgtgg ccctcgtctc ctcgatcgtc
   118441 accctgcacc cccacttgga ggaggtgaag gtagccgtgg agggcaacag cagtcaggac
   118501 tctgcggtgg ccattgcctc aatcattggg gaatcctgcc ccctcccctg cgccttcgtg
   118561 cacaccaagg acaagacgtc cagcctgcag tggcccatgt acctcctgac taatgagaag
   118621 tcaaaggcct ttgagaggct catctacgca gtgaacacgg ccagcctttc tgccagtcag
   118681 gtcaccgtct ccaacaccat ccagctctcc ttcgatccgg tcctctatct catctcccag
   118741 atcagggcca tcaagcccat ccctctccgc gacggtacct acacctacac cggcaagcag
   118801 cgcaacctct ctgacgacgt gctggttgcg ctagtcatgg ctcattttct cgcaacaaca
   118861 cagaagcaca cgttcaagaa agttcattaa actttattga ctacaccagt cccttgtaaa
   118921 gcgacgggtc tcgcgtgacg gcattcgtga gcagggcttc gtccaggggc ttgttcttgg
   118981 cggacatcat tagcccagcc gcaaatatca gaattagcat cagaaaagtg agccccacaa
   119041 acaccagtgt ccagagagga agaccgtaag ataaagatgg ctgcctctca tctggaacgg
   119101 tgggaagctc agcagttgtt tttgtggcat tggacgtccc tttggaggac agcgtggggg
   119161 ccaaggtggt agcgttggta atacgggtag tagcactggt ggtggtggag gacctggtgg
   119221 tgacattgct agtcacaccc gtggaggttc ctgttccggc ctcggtggca gtgatgttct
   119281 gtgcagtaac cttagtggtg acattgatgg tggatgcgtt ggaagttgtt gggactggtg
   119341 tgacagttgt cccagtggat gtcaccgtgg ttgtgttggt gctcaggata gcagttgtgg
   119401 ttataggggc gctggtcgtg gtcaaggtcg tagactggtt tgtgctagga cccgatgccg
   119461 acggtgatgg tgtagtcaca gccgttgtgc ctgtcacgtt ccccgccgag gccgtcgaac
   119521 tgccactaga tgtccagata aggcttgtct cacagatgag tatcatggcc aggacagcgc
   119581 ctgccttgtc tctggcgtgt gccatcgcgt ctggacgcag aaggcctccc ggcctctttt
   119641 atagctagtc tccacaccca atactctact gaaccatcac atacatgacc tcctcgaggt
   119701 atgcagggaa tgagcggtcc gtgagccggt caacacgaca ttgcttccgt ttcatgcctc
   119761 cagctgcccc tgaccagtta ggacccttga cggatgtctt taacggcgcg gtgcagttgg
   119821 tcaccaatga cggcctaaag gccaacacat ccttgaagca gggcgtagga atggtaccaa
   119881 actcggggcc caccccatca aagacataat atgtctcata gtggcagtga tgatgcatca
   119941 ccaccacagc actcgccagg accctctgca tatcttgtac aaggcgcctt tcaactcggc
   120001 cactggctct ggtgacgtta aatgtcctgt tcctattagt cacagcctgt agatttgggc
   120061 acccagactc aaaaagtgca gctacatgaa gggcagccgc ctcaaatcca ccatgacccc
   120121 catggctgtc cgtgttgttg gggtaataag tcacattgtt aatgaccacg gccgggataa
   120181 gggtgtaaac cttgcagaat ggattggtcg gacacccata agacaggggc accccaaaat
   120241 cacgcccctt accccgaagc accttggccc ccaccggcat aaagctgggc aaaaagagtg
   120301 ggttaaaacc aaaggcgagt agggccagga acgccaaata gcagcagtaa tagatgaaaa
   120361 caaagctcag catgaaacag cgtggaggct cagctagggt ctctgcctct ccatcataga
   120421 catcttcctt gaatctcatt ctctcaccgc atacctcgct cttcatccag gagggggcca
   120481 tggctgccat tctaccagtt aacgaggaga gagagagtag gtccgcggaa attggtgccc
   120541 ctctctgccc tcctgacgag gccatggtgt catccatctc cgcagtccgt tcttcagctt
   120601 tggcattggt ccgggtccgg gtggtctgat tttgattctg atcctgggta ttggtcttgg
   120661 tctctcctcc cccattggca tggattggca taggtgggtg tggctcaggc tcaggttccg
   120721 gccctgggac ggcagcagcc gccgggacgg tgaagtcgtg gaaggtagag gcccgtccct
   120781 cccgaggtcg tggggccgga gccttataaa agacttccac cctctccccg ctggccaaga
   120841 cacgccgctc gtggaccacg ccatcttcct cccggctgat tgtgtggctg acggtgccgt
   120901 gttccaccgc cacttgttca tcgaccatgg tacccccttt atcttaacca gcaagtggcc
   120961 gtcagggtct cttgagagta tgccgctgtg gccaagcgag gccccaaatt aaatagtgat
   121021 gccaaagact gtaggtaggt catcatcaca cgcatgcgtg ataaatcatc cgccactgac
   121081 aggtcatcca ggtctatccg ggctatctca tccggcacca tttcctggaa gagattcaag
   121141 aggtcgtaat gctcatgccg gataaggcct cggaccaggc gcatactggc cctgggcagc
   121201 agggtcacca tgatgcaaaa gtagagactc agattgtcca gcagggccaa gccaaggggc
   121261 cctggcacct ccgggagggc caactcgtag tggtgcccca ggtatgaaac agagccaaga
   121321 tgcatgtgta catcgagcat gtctgcgttc ccgggagcct gcatgacaac ccgggagtac
   121381 acgttaaaca ggagaatctt ctgcagcacc tcctctgcta tgggcgtagg cagcaccatg
   121441 gggaaaacaa tgtccacatc attggactct aacttcacgg tggcatgctc tcgtccaaat
   121501 accgggggca taacactgag gctcccggtc ccatgccact ggaaaaaggg ctggtacttg
   121561 ttcttaatgg cgtaggtctg acctggaaca atcttggtga gtatcaaact gtccacgcta
   121621 acctcatcca gcacggccag ggtgcaatca gacaggtagt tgtacatgga cacgtagtcc
   121681 gggaccgtct ctagagagta cacctgaccc aagcccaatc cctgcacatt ctgcgtcccg
   121741 tgagtggaag ccaggggtaa gatgcagcca atcctctgtt gcatcttggc aatctcatcg
   121801 gtatacagac gagaggagag agacactacc actttcaaat ccatctttat tgacaattat
   121861 caaaaaacca ccttatttcc aaactttaat attcttcgta ccggcgccac ctcttcaatt
   121921 atatagtgtc cgtaatggat gggggcgtgg gtctgtttga cagacataaa ctcatcgatg
   121981 agtgcccggg aggaggctga gagtgcgggg aatgcctcct gcagaaagct gcagggctgc
   122041 tccagaaaca cgtcagtgcc agcaatcact acaaactgca cctctgtgtt gctggtggct
   122101 gggtgccctc caagtcgctg gctgtactcg ttgaccatgt tgtagagtcc cctgttgttg
   122161 cgcagaagct cctccttgtt gaaaaatgcc cggcaggggc tgtagaggcc cgggacggcc
   122221 gtctggcgat aggaggagtt gtacatgatg tcacccagag aacccagctg agatgcccag
   122281 ggattcacag tgctccggta ttcataggcg gcatccgggc gagaatggtc atagatgagc
   122341 ccctcggcaa cctcctgatt gtagttttca caggagacca cacaggcggc ccgtcccctt
   122401 ggagagttgg acttttgaaa ataagccacg tctgccgtga ccggtgttac gataatctca
   122461 caggtggcct gctggccgtg gcagagtcct ggagctccat taacattagt catacctgcc
   122521 aggtatgtcc tggggtcccg aagcagcgtc ccattgcgct gagcgcccac cttggccttg
   122581 atgtagtcat tgacttgctg gttgccaaag gcctcggccg gaaagacgct aaagaagtct
   122641 tgggtgtgga tacccatgtc agtagtgatg gccgccaccc tggccggcgt catggtcgag
   122701 ctataactaa gcccggtgtc gatggaggcc atctcgtgat gcacctcaaa ggttaccgcg
   122761 tccaccctgg cctcccggcg gctaacattt ggggtcccaa tgaacatgga tgttgaggcc
   122821 ctggagctaa acaatatgtt ttcagagagg atctcatcgg tcctgaccac ggtcatggcc
   122881 acccctgggt ggatcttgag cttggcctgg gcaatatagg ccatggggga catcttgatg
   122941 tgcatggcgg tcattccact gattgaaacg agggaaggaa gacattcggc cgcgtatttg
   123001 cccatgggcg agcggtgcca ctcccggtac tctgcaaaga gctgctctgg ccggttgaag
   123061 gcttccacgg cccgctgctg aggattgcgc ataacaaagg tggcaacatc ctggtgcatg
   123121 gtggcagcca ctcgcgggtc cccgtaaaac atatggaaag gaatggcgtg aaagagacac
   123181 tgggtgacgg cccgggtcct ctcggagaag gcaaaggcca ccagcccgtt caccaaaaca
   123241 gtctgctctg tccgcttgtc ggcgggattc ggggccagct gctgcgtaac gtcattgtcc
   123301 accgacacgc gcacggtgcg ggtgaaagtg gggcaggtca tgaatgaggc gctgaggtcc
   123361 ctgatcatgc ccacggtggg gcggaggtcg gagatctcca gcagatccct gagcgtccca
   123421 ttctccaaat tgtcgagtat gtcctcgtcc ctggtaaaat gatggctgaa ggctggcccg
   123481 ttgtaggcca gggtctgggc cacgtgctga aagtccaccc cgaggccgca catgtgggca
   123541 ttggtgcagg tcgggaggaa aacgtagtaa aagatctttt ccagcacatc cgcatgcccc
   123601 tcatctacat aagggcctag gtgcagacgg aaatcgtggt cgtggtctcc gttaacccgg
   123661 tagccgtaca aggccacaaa ttgggcagcc atctcatcca tgtttccaac cctctcaata
   123721 aactggggcg cggccagggt gtcagcgtaa acctcatttc cgataataat ctggggggcc
   123781 cggtcactaa cggtgagaag atgggtgaaa atgtctgtgt aggccaccgg ggggagcagg
   123841 ttagggtcca ggagtgcgca gacatactga cccacgctct catcccccac aacatctgac
   123901 ccggccaggc gcatcagggc ctgctctagg gctataagtt ccccatagat ttttctatac
   123961 atggaatagg cctccttgga gatggcgtta tttcccaggt ggcggcagat gaacttgatc
   124021 atggaaaagc tgttcacaaa ggcaagcctc cctgcccgtt cccagtaggt gttgatgcac
   124081 agggacacca aaggcacgtt catgacaaac ttttcctcaa acccgtggat catagcctcg
   124141 actacgtaga agaaggctgg ataggcagtg tcataggcag tatcctgcac agtctcaata
   124201 acggcctgat ccaccacgtg ggccagagat gtggcggtct caaactgctg cccccgggcc
   124261 tcttggaatg cagctggggc caggggagtc ggcaggttac ccaccattag ccggtgcacg
   124321 gccctgtgcc tggccctctc cccggcatcc ctgccaatgt aaatatcata aagggggtgc
   124381 agctccagcc gcagcaggtc ataattggac gggtggagga agtcttcggt gggcagcccg
   124441 cacttgagag ctatatctgt cacgggggct gcatacttgt tatcatagaa ctcgtccaca
   124501 ataacaagca cattcatgtg attgggcctc ctgtgttgca gggagtaggt ctcgcgcctg
   124561 tctcgcgggg ccggggccgc gttgaggctg tttagggtat gggcgggtgt gtggagtcgg
   124621 gggtgacaga gaaccttgag agcattctgt aggttaaacg cgaggagaag gttattcttg
   124681 tttacgatcc atgcctccac cggtagctgc tgtgtggggt tgtccagcat tttgatggcg
   124741 gcggaggtcg tgtacttggg attgggcata aacaggccca ctgggaaata gtagctgtac
   124801 tgcattcttc tgttgagggg gtatggggac tgagtgtcat tgtacatctt ttgcaggctt
   124861 tccacggcca ccgcgtggtt gcccagcttg atgacggcgg ctgagatcgg cacccggggc
   124921 tgatcctcga cccctgcggc cacagccggc aggtcagact tggtgcttcc ggctttttcc
   124981 ggtgagtcca cgatcctagc catgaaatgc tcaaacgtac gcatcacgcg cccgtagctc
   125041 acggcagtga ccaggttctc cccccgtacc acaaaagaag catagctcga gggccccatg
   125101 atctggttgt cggcctcctc acccaggaag gtcaagagct ggcgcagaac gttgtcggtg
   125161 acaataaaca ccccccccac tggctctccc cccttggcgg tcgtgtaggt actgaccccc
   125221 ttgagcacgc tctccccgga cacggccgct accatctcag agagacggct tcgcacgtac
   125281 tgagaaaacc cggagcccat gttctcggcc cggtccagga agaaggagtg ctccagcaga
   125341 tgcctcttga acatggcaat gaggtcagac ttgacagtct tggagaaccc cctctcagtg
   125401 aaggtaggat ccgccagggt ctgcaggata aacatgggag gggcgtggcg aagcttcaca
   125461 ctcaggacgg tgttaatgag gcccctctcc agggcatcga ccccaaactg tagggccgag
   125521 gccacggtct tgacagcccc cacgtactct gcgtactcga ccggggtctc ggggatacta
   125581 tgcaggatct ccagatccag catggacagt tccatttccg tactaatgtg gtgtttgtgg
   125641 caatttttga ccacaatgaa tgtccgctgc ttgctgggtc tccttccgtc cccgtgagca
   125701 atggtgggga cggagattcg aaattgaatc ttgccatccg tcatacgact caggtctttg
   125761 aattccgtgt tcacacagga cacggccagt gccgtctcca ggaagcgaac atattggatg
   125821 gcgttcgtgt agaccccgag tagcacctca aacttgatgc ccgcctctct ggcatccttg
   125881 cccaccagca ggtcaaagct atgaaacagc ccctcggccg ctgactgccg caggttcgag
   125941 agcaggtcgg catccaccgt cagatagggg aagggtctgt tttccacacc ctcatttgag
   126001 gccatgacac aaggtaagag ggagatgggg ggaggtctcg agggcttctc ttcacagctg
   126061 ggtctctttt acgccctggc ctgcaaccgc agcccacccg cacttcccga ggatgctacc
   126121 cttctaatca aatggttgga cacggccctg ggcagggagg ccacctttta cgcgtgtcgg
   126181 gctatgcgtc gtcttctact cggcgttatc cgaataaatg actgccagga gctgccacct
   126241 ggtttaataa ttctgagtcc gggcaccgtc cctggccccc ttggagtcca gagtctggag
   126301 catacagact gcgaaatatg gtcctctgcc caccctgacc acgctgccca cctcccggtg
   126361 cccagggtca tcacatacac cgactgcccg ggttccataa gcacgagctc aatgtttcgc
   126421 cttatcatcc gctacttgtc tcatcaccaa tttgagcgct gcttcgagca gttctgccgc
   126481 gtggtcccgc gtcgcttcct agggacctgt aagcaaaact ctgcaaagat gctggctcat
   126541 ctgaagcagg ttaccaggat ccccccctgt ccgcccttca gcgggcggga ggccagactc
   126601 aagttccact tcttctcctg gagcacattc atgctgtcat ggccaaacaa tgccacactc
   126661 cgggagatca ggacgagggc cgccaccaac ctcacccacc acccacatct agtggacact
   126721 ctgtaccacg cctctccgca gaccccattt ctgacacgca gcggtgctct ataccgcttc
   126781 gtcacctgtt gcaactgcac cctgcccaat atctccatcc agcagtgcaa ggccggggac
   126841 agaccggggg acctggagat cattctacag agtaacggcg gagggaggcc tgcgagcttc
   126901 cagttcccct cctccccaac cggcgcccta ttgcgatgca tagttgctgc ggccctgctg
   126961 ccagaggtgt ccgtggggca ccaggagctg tctccgctca tgtccagaag ccatggaggg
   127021 cagacggatg tcaggtcggg cccggacccg gcccggaggc tggtggccct cctgcgaagg
   127081 gaagatgggg cacctaagga cccccctctg ggaccgtttg gacacccccg ggggcccggc
   127141 ccggccaaga gcgaagacga ggagtctgag cgtcgagacg cccctccacc cccgctcgat
   127201 ttcagcttcc aagcttcccg gttggtgccc gtggggcctg ggtttcgcct gcttgtgttc
   127261 aacaccaatc gggtgatcaa cactaaattg gtgtgctcag agcccctggt gaagatgcga
   127321 gtttgcaatg tcccccgcct catcaacaac tttgtagccc gcaagtacgt ggtgaaagag
   127381 acggcgttca ccgtcagtct attctttacg gacggggtgg gggccaacct agccatcaat
   127441 gtcaatatca gtggcaccta tctgagcttc ctattggcca tgacgtcact gcggtgcttc
   127501 ctgcctgtag aggctattta tcccgcggcc gtgtcaaact ggaactcgac tctagatctc
   127561 catgggctgg aaaatcagag cctagtcaga gagaaccgaa gcggggtctt ttggactacc
   127621 aactttccct cggtggtgtc ctgccaggac ggtctcaacg tgtcctggtt taaggccgca
   127681 actgccacca tatctcgagt gcacgggcgg acattggagc agcacctgat ccgtgaaatc
   127741 acccccatcg tgacgcatcg agaggcaaaa atctcccgga ttaaaaaccg gctctttacc
   127801 ctgctagagc tacgcaatcg gagtcagatt caagtgctgc acaagcgttt cctggaaggc
   127861 ctgctagact gcgcctccct cctgcgcctg gatcccagct gtatcaaccg aatcgcctcc
   127921 gagggcctgt ttgatttctc caagagaagc atcgcccact ccaaaaaccg acacgagtgc
   127981 gcgcttctgg gtcacagaca ttcggcgaac gtgacaaagc ttgtggtaaa cgagcgcaag
   128041 acccgcctgg acatactggg ccgtaacgct aactttttaa cgaggtgtaa gcatcaggtt
   128101 aatctaagac agtcacctat tttcctgacc ctcctgaggc acatccgccg acgtctgggc
   128161 ctgggccgtg cttccgtaaa acgagagatt acccttctcc tggcccacct gcgcaaaaag
   128221 acagccccca tccactgccg tgatgctcaa gtgtaagcag cccggggccc gcttcattca
   128281 cggggccgtg cacctgccat cgggacagat tgtcttccac accatccaca gccccactct
   128341 tgcctcggcg ctgggactgc ctggggaaaa tgtacccatc ccggccctct tccgtgcctc
   128401 gggcctcaac gtccgtgaga gcctgcccat gaccaacatg agagcaccga tcatctcgct
   128461 ggctcgcctc atcctggccc ccaaccccta tatcctagag ggacagctga cggtgggcat
   128521 gacacaggac aacggcattc ccgtgctttt tgccaggcct gtcattgagg taaaaagcgg
   128581 gcctgagtcc aacattaaag cctcctcgca acttatgata gcagaagact cctgcctgaa
   128641 tcagatcgcc cccttttccg catcagagca ccccgccttc tccatggttg agtccgtaaa
   128701 acgagtccgg gtcgatgagg gagcaaacac ccggcgcacc atccgggata ttctggagat
   128761 ccccgtgact gtgctctcat ccctgcaact gtctcccacc aagtccatcc tgaaaaaggc
   128821 accggagccc ccacctccgg agccccaagc caccttcgat gccgccccct atgcccgcat
   128881 cttttacgac atcgggcgac aggtgcccaa gctgggcaat gcccccgccg cgcaggtcag
   128941 caacgtgctc atcgccaacc gctcccacaa ctctctaagg ctggtgccca atccggactt
   129001 gctgcctctc cagcatttgt acctcaagca cgtagtgcta aagagtctga atctggagaa
   129061 tatagtgcag gactttgagg ccatcttcac ctccccgtct gataccatca gtgaggctga
   129121 aaccaaggcc tttgagaagc tggtggagca agccaaaaac accgtagaga acatagtctt
   129181 ttgcctcaac agcatctgtt ccacctctac actcccagat gtcgtccccg atgtcaataa
   129241 cccaaacatt agcctggctc tagagaagta ttttctcatg ttccctccct caggcaccat
   129301 tatgagaaat gtcagattcg ccacccccat cgtccggctc ttgtgccaag gggctgagct
   129361 tggcaccatg gcacagtttc taggaaagta catcaaggtc aagaaggaaa ctggaatgta
   129421 cacactggtc aagctttatt acctgctgcg catctaaagg aaaaacataa caatcttgtg
   129481 aaccagaaag atacccagag caaaagcaat aaagtacagg attattgcca aaacaacgtg
   129541 tgctctttct tcatacaggc ccgcaatttc catgacagtc ccgttggtgg tcagcagcag
   129601 atagtgaacg tggaggttgt caaaatcaaa gtagttggag ctcaagatgg agttttggac
   129661 ttcctgggag gtgatgtagg ttgtagtttc caggccttcc ttttcatcat aactgagcag
   129721 ggcaaagcca caaaaaatgc aggatttctg cgtcctggta aaattctgga tctttggaat
   129781 ctggcggggc tccccagcca cagcaccctg cgaacattta ttcattataa cgggggagag
   129841 aaagagagag ctgctgagat aggtggtgct ggcctcgtat agcgccgagc ctcggacctc
   129901 acggtcacta gagattatga atgtcacgtt gatgagcggg ataatcatca gaactttgtc
   129961 gagcctgtcc acgcatttgt aggcggggag atgccacgca tccctgtctt ctcgctccaa
   130021 agagagacgc ccaagaaacc catccacagc atttgaaacg gccgcctggt ccagcattgc
   130081 ctcctggggg gccatgctca gcagcttgtc tcgtgtgagg tcaaatcgta ggctgaggta
   130141 gcacggtgag aagagcccgc tctccgtccc cagggctagc ccccgcaaaa cctccccaat
   130201 ctctagggcc gagcacaggg cggtggacag cagttggtat agggcaaggt tgggcccctg
   130261 ggtagtcacg ttcagccgca actcgcgtag caccacgtgg ctgccgataa acagggtctc
   130321 tctcatcacg gtatgcaggg gctggaaaag ggggtggcgg ttgtaggccg agagaagcac
   130381 agatgtggcg cctccaatga ggccactgta aaccccggcc ttggggtagc cgacggtggc
   130441 taacctcagc gcgtactcct gtttctcagt cgtcaggtga ccaagctcct ccatcttgac
   130501 cgtggccatc agcacggcgg ccaagcgctc cagcccgtag gattgcatgc ccttgacagt
   130561 ggccccataa catatgccga tgatgtcttt caggacagtc agctcaaaga agctcttggc
   130621 caaccagcgg aggtccacgc agccattgcc agtctcaccc acggcatgac ccaccttaaa
   130681 gaaggccaca gaaacctcaa acatggtagt cagcgtttcc gtgtccagtt ctggctcccg
   130741 gcagcctccc ttcatctcca gcaggaccag tttctggaga acgtagcgag cgtagctggc
   130801 ggctgtcatg gtgacggctc gggaaaacat atccttcagg ttgggtacaa agtagttgtg
   130861 aaagttggca taatgcacaa aggttgtaac aatcaccagg gaatagtccc cgctttgggc
   130921 actggttaag gatgggtaac taaaaggccc cctcagatcc ggcaggtcct tcgtcttgcc
   130981 aaagatcagg ctcaacacat gctcatctcc cttctcggtc actcgcttgt aggtgcccat
   131041 cagaaattta gaagtcatgg cccccgtgta ctgaaacttg tccccgttga tggacagggc
   131101 cacataagac aagtgacagc gcagctgata aaagacatag ctgtgtggcc gcgtgttggg
   131161 cagcatggtg ccaatatagt agaagagctg cttctcaagg ggggcactaa gcatgcaggc
   131221 aggggaattc aggccgctaa tgactccggg atggacctta gatgcatcca cttgcatgga
   131281 tccttcagag acagcaggga tatcgacagg ctcggccagc gcaataccaa gggtaccaga
   131341 cgtcttgtaa attaacttgt agcggttaag catagacgcc aaatcttcgg tgacatttgc
   131401 ctctctccac agcgcctctg ggctaaggcc tgggaccttt gccatcagtt cggtccatgg
   131461 gatggtgtaa tgcgaagcat gcccctctat gtccaggtgc agcttaacct cgctgagact
   131521 ggcagccccc acctcccata gcaacaccag gcaaaaaaca cagagcaact gcatcctagt
   131581 cccgatttcc cctctcaaaa tcagagatca ccttgctcag accagcccaa tcgaaaaact
   131641 gagatcgtat tgccggattc ttcaatgcct gcatgtaaat ctccgtccag catccaggta
   131701 aatcgtcctg aaactctgag aggtccacaa gcacaaactg aaggtaggct agcgttcggg
   131761 tgaacgcaag acaaacttcc aacaacaccg cgtcggctcg gaaaggctgt atgacttcct
   131821 taagtacact aaagatgctg ttcttataca gcttctcggc cacaccactt cgaattatgg
   131881 gggtgtggct ttgatgacat actgtcgtga ttgttgttag accggcacat accttcacaa
   131941 tgtcctcggg ggcaaaatac tgtgttagga gccaggcaca gtaaacggcg tgatatgcat
   132001 cgttgacact cttcaggtag ccagcatcca gtcctgactc atgtttcctc cctcgcttct
   132061 tcaggcggcg catgttctcc tccacgttta acttcatcca gactatggtg tcccccgggt
   132121 ctgcggtaaa cgtggccaaa acttgaataa agtcactata ggagagaagc tggctccgga
   132181 gcagcattag agggaaaacc acggaggccg acagcaaatg gcgatcatgc aaaatccaac
   132241 aatccagggg cgcgactgac ctggcaccag actcggtaac cagcaagctc cgcttcctag
   132301 aggccaagac tctgaaaggg gtagtaaatt tcatctggca tgctaaaacc tcagccgacg
   132361 tgtcttccct tccatgcctc gcccgagtca cattcttgtg catggcctta atggcatttt
   132421 catacacatg agtccagtac cgcatcggtt cagggactac aatggtcagg tccccaaaga
   132481 cagccttcaa atgattcagc atagtagtct ttcccacacc aggggcacct tccaaaaata
   132541 gggaacaggc aggtttgatt actggtacat gatttgtcag gtgggtcaca attggaaccc
   132601 gcgtgctctc cttcctctga gccttggcct ggcgggtgtc ttgggcatca tccagattca
   132661 gaacattcat cacactccca cttagccgct tcagctgggc agcatgcttg gataacttac
   132721 taaactcacg cccatgggcg gccaggtgtt cgaagagacc agaaggctta cccttgccac
   132781 cattcttttg ttttaacgcg gaatgagaag agggcctgcg gaaattagac tcatcctcag
   132841 actcacagtc agatttgtca tcaagcccaa ggccggccag gccctcctca aagcctttct
   132901 ggtacatgaa gctccggctc gtggagtccg cacctccttc tgtgcacgaa gttttgcgga
   132961 accaggagaa ggggtctggc gtcttgctgg ggccacactc ccggctacgt ggcttcgggg
   133021 taggggcagt aggcttttgg tgtgcgggtg ctggtggctg ggctcccctg ggtagggtaa
   133081 aggggcacga tgtgtgccgg ctacccggag agtttccagt attagatgtc acggcagcct
   133141 gggtccggca cggcaccctc tccccagaca gtccggtcgg agccatcaag gggggccagt
   133201 gggtgggcac ctggtagagt ccgtcatcat cttcctcacc tgcccctgag tcactgccgg
   133261 ttggggtaag aactgagggg gcaaagtcat caatctcagc gtaaaagttt tcgtgtcttt
   133321 cgttttcagg ggactcatcc tcctgacatt ttcgccagcc gccgggcggg ccggcctcct
   133381 ttcctggaaa tccagccatg gatcccaccc gaggtctgtg tgccctctcc acgcacgacc
   133441 tggcaaaatt tcacagtctc cccccggcta gaaaggcggc aggtaagcga gcgcacctta
   133501 ggtgttactc caagctgctc tctcttaaga gctgggagca actagcctct tttttgtctc
   133561 tgcccccggg acccacgttt acggacttta gactattttt cgaagtcacc ctgggtcgga
   133621 gaatcgcaga ttgcgttgtg gtagctctgc agccttcccc ccggtgttat attgtagaat
   133681 ttaagacggc catgagcaac acggccaacc cgcaaagcgt tactcgcaag gcacagaggc
   133741 tagagggcac cgcccagttg tgtgactgtg ccaattttct tcgcacgtcc tgcccccccg
   133801 tgctgggcag tcagggcctg gaagtcttgg cggcgttggt atttaaaaac cagcgatccc
   133861 tgagaacgct ccaggtagag tttccagccc tgggccaaaa gaccctcccc acctccacca
   133921 ccggcctgct aaacctcctc tcccgctggc aggatggcgc tctccgggca cgtcttgata
   133981 gaccccgccc gactgcccag ggacacaggc cccgaactca tgtgggcccc aagccttcgc
   134041 aactcactgc gcgtgtcccc cgaagcgctc gagctggcag agcgggaggc cgaaagggcc
   134101 aggtcggagc ggtgggacag gtgtgcccag gtgctcaaaa ataggctgct ccgcgtggag
   134161 ctggacggca tcatgcgtga ccacctggcc agggcggagg agatccgcca ggacctggat
   134221 gctgtagtgg ccttctctga tggcctggag agcatgcagg tcaggtcccc ctccacggga
   134281 gggcgctctg cgccagcccc gccctcccca tccccagccc agccgttcac tcggctcacc
   134341 gggaacgccc agtatgcagt ctcaatctct cccacggacc cccctctgat ggtggccggc
   134401 agcctggctc aaacgctgct tggtaatctg tacgggaaca tcaaccagtg ggtaccgtcc
   134461 ttcggaccct ggtacaggac catgtcggct aatgccatgc agcggcgcgt gttccctaag
   134521 cagctgaggg gcaacctgaa ctttaccaac tccgtctccc taaagctgat gacagaagtg
   134581 gtggcggtgc ttgagggcac cacccaagac tttttctcag acgtcaggca cctgccagac
   134641 ctccaggctg ccctgatcct ctcggtggcc tacctgctac tccagggggg ctcctcacac
   134701 cagcagcgcc ccctccctgc ctcacgggaa gagctgctgg agctgggccc ggagagccta
   134761 gagaaaatca tcgccgacct caaggccaag tcacccggcg gaaattttat gattttaaca
   134821 agcggaaaca aggaagcgcg ccagtcaata gcccctctca accgacaggc ggcatatcca
   134881 cccggcacat tcgcggacaa taagatttac aacctgtttg tgggagcggg actactgccc
   134941 acgacggccg cgctgaacgt gcccggggcg gcgggtcggg accgagacct ggtgtaccgg
   135001 atcgccaacc agatctttgg ggaggacgtg ccccccttct catctcacca gtggaacctg
   135061 cgcgtaggtt tagccgcact cgaggccctg atgctcgtct acacgctctg cgagaccgcc
   135121 aacctggccg aggcggccac ccggcgtcta cacctatcgt ccctgctccc ccaggcaatg
   135181 cagcggcgca agcctgccat ggcgtcagct ggtatgccgg gcgcctatcc agtccagacg
   135241 cttttccgcc atggggagct cttccgcttc atctgggccc actacgtgag gcccacggtg
   135301 gcggcagacc cccaggcctc catcagctct cttttccccg ggctggtttt gctggccctg
   135361 gagctgaagt tgatggatgg gcaggctccc tcccattatg ccataaacct gaccggacaa
   135421 aagtttgaca ccctctttga gattatcaac cagaagcttt tatttcacga cccggctgcc
   135481 atgctggcgg cacgcacaca gctgcgtcta gccttcgagg acggcgtcgg tgttgccctg
   135541 gggcgcccct cgcccatgct tgcggcgcgg gagatcctgg agcgtcagtt ctcagcctcg
   135601 gatgactacg accggctgta cttcctgacg ctgggctacc tggcctcccc ggtggcccca
   135661 agctgagcca gttcctcgca ctggagtggg tcattggcaa aaaggtaaat aaagtcatcg
   135721 cacgggggtt ttgcctcctt ctcgtctctt gtttcgggta ggggagtaag gccgtgccag
   135781 gccgccatgc tcagggccac ggcgtgccag aggccctcgt agtcgtgcgc atccgagagg
   135841 atggcacggt ccagaagcag atagccggcc aggcagagga aggccacgaa gagggggcga
   135901 aggcgtgccc gaacccgggt ttcatgctcg tctgcacccc agtggacaag gcagtagagg
   135961 acacccacca ccaggcggtt agggaggaca ctgccaaggt tgaagagcag atttccgtca
   136021 gccagggtga cctggctcag gtccggcgcc ctgcgcagtc caagctgcgc ccacacacat
   136081 gcacagacgg cccctgtgac atcaggccgg tcatgcaaaa acagacaaag agaccgtgag
   136141 cggttaccgg ggcgcagggc ctctgccggg aagcccaccc gggccagggc ccggtaaagc
   136201 aggtaccagt attcatccgg caccttgcgc gccagcacac gattcgtgcg gtttccagta
   136261 tttatcacgg cttcccgcca caggtaaaag ttaacactta gggtcagcag cttggtcagg
   136321 gataggtgca aaaacctgag ctcgtcctcg cgcagagcgc aaagcggcca gttctttagc
   136381 atcttcagga ggagcccgtg aatcccaggt gtcattcgcg cgtcatcccc gcgcaccccc
   136441 agtcccatta acatagcggg cacaatggtg caggcaccgt ctgtatacgt ctgcggcttt
   136501 gtggagcgcc cggacgcccc acccaaggac gcctgccttc acctggatcc cctcaccgtc
   136561 aagagccagc tccctctgaa gaagcccttg ccactcacgg tggaacacct gccggatgct
   136621 ccggtcggct cagtctttgg cctttaccag agccgagcgg gtctctttag cgcagcctcg
   136681 attacctctg gggtcttcct gtccctgctg gactcaattt accacgattg cgatattgca
   136741 cagagtcagc gcctgcccct ccctcgagaa cccaagttgg aggctctgca cgcctggctc
   136801 ccctcactgt cactggcctc cctccaccca gacatacccc aaaccaccgc agatggaggc
   136861 aagctgtcct tctttgacca cgtgtctatc tgtgccctgg gtcgtcggcg cggcaccacg
   136921 gcagtctacg gtacagacct tgcgtgggtc ctgaagcact ttagtgacct ggaaccgtct
   136981 atcgccgccc agattgagaa tgacgccaat gccgcaaagc gtgaatccgg atgcccggaa
   137041 gaccaccctc tgcccctcac gaagctcata gctaaggcca tcgatgctgg atttctgaga
   137101 aaccgcgtgg agactctgag gcaggacagg ggtgtggcca atatcccagc cgagtcgtat
   137161 ttaaaggcca gcgatgcccc ggacctacaa aagccggaca aggcacttca gagcccacca
   137221 ccggcctcca cagacccaga caccatgcta tcaggtaacg caggagaagg agcaacagcc
   137281 tgcggaggtt cggccgccgc gggccaggac ctcatcagcg tcccccgcaa cacctttatg
   137341 acactgcttc agaccaacct ggacaacaaa ccgccgaggc agaccccgct accctacgcg
   137401 gccccgctgc cccccttttc ccaccaggca atagccaccg cgccttccta cggtcctggg
   137461 gccggagcgg tcgccccggc cggcggctac tttacctccc caggaggtta ctacgccggg
   137521 cccgcgggcg gggacccggg tgccttcttg gcgatggacg ctcacaccta ccacccccac
   137581 ccacaccccc ctccggccta ctttggcttg ccgggcctct ttggcccccc tccacccgtg
   137641 cctccttact acggatccca cttgcgggca gactacgtcc ccgctccctc gcgatccaac
   137701 aagcggaaaa gagaccccga ggaggatgaa gaaggcgggg ggctattccc gggggaggat
   137761 gccaccctct accgcaagga catagcgggc ctctccaaga gcgtgaatga gttacagcac
   137821 acgctacagg ccctgcgccg ggagacgctg tcctacggcc acaccggagt cggatactgc
   137881 ccccagcagg gcccctgcta cacccacccg gggccttacg gatttcagcc tcatcaaagc
   137941 tacgaagtgc ccagatacgt ccctcatccg cccccaccac caacttctca ccaggcagct
   138001 caggcgcagc ctccaccccc gggcacacag gcccccgaag cccactgtgt ggccgagtcc
   138061 acgatccctg aggcgggagc agccgggaac tctggacccc gggaggacac caaccctcag
   138121 cagcccacca ccgagggcca ccaccgcgga aagaaactgg tgcaggcctc tgcgtccgga
   138181 gtggctcagt ctaaggagcc caccaccccc aaggccaagt ctgtgtcagc ccacctcaag
   138241 tccatctttt gcgaggaatt gctgaataaa cgcgtggctt gaaagtaaac tttattgcgt
   138301 gttagtacct gtccattcac aggggtatcc agcccttgcg ccgcctcccc cagcccgcca
   138361 gccaccccag acaggagatg ataatgatga ggagcaccgg agccaccaca gcacaagtga
   138421 ttaggagcag ggcccagtgc acccaggtgg tcttagggcg ccagggatcg attggaaaag
   138481 ggcccagggt cactggctta tgcgtgggac gtttagaaac aggccgccta tggggcctgt
   138541 gactggtgct tgtggtgtgg gagactaatg tggtgggggc tatggtagtg gctgggataa
   138601 cagtaagatg catacgctga gtgagcgtcc ggttggcatg gtattggtcg tcttcttccc
   138661 ctgcagagta attgcagtgg accccggagg ccacactgca atttctcagc gtcacattgc
   138721 acgtgtagta acctgcatgc gcaagggtca cattggggat tatcagagag acggaggtgt
   138781 tggagtcatt tacccattct agggtaaggc tataattgta acccccgtta gttatatgag
   138841 ttccgttgtt ggaagtagct acggccaagg gcagttgtcc atccccggga gtgtatcccc
   138901 ggcccaactc gatccgagag accgactcat tgctaggaac gctgcaggtg agattcactc
   138961 tagcacctgc atgggcggtg acattttcaa atttaaccag atctgagaaa aatgcacaaa
   139021 cagaccccac acagcagcac aatagaagca ctaaatgagt cattcctaaa ctgtcagttt
   139081 taaaactccc tgcttctcag gcctaaatac gtggtggggt gtgcttagga tcactttcat
   139141 attctgcaac aacagccata cccggaagag gagctgccgg ttgccatttt tcaagctgct
   139201 aaaccacgag tggcagcagg cctaagaagc tcctcagcaa catggagacc tcgaagggaa
   139261 actggcagga gcagggagtc acgtaggcac tagcctcttc atgtgaggta agagatcgct
   139321 aaaaatggga tcagggtatg taaaccgagt tttgcggggg atggtgagcc agacacggcg
   139381 ggtgggggga aggagctgac acgagtgcgt agaaagggcc aaaaatacac cagctataag
   139441 gaattgctca gaccaaagtt gttcctcagg tggctttagg cctaatgtag gcaattgcgt
   139501 gcctagaaca ttgctaatgt gccctgtgtt tcctgccttc atgcaaatat cctacctccc
   139561 ccggcctggt gcaaaatgtc tgcctcagaa tactaacagc taatccaagc taacattcta
   139621 tcagtaaacg ggcagaaaac tgataaggac cgcggagttt ggccctccgc ggtgtccggt
   139681 ggtcctcaca cgtgccctcc cccccccggg ccgatggctg aggcccggaa tatgcaagtg
   139741 catctttcta accagtaggg gcctccacct aggtgctttg ttaatcttta gtgggaacta
   139801 gtgggagtgc tgtgcctagg gtacccctat cctataggtc ctaccggagc tccttgcctt
   139861 gataatccct gtaaacacac accacctaag aacaaggcat cgttaacctt tggtggaacc
   139921 tagtgttagt gttgtgctgt aaataagtgt ccagcgcacc actagtcacc aggtgtcacc
   139981 ggaggctact tgcctcagtg ccacttttac cttctcaaat ctatacgggg ggggggcctc
   140041 tgtaacattt ggtgggacct gatgctgctg gtgtgctgta aataagtgcc tagcacatca
   140101 cgtaggcacc aggtgtcacc agggctactt gcctcggcat ctcctcaccg gagaaggggt
   140161 taacaaaccc gtggggggtc ttagtggaag tgacgtgctg tgaatacagg tccatagcac
   140221 cgctatccac tatgtctcgc ccgggctata tgtcgcctta cctcccctat atagtcacga
   140281 ccccaccgaa ccaggcatga tgtagaataa aattttatgc atcatcttct aatctgtgcc
   140341 gcttggaggg aaacatgacc acctgaagtc tgttaaccag gtcagtggtt ttgtttcctt
   140401 gatagagaca caaggactgc cagccccgtt ggggaggggg tggtgggtac gggagagttt
   140461 gggctcgtct aaacaaagcc tcctctgatg ctctgtggca cctcaaggtg aatatagctg
   140521 cccatcgacg tatcgctgga aaccggtggg ccgctgttca cctaaagtga cgcaaggtct
   140581 gtcagccgcc agggtccgtt taccaggctt tcaggtgtgg aatttagata gagtgggtgt
   140641 gtgctcttgt ttaattacac caagatcacc accctctatc catatcccac aattgataaa
   140701 cctccgcatg tccaaccacc acgttgaaca ggatgtggca ccctaagagg acgcaggcat
   140761 acaaggttat tacccagtcc ttgtatgcct ggtgtcccct tagtgggacg caggcctagg
   140821 tagcatcatt tacactaaaa gcagtgacct tgttggtact ttaaggttgg tccaatccat
   140881 aggctttttt gtgaaaaccc ggggatcgga ctagccttag agtaactcaa ggccaagcat
   140941 ttcacacctg caaatgcacc atgtaaccac agatctaaac tgaaagttgc agctttagat
   141001 ggcaaggaaa cttgggtttc aggcatagaa agcctggctc actatagcag cccatgtttg
   141061 ttccagggtg ggggaaaggc acgtgccctt agaaaactta gctgcaaaaa ttctattgtg
   141121 ttgggagagc ctctatatct aaaggccttt cctcccaata caaatgttac taacatctgc
   141181 cctctggaga cctgctatgt ggctagactt atggcctacc caagacgttg ggggtctcgg
   141241 gtaggccgat tcttccaggc ataggttaca accagtcact gctatcaagc ctactcagtt
   141301 cccaacgcag cacatacccc ccgcctctcc tgccatgagg actcatggca gtgtttactg
   141361 ttctgctttt actcttggac caggccgtca ttctatcaga ataacagggg aagcaatgcc
   141421 ccctgcgtca gcgggacacg tgtttctaga atctcggagc caataactac ctgcccctct
   141481 aatctgtacg ctgcatgaaa aaccacatac acgtgatgta agtttagcca gtttattgtt
   141541 acaccaatgc cccgaaagtc cccccctgtc cctttgggtc tcaggaccca gccctggagc
   141601 tcggggggcg gccgggtggc ccaccgggtc cgctgggtcc gctgccccgc tccggtgggg
   141661 ggtggccggc tgcagccggg tccggggttc cggccctgga gctcgggggg cggccgggtg
   141721 gcccaccggg tccgctgggt ccgctgcccc gctcccgcgg gggggtggcc ggctgcagcc
   141781 gggtccgggg ttccggccct ggagctcggg gggcggccgg gtggcccacc gggtccgctg
   141841 ggtccgctgc cccgctccgg cggggggtgg ccggctgcag ccgggtccgg ggttccggcc
   141901 ctggagctcg gggggcggcc gggtggccca ccgggtccgc tgggtccgct gccccgctcc
   141961 ggcggggggg tggccggctg cagccgggtc cggggttccg gccctggagc tcggggggcg
   142021 gccgggtggc ccaccgggtc cgctgggtcc gctgccccgc tccggcgggg gggtggccgg
   142081 ctgcagccgg gtccggggtt ccggccctgg agctcggggg gcggccgggt ggcccaccgg
   142141 gtccgctggg tccgctgccc cgctccggcg ggggggtggc cggctgcagc cgggtccggg
   142201 gttccggccc tggagctcgg ggggcggccg ggtggcccac cgggtccgct gggtccgctg
   142261 ccccgctccg gcgggggggt ggccggctgc agccgggtcc ggggttccgg ccctggagct
   142321 cggggggcgg ccgggtggcc caccgggtcc gctgggtccg ctgccccgct ccggcggggg
   142381 ggtggccggc tgcagccggg tccggggttc cggccctgga gctcgggggg cggccgggtg
   142441 gcccaccggg tccgctgggt ccgctgcccc gctccggcgg gggggtggcc ggctgcagcc
   142501 gggtccgggg ttccggccct ggagctcggg gggcggccgg gtggcccacc gggtccgctg
   142561 ggtccgctgc cccgctccgg cgggggggtg gccggctgca gccgggtccg gggttccggc
   142621 cctggagctc ggggggcggc cgggtggccc accgggtccg ctgggtccgc tgccccgctc
   142681 cggcgggggg gtggccggct gcagccgggt ccggggttcc ggccctggag ctcggggggc
   142741 ggccgggtgg cccaccgggt ccgctgggtc cgctgccccg ctccggcggg ggggtggccg
   142801 gctgcagccg ggtccggggt tccggccctg gagctcgggg ggcggccggg tggcccaccg
   142861 ggtccgctgg gtccgctgcc ccgctccggc gggggggtgg ccggctgcag ccgggtccgg
   142921 ggttccggcc ctggagctcg gggggcggcc gggtggccca ccgggtccgc tgggtccgct
   142981 gccccgctcc ggcggggggg tggccggctg cagccgggtc cggggttccg gccctggagc
   143041 tcggggggcg gccgggtggc ccaccgggtc cgctgggtcc gctgccccgc tccggcgggg
   143101 gggtggccgg ctgcagccgg gtccggggtt ccggccctgg agctcggggg gcggccgggt
   143161 ggcccaccgg gtccgctggg tccgctgccc cgctccggcg ggggggtggc cggctgcagc
   143221 cgggtccggg gttccggccc tggagctcgg ggggcggccg ggtggcccac cgggtccgct
   143281 gggtccgctg ccccgctccg gcgggggggt ggccggctgc agccgggtcc ggggttccgg
   143341 ccctggagct cggggggcgg ccgggtggcc caccgggtcc gctgggtccg ctgccccgct
   143401 ccggcggggg ggtggccggc tgcagccggg tccggggttc cggccctgga gctcgggggg
   143461 cggccgggtg gcccaccggg tccgctgggt ccgctgcccc gctccggcgg gggggtggcc
   143521 ggctgcagcc gggtccgggg ttccggccct ggagctcggg gggcggccgg gtggcccacc
   143581 gggtccgctg ggtccgctgc cccgctccgg cgggggggtg gccggctgca gccgggtccg
   143641 gggttccggc cctggagctc ggggggcggc cgggtggccc accgggtccg ctgggtccgc
   143701 tgccccgctc cggcgggggg gtggccggct gcagccgggt ccggggttcc ggccctggag
   143761 ctcggggggc ggccgggtgg cccaccgggt ccgctgggtc cgctgccccg ctccggcggg
   143821 ggggtggccg gctgcagccg ggtccggggt tccggccctg gagctcgggg ggcggccggg
   143881 tggcccaccg ggtccgctgg gtccgctgcc ccgctccggc gggggggtgg ccggctgcag
   143941 ccgggtccgg ggttccggcc ctggagctcg gggggcggcc gggtggccca ccgggtccgc
   144001 tgggtccgct gccccgctcc ggcggggggg tggccggctg cagccgggtc cggggttccg
   144061 gccctggagc tcggggggcg gccgggtggc ccaccgggtc cgctgggtcc gctgccccgc
   144121 tccggcgggg gggtggccgg ctgcagccgg gtccggggtt ccggccctgg agctcggggg
   144181 gcggccgggt ggcccaccgg gtccgctggg tccgctgccc cgctccggcg ggggggtggc
   144241 cggctgcagc cgggtccggg gttccggccc tggagctcgg ggggcggccg ggtggcccac
   144301 cgggtccgct gggtccgctg ccccgctccg gcgggggggt ggccggctgc agccgggtcc
   144361 ggggttccgg ccctggagct cggggggcgg ccgggtggcc caccgggtcc gctgggtccg
   144421 ctgccccgct ccggcggggg ggtggccggc tgcagccggg tccggggttc cggccctgga
   144481 gctcgggggg cggccgggtg gcccaccggg tccgctgggt ccgctgcccc gctccggcgg
   144541 gggggtggcc ggctgcagcc gggtccgggg ttccggccct ggagctcggg gggcggccgg
   144601 gtggcccacc gggtccgctg ggtccgctgc cccgctccgg cgggggggtg gccggctgca
   144661 gccgggtccg gggttccggc cctggagctc gggggggggg gcgctcccag gccggaccct
   144721 ggtgccaggc agggaccccg cgccacccgc ttcatggggg gggaggccgc cgcaaggacg
   144781 ccgggccggc tgggaggtgt gcaccccccg agcgtctgga cgacgctggc gagccgggcc
   144841 agctcgcctt cttttatcct gttttttggg gtctctgtgc aataccttaa ggtttgctca
   144901 ggagtggggg cttcttattg gttaattcag gtgtgtgatt ttagcccgtt gggttacatt
   144961 aaggtgtgta accagctggg tggtacctgg aggtcattct attgggataa cgagaggagg
   145021 aggggctaga ggcccgcgag aattggggta ggcggagcct caggagggtc ccctccatag
   145081 ggttgaacca ggagggggag aatcgggctc cgccccgata tacctagtgg gtggagccta
   145141 gaggtaggta tccatagggt tccattatcc tggaggtatc ctaagctccg cccctatata
   145201 ccaggtgggt ggagctaggt aggattcagc taggttccta ctggggtacc cccctaccct
   145261 accttaaggt gcgccaccct tcctccttcc gttttaatgg tagaataacc tataggttat
   145321 taacctagtg gtggaatagg gtattgcagc tgggtatata cctataggta tatagaacct
   145381 agaggaaggg aaccctatag tgtaatccct ccccccccta cccccccctc ccttacggtt
   145441 gcctgagccc atcccccacc ccagcacccc ggggtgacgt ggcaccccgc gtgccttact
   145501 gacttgtcac ctttgcacat ttggtcagct gaccgatgct cgccacttcc tgggtcatga
   145561 cctggcctgt gccttgtccc gtggacaatg tccctccagc gtggtggctg cctttgggat
   145621 gcatcacttt gagccactaa gcccccgttg ctcgccttgc ctgcctcacc atgacacact
   145681 aagcccctgc taatccatga gccccgcctt taggaagcac cacgtcccgg ggacggaagc
   145741 tggattttgg ccagtcttaa attttgggga gtggttttgt gtgagccgga agttggcaat
   145801 ggggtgaggg tggcgctggt taagctgacg acctcccaag gtctctcacc ctgggtacac
   145861 aggtggggcg gcagcctcta actttggctg tggcctctat ttcctccctt tcctagccag
   145921 ggccatgtgt tcctgcatgt ctacttgcct cctgtggtgg cagagcttgg ccctgggccc
   145981 aacccccgcc ttgggagcct gtaggggcca acacccttgg tttgtttgtg ttcctgtttg
   146041 ctggcaactt actggcagcc gagcagattc taatgggcgc ccgccttctt tctctcttgt
   146101 tttattaata gaatctcagc caggacctat acctgagact tcaaagtctg gtcctgggtt
   146161 ctgagacccc caagatttgt catgcacacc tgcacacctg ttggtattgg gtttctattc
   146221 ttgagtgtga aagtttgtaa aaaaattcat aaaatgtcac taattcctct tacctgttta
   146281 gagtattgtg caattcttca gcctgcctat tttcaatttg cctaaggtgg caatttaaga
   146341 tgtggttaat taaccatttt cctgtctgac accactgcat gggcaaccgg gttccatggc
   146401 acatttacag ataaacatag atgtcttgtc ttgctcatgt gcagaggagg gggtgttggt
   146461 gtgcaatata gtttctggat tccaaaatga gttgggggtg ctattttcac tatggaatta
   146521 aattactgac attagacagt ggacaccggg ctatatgtgg ggatgtctgt ggcttgtcat
   146581 ttcctcttag aaggtaatcc cccatcttaa cttcccttta aattgtgatg caagccctgg
   146641 gttatttata gaatgattat ctaggtttga tagtctgaag gctgggcaga gaatgtttgt
   146701 aatttttatt caccttcttt accccccacg agtatccagt tctagaaaat ctcctgatat
   146761 cccgggctgc cattattccc ttgagtgtta tagcttcctc ttaacttaag caagagctcc
   146821 aggatgttag cttttttggt ggggctggtt gtcaggaaga ggttccagtg ttgtccttta
   146881 tttttagatg ttagctttgt gttgggttag tatgggctgg gtattcacta gtgaaggcaa
   146941 ctaacacagc tagacgtgct agttgtgccc actggtgttt atccggtccc aaatgtcaca
   147001 acagaacaca ggaggctgga tttggcagca gcacgtgtgc ttttgttgat ttttaccctt
   147061 gtatcagagt gggggatgct tctggttcct ggtcttctct gtgcacaaaa aggggccaat
   147121 ggccacggcc ccgcggcttt ttgtgccggt gcggagccaa tttagcttcc cctcccctta
   147181 gcggggggtc tcgcggggtg ccaattgtcg cctgccttcc cctgcttccc cttgttaact
   147241 tatagcatga taggtaggtc acctaacgtg gaagcctggt gggtgatcct tcctcggtag
   147301 ggagcgctta gggctgttga gctcaacagc cccacctggg taaaatgtat gttctaaaga
   147361 gttacccaat tataacaaaa ctgttgtagg gtaacgaaga cctgatggaa gtggtattgt
   147421 tgccgttgaa agacgggtgt cctggctcaa gttcgcactt cctatacagt gttaaagcct
   147481 tgtatcggaa gtttgggctt cgtcccagtg tactcaataa tgtcgactgc tgcgaaggtt
   147541 tggaccgtct tccagtaggt gttgggggtc ccaaatcacg aggttaggca ggtgcactta
   147601 gctctttagg agggaccctt aagccaggca atgtagtgcc cctttttttt gcaaattggc
   147661 cttattatta aattcttgtt aacactaatt ctgttctatg accctgtgtt tttcagatgc
   147721 cgttggacgt gtcactgagc tgattttgga cgcagctact tgacctttgc ccccgtgcct
   147781 ccaacgccga taagtgctgc ttccactttg tgttacaggt gggccaaacc tccagaatat
   147841 caagtggtgg ggccttggtg ggctgcataa ggcagtaggt tttaggtgac ctacttggac
   147901 catgtggatc cagtgtcctg atcctggacc ttgactatga aacaattctt aaaaaatgca
   147961 tcatagtcca gtgtccaggg acagtgcact cggaagtctc atcatctccg tttgtgtgtt
   148021 tagtgtggcc agtacggcca ctcctgtgcc acgccctggc atgctgctga catctgggcg
   148081 ccaatttcag cgggcccttt tcccccttgt tcaccccata gcaagaaggg taggttacat
   148141 gggtattttc ccatcagcac ctgactggcc ggtgtaatta gaggagaggg caacaacgca
   148201 aggctgttgt tttatttggg ttacaagagc tgcggtggtc gatgggttca ctgattacgg
   148261 tttcctagat tgtacagatg aactagaact gtcacaatct atggggtcgt agacagtgtg
   148321 cttaccagac ttccatggaa gatgtgaatt tgctgctagc tatatgggtg gtgctatggg
   148381 ctccctaggg actcatgtag tggggctttg tgatagctaa tgaatgtggc agctgttgtt
   148441 tgtactggac cctgaattgg aaacagtaac ttggattctg taacacttca tgggtcccgt
   148501 agtgacaact atgctgaata tcttgaatat gggaggaggg gggctttggg ttccattgtg
   148561 tgccctttcc tggccaacgt gagggtccta gtgttatagg gcgtggcagt tttcttgagg
   148621 gctaataacc cgggtgaggc ggttgtcaca ggtgctagac cctggagttg aaccagtacc
   148681 actcggttac aaagtcatgg tctagtagtt gtgaccctgc aaagctacgt ggggatgagc
   148741 agccagggac tttggttggc aagcagacag gcggcgcatt ggaaccccag aggagtgtcc
   148801 cggggccacc tctttggttc tgtacatatt ttgttattgt acataaccat ggagttggct
   148861 gtggtgcact ccatctggta agggggctgg tgcggacgcc tgtgtttagt ctatgccaat
   148921 gtttacctgc cttgggttac tattccaaac gaccacacct ttgaggacac ctggagccct
   148981 gatcattctc ggcttttact gccacctggc ttctgttggg tcagacagtt tggtgcgcta
   149041 gttgtgtgct tagcagcaac gcacaccagg ctgactgcct tagcagtgtg gccctttatt
   149101 gtggcatcct aaggagggat tctggagtgc ctttcgcgtg aagcatgccc tgagacgtac
   149161 tcgagttagg acttaatcgc tcctgtgccg ctggatgagg gagcgccaat ttgtacatcc
   149221 tagctctggc catagagtta gcccaccctt gtgtctccct ttggcctttg cggtgccaat
   149281 ttccggtggt ttcccttttc cgcccgttta tccaatagca tgtaagagag gttgcctaga
   149341 tttggcaact ttgagggaac gttccgtgta gctggtgacc taacacccgc ccatcaccac
   149401 cggacagatt ctgaacttgt cctgtggtgt ttggtgtggt tttggggtac gcaggagtac
   149461 gttggaatgc tttggagccg agagggatgg gcccgcttgt gcgcttatgt gttacacggt
   149521 gccaataacc ggcccggtgc ggctgccccg tgacccgtgg gccttacctt cctggccatc
   149581 gggggaccct ggtgctaggg tcccttgtgt tgctttctgc catagggggg aaagcatcgc
   149641 cttcagaatt ggctgctccg ttggaacatt tgaggcctac tgtatccgtg tcctgacaac
   149701 attccccgca aacatgacat gggttaattt aaacatgttt tgtttgcttg ggaatgctct
   149761 tagggcctgg aagcttgtca ttggattcat cgtttcctga actacaggcg tagggcctat
   149821 tgtagcaggc atgtcttcat tcctgcgtac cgaatggcat gaaggcacag cctgttacca
   149881 ttggcacctt ttttccatgt aaacctccgt gatcctgggt cctttggaga ctcaagtgtg
   149941 aatttgtttt ggtgttcggc gccagggcat ctcgacgttg gaatgtcaac tcaacttggg
   150001 cacctcgata accggctcgt ggctcgtaca gacgattgtt tggctctgta acttgccagg
   150061 gacggctgac gatgtgttta gtctgccact tgcatccggc gctttggtta cacgggagac
   150121 taatgggggg tgtggtatgg cacaggctgg gggtgagtct ggggatgtcc ctgggcgttg
   150181 ctgcagccca ttcgccctct ggggatgaga tgttcagggg tggccggtac cctacgctgc
   150241 cgatttacat aatataaatt gtaaatgctg cagtagtagg gatctggacg cgcgacctgc
   150301 tactcttcgg aaacgccaac ccaggagcgt cgcctctggc cccatactcc cgccatgcga
   150361 ctgctcgccc cctcccaggc ctccctggtg agcccttgcc gctccccgca ttcctgcttt
   150421 cggcgcccct gcggatcccg atgacagcag gcctttcctt cccccgttaa tgaaaagaat
   150481 gacagtgagg ttgtgacaga aggacagctt tattcagttt acagagtgcc ctcggaggct
   150541 acgatattcc cgttaaatgt cttgttgatt ctctcaaagg tggggaggga ggagctctcc
   150601 acaacaatgt tccctggcag cgtgagcgcg cagccctgcc gttggatgta tcttctcatg
   150661 atggtgctga tagaggggtc tccggcgtag atgaaaaagg cctgggccat gctctggccg
   150721 gtcacgatcg ttatggggtt gttggaaatg ttccggaccg tcagcttgag ggtctggccc
   150781 ggcttccact cctgtgggta gacgtagaag accgggttgg aggagtggga cacgacaacg
   150841 gccgtaatct tggagctcag gggggcctcg taggtgttgt tgtattccag ctccgtgatg
   150901 aaattaggag gaataatcac aggggagcca aagtagcgga tgtctgtgga ttccccgtcc
   150961 cagcgccagt ggctcttagg gtaggggttg taacggaagg caataatcac atcatccaat
   151021 agggtcatgc ccaccttgac gttcagcggg ccctctcgtt tcaggtccgg cgtgtccacg
   151081 gagactcgga cgtagccctt accgcggcgt atggcgttga ccggacacac cttccccggg
   151141 aatgtgtgaa tacgggcgta tgactttaga aatgggggcg tgtgctgcgc cagcaggtaa
   151201 ggcaggcact cgtcctggct ggtgacggga gagccactga ggaagatctg gggctcgctg
   151261 gtgtttagct tgtccccact ctgggtgcag gagcgtgtca gctgaatgtc gctctgcccg
   151321 ggcagaatct gcaggtagag gtaggggttc ttgaccaatc tgatgggcac aatgtaccag
   151381 gtaaacttcc ctttctctat gaacaggctg cgcggattca ggacgcttag cacgatgtcc
   151441 tggtcagagt gcataacgaa gaagggcttg aggaatacct cgttgtcttc cgctccaaag
   151501 aacaagaacg caaccgtaaa gtagcggctg ccgtaggtgg tcgtgttgaa ggagaaagaa
   151561 ggtaacttga agctgagtat ctggcccacc gaggggcagg gaggcagctc ttggcactgc
   151621 gcgtccagct gcaatacctg cttgttggtg acgcgaacgt atgaggggaa gatctcgtac
   151681 ttccacacgc ctctcatgaa cgacgtgtct ggtttttcag tgggccgcag gcggcggagg
   151741 ctgttcctga acgacgagcg ccgggacgct agtgctgcat gggctcctcc ggggtaagct
   151801 tcggccatgg ccggagctcg tcgacgggca aggtgagagt cggggggcgg gcgacggtgc
   151861 ggccccaata caactctccg ctcgttagct ggtagaatat ccgcccggcg tctaggttgt
   151921 cacttcgctc ggccggccag aagagcgcaa gtccaagtct ggtgctgggg ccgatgtgca
   151981 gcggtttgtg cccgcagttg tagactgtca tttttatggg cgagtgggcg gtccacacgc
   152041 gcgggcgcag cacccattgg tcgcacgccg cctcctggaa tgtaaacccc cagagagagg
   152101 gcgtgccgcc ctggagatgg ccctgtgcca tcacatgtat ttcctccttg ggtggaacga
   152161 cggcgtcgtg ctccgggtgg agggggaata gcgtccaggc atctttcagg gtcacgagac
   152221 cggggtccat gcttagaaaa cagccctccc gggcggtggg cggcccgggc tccagcagaa
   152281 cgtcgcagac ccagccctcc tcggccctgt ccacctgtat gtccaggtgc acggacccgg
   152341 aggctgcgtc tcgtgacatg gccaggcctg gtgccagccg accacgtccc gtgtcccagc
   152401 cgaggccgcg ccagagcaga gcccgggact gactcagggc cacatcccct cggcccgcgg
   152461 acgctgcctc gccagccccc gggccttcat gggcccgctt tctacctctc tccggcaccc
   152521 cagcctggtc agccgcagag gaagcatgac cttggggtgg gacggggcag gcgtgatcct
   152581 gggcgcaatc tttaccgatc cccacacctt cactccttgt tagtttgata gaatgtcggt
   152641 accacgccac ggggggcggg cccgcatagg gaaaagccag ggagagcgat atgggcgagg
   152701 atgggctcag gcggccccag acacgcaatt tgcccccctg ggcggccgca gcctgcccct
   152761 cggcggcccg tgccccagct ccgtcacggg gggcgcatag gaggggtata tctaggatag
   152821 ccgcacctac acaaatgaga cacagacaca ggtcgtgagg atttaggcaa cgcaggcttg
   152881 tctttatagt tacaaacatg ggagcgtgca cctggaagat gcagctgggg tagatcttta
   152941 catctttaca gggcgcagcg gccgccagac actgaagggc agagttcacg gcgggcacct
   153001 cccagaggga gcccaccagc ccgtacctgg ccacggccag ggcctcgtag gccgagacgg
   153061 gcagccggag cttgtggtac tgtccctccg gcaggtggag tgggacacag ttagagaaca
   153121 ttagtcccct ggtccctatc tccacccgcc aggcatgtgt gtcagtttgc agggccatcc
   153181 tcgcgctcag gtggactggc taggcaccct tctgaagtat ctggcggtga ctgtcacctg
   153241 gttcttgaga gagtccataa aatggctgaa gctccaggcg tatagtataa tgagcaacag
   153301 ggccagacag gcggcggggc ctgggtagta gcgggcaacg agagactctg tgcaatcaaa
   153361 ccccaggctc ccggcctcac ccaggaagag cagcggcagg gacagcataa accaggagaa
   153421 ggcgcagatg agtccggtga aggtgacgtt gcatatcagg cgcggcttcc ttccgaattt
   153481 tgtgcgcaaa agtttccaga tgatgatgac tgtgaggagg acgatcagga ctgccgccag
   153541 taggtagcag ccggctttca gtccttggac ggccgtgtgc atgcctttgg tggggccttc
   153601 cctgcacatg ttggggcctc tgttgagatt ggcgtcgggg cccatggtaa tgaggaggat
   153661 gataatcagc aggagtacca gacaaaacac gcccatcagg tacaggcaca catttctgtg
   153721 ggaggttcgc ttgggcgttc ggctgaacaa tgctagggtc ttctccaacg ccatacccaa
   153781 gtgagtccat acggagcaca tcaggcccaa gaacatcatg ttctgggtca aaaggcagag
   153841 accggtagac gagaactcct gaatcatttt tcccagcacc cagagcagca gttctatgag
   153901 aagagctatc agccagacat ccattcggtg aaccaatttt cttacaaaga tgataaacaa
   153961 gatgccagcc agtgttagca gaatcagcag gacgagcagc aggcttgtca tgccgctgag
   154021 gaaggcgctg taggatttag tgcacgcatc ttccgttgca ttgacggaag tcatgttggc
   154081 caccagggtc cccacagtgg acccgggggc catggtggag agcatcttgc tggtcagagc
   154141 cagactgggt ggtgtctgca gcaaaagagg aacttgccca ggcagtcagt tattttgcat
   154201 gccacctccc tgcctggtgg acttccagac tattttctgc attcgccctt gcgtgtccat
   154261 tgttgcaagg agcgatttgg agaaaataaa ctgtgagttt cacagatcca cgggccacgc
   154321 tcccctgggg gcttcatgat cccaccgcct ttcccgatga tgatgacaac cgcggctgtc
   154381 tgaagcggct gacgaaatcg gttgagattc tgatgagagg cttggggggg tctttgccct
   154441 caaggcgagg ctccttctcc taggaatgcc gagccccctg cactagcttc gctccactgg
   154501 ggatctttgc cagccttcat actagattca gcgatccccc ggttgggaat cttcgccagc
   154561 cccccgtcct gctatcccgc tcgtcgccgc gcctcccatg ctaagggccc ccttcctttc
   154621 ccttgacttt ggggatattc ggagtctgct ctcgccgctc tcttctctcg tttaaacgag
   154681 agaatagtag tagggtccag tctcaggccc cctcactttg ggtcttagaa tggtggccgg
   154741 gctgtaaaat tctggaggac ggagagggcg gccccggagt tgttatcaaa gaggcactgg
   154801 aggatgttgg ccgctccttg gagcagcttg tcgaaataat gatccacggc cacgggaacg
   154861 ccgtgccgct cggcgtaggc cgggtcctcg gccatctccg tctttctcgc ccccttcact
   154921 ccccccttgg gctccacaaa gacgtactgg atgcggtcgt ggatctgggg cagttcctcg
   154981 ttgcgctcga cgaacttctg gtagacggcc aggtgaggca tctgggtgct cttgtaggct
   155041 gagagcttgc ggctgagctc cgttgaaaag cagagctccc ccatggggac cctgccttca
   155101 cggaggtctg tgtaggcctg gtttaggatg tcaatgacgg gcaaaaagcc cacaggtagc
   155161 ccttgtgtaa atgactcttg gaagggccgg tgggagagga ggctggccgc ctcctttacc
   155221 cgggcatccg ccagcaccag gtcgagcacg cgccggcagc gtgtctgcac aaacttgcag
   155281 gccgtcttcc ggacgagctc cacccccttc atcagggtct tgccgtccgt cagcaccccc
   155341 acatatctct tctttgtaat cagcatcagg caggagaagg tcttctcggc ctccagggag
   155401 atgggggcca caaacaggct ccgggtggtg tgggcggcca gggcctcggc aaagcgcagg
   155461 gtctcgctct ctgaaaaccc ccggcactcg ataaacagcg agtccgtgtc cccgtagatg
   155521 actcgaagct ggccctcggg gttgaggggc gcccaggcgt ctggggaggg ggccagggcc
   155581 tgcaggttgg cggggctcag ggcctccacg aaggccttgg cccgctccaa catcgtgcgg
   155641 ccctgcagcg tcaccgtctc ggcgatggag aggcagggaa agaggccgtt ggccaccccg
   155701 gtgaagccgt agacggcgtt gcacgtgcac ttgatggcca gctgctgctt gtcgaggatg
   155761 gtcctttggc gcggatcctc gcaggccgcc agcagcttct tgatggcctt gcgcttggcc
   155821 agccaggagg tcaacagact agccaagaag gactcgtgca cgtgcttctt cacaaagtgg
   155881 tagacgcccc ccgtgagcct gaaggactca tagtcttctc ccgggcgcag gccggctagc
   155941 ctgtgctctt ctcccggcgt tatcatggta gaataacaga gattatgagc ctgaatgatg
   156001 ctcgggtaga ggctggcaaa gtccaccacc agaaccgggg agttgtagaa tccggacagg
   156061 ggctggatga cggtggcccc ctggtagccg tcccggtcag aggccgaggg catgggcagg
   156121 ataaagtttt ccttttgggc ggccgccagg aggcaggaga acacgcggat ctgctgccca
   156181 tcgtccagca cccgcctgca ggggatgtga gcgatcttgg caatctctgc cacctccacg
   156241 tggatcacga aatggtttag cagatccatg accagggccg agtcctgcac gcagtacatg
   156301 ccgagccgcc tgcgcccctc ggggcccgct gcaaagaggc gaggaatctc cttgtaatgc
   156361 acatcctcct tcttggcccc cagtaggtgc ctggctactg tgtccagctt gtagtctgag
   156421 agactgagct tgtcccggca cacggcgtac atgtctatgg ggatgaggcc ggtgatgcgg
   156481 accttggtgt tggcccgcaa gaagcccttg cccgcatcat ggggtcgcct gacctcgcag
   156541 acgcccccag ccctaatttt gcccagagag gctgggttga tgctgtagat gtgcctggct
   156601 ctgtccagaa tgtagggcca gtcaaagttg gccacgttgt agccggtcac aatctccacg
   156661 ctgaggtctc tgatgagctg gaagaaggcg tagagcatgt ccagctccga tgggaactcg
   156721 tagacctcaa ccccctctat gtcttcgcag gtgcccagcg tcagcaggat gcgcctatag
   156781 cgcccggcct cctcccctgt cgaccagaga acgcaggata tctgcaggat caggtcagcc
   156841 tcgttggtgg ccgtggggaa gccctcctcc cctagacact cgatatcgaa ggccagggcc
   156901 tggtaggagg gccaggagct gtcttcacgc cggaccgaga ggtcgcccac ctcacagtcg
   156961 tactcgagct cggcgtacga gtcccggtgc tggaggcggg ggatggcgcg gcggcagctg
   157021 taccagccaa aggtgacaaa gtcattgtcc aggacaaagc ggcgcgtggc atccacgttg
   157081 gcctcaaaga tccgacaccc gtgcttgtct tgcagccacg tggccacgtg acacacactg
   157141 ttgggatggg agagggtgat cttgtggtag tcgccggcat ggttgccgta gcccataatg
   157201 gaacggcgcg tgaccttctc caccgagacc cggcaggggg tcctgcggtc gaaggtgctg
   157261 gccttgaggg cgctgaggac tgcaaactcc acgtccagac cctgaggcgc gctggcgtag
   157321 aagtaggcct gctgcccaaa cacgttcaca cacacgctgg ccccatcggc cttgcgccgg
   157381 cccagtagct tgatgacgat gccacatggc accacatacc cctgtttatc cgatggaatg
   157441 acggcgcatt tctcgtgcgt gtacaccgtc tcgagtatgt cgtagacatg gaagtccaga
   157501 gggcttccgt gggtgtctgc ctccggcctt gccgtgccct cttgggcacg ctggcgccac
   157561 cacatgccct ttccatcctc gtcacccccc accaccgtca gggagtcttg gtagaagcac
   157621 agggggggct gaggcccccg cacatccacc acccctgcgg cgcctggtgt ctggaaacac
   157681 ttgggaatga gacgcaggta ctccttgtca ggctttttca gaaggccttt attaggtctt
   157741 aggaaagggt tatagaagag tcccccagac atggttaaaa ctcagtctct gcctccccaa
   157801 gcagtgcggc ggcggtctct ggatcgtgat agcgtcttct gcgtaggcct ggaaaacggt
   157861 ccctggctgc ctgcaatgct ctgctggcca ctgagggtcc ggccgccctc tgagctgctc
   157921 tcttttgctc ctggttttgc tcatgcagcg ctaacatgat ggcttgtaat tctgtcttac
   157981 taatgggatt aatgcctgga ccctcaccag aggcatgttg ctgagcgagc tcgtcgatcc
   158041 cggggtagag catctgcacc ggctgctgcg acatctggcg cgtgcgcctc gtgagggaaa
   158101 taaccaggat caccaccccc gccaccagga ccagaatgag catgccgccg aaggggtttt
   158161 tgaagaagga gatgaaacca gagaccaggc tgctaaacaa accccccacc gtgctgacta
   158221 ggttggtgat ggactgaccc acgctaccca gactgtccat aagttccccc aggccgtcca
   158281 cgaattgatt tcttccgttt gacactgcat tgtccaaatc cttccgcagg ccggcgatgt
   158341 tttgcgcctg gaagttgtac tcccggaaga tgccctccag gtcaaagacg ttggaggcac
   158401 gctgttcgtc ccgtgagtac agctccaggg aggcaaagtc aatgttctcg atgagggagg
   158461 tgtttagtga gatgaaggtc tgcagggtgg caatgccgtc cagctcgatg gttttaaagt
   158521 ggtggtagtc gttgtagacg tggatctcgt tgccggactg gaagtagtac tggctggtcg
   158581 cctggcacac ctccgtcatc ttttttgtga ggaagatctc gttgtcggtg cccagctgtc
   158641 cctcgtaggt cttggtgtcg ttgataaagc tgaaggacac cagggggcgc gagtagcaca
   158701 tggtctcgga gccagggacc ctcatgctct tgcgcagggt gacggtggcc tggttaacgg
   158761 gcacgcactg ggagactgag atgacatccc ccaggcgctt ggccgccacc gccttaccgt
   158821 agatgctgga catgacggtg gtgggattaa tcttggttag ttctctcagc accatgttct
   158881 gcctcttctg ctccaggcac caggcccgcg cgaggtctcc cagcatgcgg ttgatctggc
   158941 ggcgcaggga atcgtaggca aattggatct ggacggtggc gggattgttg agggtgccca
   159001 gggacttccc gggggccgcg gggggcaccg gtgtggtggc attccccgca tcccgcctcc
   159061 ggcgcctcag aacggcggcg gaggtgctcc cgcgggccgc gggtggggcg gggggcgatg
   159121 gactgctggg gggtgaggaa gtcggagtgg taagctccgt caggttcttg acggtggcca
   159181 acgagcgcgg ggtcagaggt agccaagcta ataacaatcc tccgctcgtt ataaaatatg
   159241 taatggcttc ctggcccttc gtgtaacgat cctggacggc ctcgtacttc tcatgcatgg
   159301 tcttgttcac ctgctcttcg atgcacttga aggcgtccgg gagctctatg cccacggttg
   159361 tgttggtcac gaagctagag gtgccctcgt cagtcacaaa atgtattgac ttccctgttt
   159421 ctgtggcgat ggtcgagtca aaggtttgcc agtgttgaag cgggcagtag gctgtcctgt
   159481 tctcgagctt ccaagatagg gtgtaagtgc ccttgtccag gaaggctcgg cgttcgcctt
   159541 gcgggttcgt ccctcggttg tcgtagtcca ctatcttgta gttagttctc acgtggaagg
   159601 agtctgcccg ctcatggaag gtttccttat ttttcccgtc atagaaaggg gacatttcca
   159661 cagtctgccc ggtggtggtc acaaagaagt cgaaggggct gttggacttg gccatcatgt
   159721 cagttatcag gcagttgacg gtagttcttg ttctgtaagt ccatatcaac cacccggggg
   159781 cgtcatagag ctccgtctgg ctggcgtagc ggcgcacccc gttggccagg cccccggtgg
   159841 gctttaggtt gacggtgatg ttaactccgt cgcggtctac atacacgcgc gtcagcccat
   159901 cttttgtcat cttgaccgcg ttgtagcact ggtagatggt atccatctgg tcagtttcgt
   159961 agctgtcaac ggagaacttc tcctcgtgcc ggttggtcac ggagtccgcg taccagccat
   160021 tgtagatgag aatgttggtc actatcttgg tgtaggagcg gaccttaaac gagtagggaa
   160081 taatgttgtc tttaaacacc atcaacaggc cctccgtgtg attctcccgc gtgccaaacg
   160141 agggacactg gatgtccgag gagaagcgga acaggtcgcc gtggctggag agctcgcaga
   160201 ctcggaaagg aaagctggtt tgctgacgcg tggcggtagg ctgcaccgtg gtggcggggg
   160261 gtgcgggctg ctctggggtc tgcgcaccga ggcggcacgc cagggcggct agcagcacga
   160321 ccacgcttag caccctacgc cgagtcatct ctcatttgga ggtgcaggta gagaagggca
   160381 tatagatcct taaataccca ccccctgccc ttatacagaa gaattagggg ccggtcagag
   160441 tcgtacgtga ggtaaagccc atccgggggc agggcctggc cggggctgac cgcgtccgcc
   160501 cggcgcagga tcaaggaccg cccccaggtc ttgttgtaga gggacacggt taggacggcc
   160561 tcgcgcagcg cccggcacag aatttgctgg ctagatgcca gtgagccccc gggtacgctg
   160621 tagaagctgt tgaaggaggt ctctatccag tcgctcggct cgatgcctgg ccatatcagg
   160681 gaagtcagga acgccttctg gtgaggcagc gtacctgcgg cgtcacagca gcgagccagg
   160741 gccacgttgc tgggtggggg aaagagcccg ctctcctccg ccaggggccc cgtgatgaag
   160801 gtgtacaggc tgtgcgtcag cgcgtgcagg tgctccgagc tcagggtctg ggtaaacagg
   160861 tgtgttttga tgtacttgga attctcaaag gcggcaccct cgccggcgcg cctgtcctcc
   160921 cagggacccg agacgaaggc ccgtctgtag aggaagtggt tgcgcatgcg ggccagctcc
   160981 cagtagacca cgtcccccca gacgcgcagg cacagggtct cggtcagggt ctcgctctgt
   161041 tgcgccaggc aggactgcag cttggccaga ccctcggtgg ccacctggcg caggtactgc
   161101 tccttgcgct tgagcgcgtc cgagagggcg ccggacgggc cgggctctcg tgccccagcc
   161161 ggccggggca cctccgggct ctcccgggac gcctcctcct cgcctcggcc caaccgctgc
   161221 atggctcggt tgagccgcgt gtagagctcg ttcctctttt gcaggatggc ccggtactgg
   161281 gggtgcgccg tgaaggcggc ggcgcagtcc gccttcagcg cctccaccgc gtcgcccgag
   161341 gagctgtaga ccccgccgca gaagagccgc tccgtggccc cgggagccac ggcatcaaac
   161401 aggtgagtca gccttgcccc cgccagcgcc tcctcgcagg cccgccgcac cagggccagg
   161461 cgacgctccc gggcaaacag ggcagagagg cgggaatggc cgccaccctc cccctgcccc
   161521 gttgcaccga tagcatggcc gccagagttc caatagagga gctccgagag ttccgccacc
   161581 tccgggggca ctgtcgagaa gacgttgtag gtgtccagcg ctctggtcgc cccctctgcc
   161641 tccggccgcc ccgggcccgg gaccgcgccc tcctctgggc cgcccggcct cgccttctcc
   161701 tcagcctcca acaggtgccc gagcccagcc tgccggactt cattctcaaa cagtcccgag
   161761 accggctccg gattcaccgg caccgccagg tggttacagg agacgtgggt cccctctgcc
   161821 gtggaagggt tgccgtggtt gggcagaacc atcagctcgc ccacacagcg ccagcagggc
   161881 acagaggtga tgtagaggcg cgggtctggg atgggactta cgccccgaaa gcggcccagc
   161941 agatccaggg cccgttccag gctctccagc cccatggtgt gagacatgca ataaaacacg
   162001 ctattgattc tcttcattaa aatctctatg tcatttatta ggcacaaact tacatcgact
   162061 ttatgccccc cgtaaaactc cacagagtac gcgactgagg gggtgcggag aggcgggacc
   162121 cgggtaccct ttctaccagg ggcgagcagc gcggcagagg cctctctcga gttctctagc
   162181 aggtgcacca gctccaggga cagggcgctg catgcacggt cattctgccg tctcaaacgg
   162241 ggaaggagga tggcctccag ctcggccagc aggccggcgt tgcgcactac cgcagccacg
   162301 tccagactcc gggggtccag ccgggcgcac acgctcagct caaccgccag ggcgtacacc
   162361 tggctgtacg ccgccgccag cagccccgac atcgccgccc caggggtctc tagacctcga
   162421 gtccggggag aacggtggcc agacggcgct tgcgtctgcc cccggagccc tgccctcctc
   162481 cacccagcag cagcccggcc gaggcctgcg acgcggtgct gaccggctcg gccacgctga
   162541 taaagttgtc ctgggctgcc ccgggcccac cccacactcc ctccagaaag tcccgagcgg
   162601 cccccgccgt ccactctatc ccgctggagg caatggtcgc cagggtttct aggacgctgt
   162661 ccgccaggac ggagaagcgg cccaataagt actccgcgtc gtccctagtc agcgaggcgc
   162721 atgcctcgcc catggcatcc acaaggttgc acaccacatc aaacacacag tcttcctcct
   162781 gtttttgtga tataatggcc tccaggccag ccctgatgtt ctcaatctca tatgtggtcg
   162841 cggcttgggt ccggcgcttc acggtcaacc ctagggtggg ggtggcaaag acaaacttct
   162901 tccgcatgga agagcccccg gcctgcttgc gcagcccagc cccgggggcc tgcagcaggt
   162961 tcctgtccac gccccggccc ataaagtatc ccaggttccc ggcctggaat atctggttgt
   163021 tgccgttgac ccccgtgtac ttgttgatgg tcactggcag cgtgacaacc ggacgggcct
   163081 tgcagacctg gctaagacag tctgtggccg cgcagaccac cgtagtcgca gtaagggagg
   163141 aggtggcctc cgcgtaggcc gctgccgact ccaccgcccg cgtgcccagt acgtgggggt
   163201 agtcacgggc gggcaccgac tgcgtcctcg gcaccagtcc ctgaatcagg ctgatgtaga
   163261 actgggtctg gccgcacgcc ttcaggatgg cgttgttgag cctctgcttg gcgtaagtga
   163321 ccaggttgcc aggcaccaca tctatgacgt tgctctcttc gtgggcccgg gagcccccgt
   163381 ccacaaagag ggccaggtca gagtactcct ccgcgctggc cccgctgggg acagggaccg
   163441 agcgccgcct ggaaaagttg tgccacaggt acaggcttga gagcttagtg tccgggaata
   163501 gggtcttgtg gtaggtgttg aggaatttca tgtagggccc gttgatgatg tagttctccc
   163561 tcctggtagt ggacttgatg aagctgttct ggagggcggc attctccccc gtgaagacca
   163621 ccctgttctt gatcttgatg ttcctggggc acagcatcag caccttggac atgcgcacag
   163681 gcagccgccg gccgtacacc cggccctgca gggccgcgtc caggtctggc aggtcgcagg
   163741 tgggctcccc atgcaccacc ttggcctcct tggccgtgag gacccccttg tcgatggcca
   163801 ggctcctaaa gttggtgcac agcgtctggt agtgaccctt tagccactct ggggggctct
   163861 ggccaagccc ggggttgtca ttctcatagc acatacagat gggcagggag atgtcctgca
   163921 ggatggtcag cagtgagcgg taaaacagct gggtgaagat ggggcaggcg ggctgcgcaa
   163981 aggggttgca cgagtactgc atcacgtggt agcagctctt gaccaggtcc ttgtaggtga
   164041 tgttgttctt ggccatgctg ttcataaact ggaccacttc ggcgtccacc gccgcatcca
   164101 cgtccttgaa catcttgaca aagtcacgcg ggccatgggg ctccttctct agctttccct
   164161 cagcgtctat gcccagccga gacagccgct ccagcaggtt ctggttcagc tgccagtagg
   164221 tgtagcgggg ctcgtcgtcc ggccgctgcc cgtcgtcctc cttatcgatg aagttgagaa
   164281 agttgcccaa aaagtccgtc tcgttgtagg agcccgaggc ccccgagatc acataggggt
   164341 ccctccgctg cgtggacatg acggggggaa agcggtccct cagcctaaag aagagcgtgt
   164401 tcaggcacac ggccggggcc cggccctcgc agagcgagca catggggctg gcggccgccc
   164461 ccgccacgta gctgcccgtc tccggcaccg gggtcagaga gctcttctgt ccctggcaaa
   164521 actgcaggta gtaggcatag cgggcaagaa ggttgggcga gaaggaggcc gcatagacca
   164581 ggtgctccac agcgtagttt cccggaccgt tggttccggt cacgtctggc ccaccccagc
   164641 ccgagaagca gggtcggcgg caggggtccc aggtcccctc ctgcagggtc cccaggccgt
   164701 gggtcatgta gaaactgtta aagagactct ccttgccctg accggttgac ttcgagaccc
   164761 ccgagacgta gaggacggaa ttggtggcaa agatctgcgt ggacacgtgg ggggccaggc
   164821 tggcattata tcggtgtaac gcagccacac gggcctctgg accctcacag tcggcaaaca
   164881 ggggccacga gtcgtagttg aggctggccg gggtctcgtg cgaggcctcc agcatggcgg
   164941 gcgcgtagct caccgccagc tcgcaggccg cgctgtccac aatcattaag gctcccgagt
   165001 ccgggtgact gatggttgag gctgggaact ccttgagggg ggccaccttg gccaccttgg
   165061 cctggtcctg caggctctgc ttctccagca gctccaccag cttgcccacc cgtcggacgc
   165121 gcagcgcctg cgccagcccg gtgtacagcg cctcgtgcat gcagcggctg aggtccgagt
   165181 tgtaaaactg gcggagctgg ggcacgccct ctgggaacac ctccttgtcg tagagcggga
   165241 ccctaacgct cgcagactgc cccaccgcta cctcctgttt taacgatgga atggccacca
   165301 ggtttccgct gtagagtcgc tccttgaagg cctcggttat tgccaccgcc ccaaggtagg
   165361 cagagggatc tagcccttcg gggaagaagt cccccggctc ggagctttcc ctcggtaggg
   165421 cgctgtaggc gtcgtatcca aacacctccc tggtctcgcc acagagggcc tcgagacccg
   165481 gcccctcaaa gatgggggga accatatggg cattgtggaa cacgtagatg tccctgtgat
   165541 aggaggtagc gcgtaggagc ccgcagttgg ggtcgggcct cctgtgcaga gccttgacat
   165601 tgatgctgaa gcccggctcc acggtgatgc cacaaaggag cggcaccgtc aggcacctgt
   165661 ggcccgcgta gccggtcccc agtgtggcca cctccctaag agggtaggtg gccagggggt
   165721 aaaagtagat gtagccgcac ggacccggct ggctctggct gcccagatta tcctcgctag
   165781 tctgtgcacc ctgcatgatg cccaaggtat cgccccggcc tcccagtccc acattaaatg
   165841 ttacacttta ctcatcacgc aacacccact gtttattcat ttacaaagat ttcaggaagt
   165901 cagtcaggct ggccagggcc cacgtcacgg ggaactgacg tctcagcgat cttggcatgc
   165961 cgcccagcct cgcaaaccag agtctgcgat agagggccag gtagtgggcg attgccccca
   166021 gcacgaaggc ggcgctcttg tggtcatcca ggtagtttcg caccgcaaac accactgtgt
   166081 agcacagcac caccctgagc cgcgaccagt agtcgtagtg gtcgttgtac actgcgcgca
   166141 ggacgctgat gatgagccgt acgtgcgtgt ctttgccccc gatgtcggct gtcctgcagg
   166201 ccagctccgc gtacagcttc ctatccttcc tcagggaggc cttgatgagc cggcagagga
   166261 ccagggctgg caaaggcagg tctttctcat cccgggtgaa caccgcgtac atggccctga
   166321 acatgaggta gctggactca gccaccttgt cgtccggcgg cgagggcgcg acccacgcct
   166381 cgaccggggt cctcacaaac acagaatctg tagacttggc tggcctcatg gtctcgtcag
   166441 gccagctcac gggcttcagg cttatatgat aaaatgggcg tggcagaata gtataagacg
   166501 cgaggcctgg gtgaggagag tccagagcaa tggccaggtt catcgctcag ctcctcctgt
   166561 tggcctcctg tgtggccgcc ggccaggctg tcaccgcttt cttgggtgag cgagtcaccc
   166621 tgacctccta ctggaggagg gtgagcctcg gtccagagat tgaggtcagc tggtttaaac
   166681 tgggcccagg agaggagcag gtgcttattg ggcgcatgca ccacgatgtc atctttatag
   166741 agtggccttt caggggcttc tttgatatcc acagaagtgc caacaccttc tttttagtag
   166801 tcaccgctgc caacatctcc catgacggca actacctgtg ccgcatgaaa ctgggcgaga
   166861 ccgaggtcac caagcaggaa cacctgagcg tggtgaagcc tctaacgctg tctgtccact
   166921 ccgaaaggtc tcagttccca gacttctctg tccttactgt gacatgcacc gtgaatgcat
   166981 ttccccatcc ccacgtccag tggctcatgc ccgagggcgt ggagcccgca ccaactgcgg
   167041 caaatggcgg tgttatgaag gaaaaggatg ggagcctctc tgttgctgtt gacctgtcac
   167101 ttcccaagcc ctggcacctg ccagtgacct gcgttgggaa aaatgacaag gaggaagccc
   167161 acggggttta tgtttctgga tacttgtcgc aataaacgca cttgcctatt tcaccttgtc
   167221 ttagtgtggc atgggggggg tggcattgcg ggtggatagc ctcgcgactc gtgggaaaat
   167281 gggcggaagg gcaccgtggg aaaatagttc caggtgacag cagcagtgtg tgaagattgt
   167341 cacagctgct ggtttggaga aaacgggggt gggcggtgat cagggagaac aattccccgg
   167401 ggacacctgc acgagacccc tgcgctctca ggaacttcgc ccaggtctcg ccaattgggg
   167461 tgatcctgta gcgccgcggt ttcagcatca caggttattt tgcctgaagc ttgctggggc
   167521 gtaaatccct ctcgccttgt ttctcagaga gcatttcagg ccggttttgc agtcgctgct
   167581 gcagctatgg ggtccctaga aatggtgcca atgggcgcgg gtccccctag ccccggcggg
   167641 gatccggatg gggacgatgg cggaaacaac tcccaatatc catctgcttc tggctcttct
   167701 gggaacaccc ccaccccacc gaacgatgag gaacgtgaat ctaatgaaga gcccccaccg
   167761 ccttatgagg acccatattg gggcaatggc gaccgtcact cggactatca accactagga
   167821 acccaagatc aaagtctgta cttgggattg caacacgacg ggaatgacgg gctccctccc
   167881 cctccctact ctccacggga tgactcatct caacacatat acgaagaagc gggcagagga
   167941 aggtaagagt gccatctatc tgtactttta tttattgcat cacaagtcac atcaataata
   168001 agggcgccat ctagcgggag atgttatcca caccatccca attcacatct cagggacaac
   168061 aggtcaaagt tctttgttga cacccccagc gctggctcca gggggtggca gcgttggatg
   168121 cagtcctccg catcggggcg gacgcctcct cccaacgcgt ttctgcggat cagtcgctgg
   168181 ctggtgggca tcggagtcgg tgggcggtcc tccacgggga cacgctcctt cttggccttg
   168241 ttctttgacc ttttggacat tcttctgaag gaacggcgga gagtagcgta gaatccagcc
   168301 agtggtctac ccggtcgcat ggtggcttct tagatgagga gcaggcataa aagtccaaac
   168361 aggacacaga gtaccaccag gagtagtctt agtctgctga cgtctgggtc ctcggggcag
   168421 gggtggctag gcctggtctc cgtagaagag ccgggcaggc cgcaggcaga ggactgctgc
   168481 tctagcaaag cacgctccag gacgtgtacc atctcgagag tgaggcacag ctgttttcgt
   168541 ggacttttat acagtaagga caaggaaaga aggccagagg aatgtggaaa gatgagcgag
   168601 gacaggtgtg gaggttttgg gctagctctt agtttctggg tgtgagagag ggattaaagt
   168661 gcttatgcgc aaagaatgtg tcaacaacag gtgttcctgc atctgctggc atgagttagg
   168721 tgtggcttgg gctgaatcca aatgtgtatt ggcacaagat ggaaagcaaa gttgctggag
   168781 ttactgggtg ggagacaggg atgtatgtgg tcccccgctg gtatgccagt accctgtgga
   168841 agtaaggggc ctcatctgcc cggtagttgt gttgtgcaga ggtctgatgt gtgtaggagg
   168901 ggtgggttca acgcaggggc gttggtggcg gagtctggca acgcccgggt cctcttgcta
   168961 cctgtgtggt gtgtgaaggg ctgggtaaag gtgtctgcca attctcgcat gtcctccttt
   169021 ccccttgttt tgaaatagaa tatgaatgtg gcttttcagc ctagacagac agtgtggcta
   169081 agggagtgtg tgccagttaa ggtgattagc taaggcattc ccagtaaatg gagggagagt
   169141 cagtcaggca agcctatgac atggtaatgc ctagaagtaa agaaaggtta gtcatagtag
   169201 cttagctgaa ctgggccgtg ggggtcgtca tcatctccac cggaaccaga agtacccaaa
   169261 agcagcgtag gaaggtgtgg atcaccgccg ccaccgtctg tcatcgaagg cgggccccgg
   169321 tcacctcctt tgttttcaac ctcttccgtc aaatttggtg ggcctccatc atttccagca
   169381 gagtcgctag ggttatgagg cagcgggtca tgtgggccat tgtcagcagt gttgtcaggg
   169441 tcctgtgggc cattgtcatc agtgttgtca gggtcctgtg ggccattgtc atcagtgttg
   169501 tcagggtcct gtgggccatt gtcatcagtg ttgtcagggt cctgtgggcc attgtcagga
   169561 ccacctccag gtgcgcctag gttttgagag cagagtgggg gtccgtcgcc ggctccagtc
   169621 acgagcaggt ggtgtctgcc ctcgttggag ttagagtcag attcatggcc agaatcatcg
   169681 gtagcttgtt gagggtgcgg gagggagtca tcgtggtggt gttcatcact gtgtcgttgt
   169741 ccatggtaat acatccagat caaaatcgcc agaaacagga ggagccaaag gagatcaacc
   169801 aatagagtcc accagttttg ttgcagatag agagcaataa tgagcaggat gaggtctagg
   169861 aagaaggcta ggaagaaggc caaaagctgc cagatggtgg caccaagtcg ccagagaatc
   169921 tccaataagt agatccagag acctaagact gcgttgaaaa aagagtgtta gggttggaaa
   169981 agtgggggtg tggtaaataa ttcccaggga atgttagatc ttaccaagta agcacccgaa
   170041 gatgaacagc acaattccaa ggtacaatgc ctgtccgtgc aaattccaga gagcgatgag
   170101 caggagggtg actggggaaa gaggagaaag tgcgttagag aaggaagagt aagggaaagg
   170161 gggtgtgggg caaagggtgt aatacttact catcagtagg agtagacaaa gggctccaag
   170221 tggacagaga aggtctcttc tgaagataaa gatgatcaaa attataatta taagtatgag
   170281 agcaaaggaa tagaggacaa ggagggctcc tccagtccag tcactcataa cgatgtacag
   170341 ccaaaacagt agcgccaaga ggaggagaag gagagcaagg cctagggaag aggagagggg
   170401 gggtcctcga gggggccgtc gcgggcccgg tgggcccctc tcaaggtcgt gttccatcct
   170461 cagggcagtg tgtcaggagc aaggcagttg aggaaagaag ggggcagagc agtgtgagag
   170521 gcttatgtag ggcggctacg tcagagtaac gcgtgtttct tgggatgtag ggccgggggg
   170581 atttgcgggg tctgccggag gcagtacggg tacagatttc ccgaaagcgg cggtgtgtgt
   170641 gtgcatgtaa gcgtaaaaag gggaagtaga aagcgtgtgt tagtgttaga aaagcgggtc
   170701 cccggggggc aagctgtggg aatgcggtgg gcaagtgcaa caggaaatgg aaaggcagtg
   170761 cggcaatcag aagggggagt gcgtagtgtt gtgggaagcg gcagtgtaat ctgcacaaag
   170821 aggcgtgggg cgcgcaacgt tgggaggtcg ttggcggcag gcgggaggcc gtgctttagg
   170881 ggggttcagg tgaggcaagg ctgtggggta accgtagggg aggcgggtga ggcggctaag
   170941 agggctaagg gtcggcgggt gacgaagcag cagacggcgg atatgggaat ttcagaatga
   171001 ggtggcggat tcaggcgaaa agggtgtggg ctgtgcgagt gtcatgaggc aggcgcggaa
   171061 agtcgctgcg gcttgctggg gccatgggcc gcgcattcct ggaaaaagtg gagggggcgt
   171121 ggcctgcccc ccgcggcccc ctagcccccc cgcacagagc ggcgcaacgg cgggcgggcg
   171181 gcggggggtc ggggtccgcg ggctccgggg gctgcgggcg gtggatggcg gctggcgttc
   171241 aggggaacgg gggggtcggg gggcgcagcg gccgcgcagc catgcgtgac cgcgaggagg
   171301 ggacagggtc gcagggggcg tgtctggtgg gggcgggagc ggggggcggc gcgggagcct
   171361 gcacgccgtt ggagggtaga atgacagggg ggcggggaca gagaggcggt cgcgcccccc
   171421 gccgcggcag ccaagccccc aaggggggcg gggcgcgggc agcggagcgt gacgaagggc
   171481 cccagggctg accccggcaa acgtgacccg gggctccggg gtgacccagc caagcgtgac
   171541 caaggggccg ctgggtgaca cagacaaccc tgacaaaggc cccccaggaa agacccccgg
   171601 ggggcatcgg ggggtgttgg tggggccatg ggggtggggc catgggccgc gcattcctgg
   171661 aaaaagtgga gggggcgtgg cctgcccccc gcggccccct agcccccccg cacagagcgg
   171721 cgcaacggcg ggcgggcggc ggggggtcgg ggtccgcggg ctccgggggc tgcgggcggt
   171781 ggatggcggc tggcgttcag gggaacgggg gggtcggggg gcgcagcggc cgcgcagcca
   171841 tgcgtgaccg cgaggagggg acagggtcgc agggggcgtg tctggtgggg gcgggagcgg
   171901 ggggcggcgc gggagcctgc acgccgttgg agggtagaat gacagggggg cggggacaga
   171961 gaggcggtcg cgccccccgc cgcggcagcc aagcccccaa ggggggcggg gcgcgggcag
   172021 cggagcgtga cgaagggccc cagggctgac cccggcaaac gtgacccggg gctccggggt
   172081 gacccagcca agcgtgacca aggggccgct gggtgacaca gacaaccctg acaaaggccc
   172141 cccaggaaag acccccgggg ggcatcgggg ggtgttggtg gggccatggg ccgcgcattc
   172201 ctggaaaaag tggagggggc gtggcctgcc ccccgcggcc ccctagcccc cccgcacaga
   172261 gcggcgcaac ggcgggcggg cggcgggggg tcggggtccg cgggctccgg gggctgcggg
   172321 cggtggatgg cggctggcgt tcaggggaac gggggggtcg gggggcgcag cggccgcgca
   172381 gccatgcgtg accgcgagga ggggacaggg tcgcaggggg cgtgtctggt gggggcggga
   172441 gcggggggcg gcgcgggagc ctgcacgccg ttggagggta gaatgacagg ggggcgggga
   172501 cagagaggcg gtcgcgcccc ccgccgcggc agccaagccc ccaagggggg cggggcgcgg
   172561 gcagcggagc gtgacgaagg gccccagggc tgaccccggc aaacgtgacc cggggctccg
   172621 gggtgaccca gccaagcgtg accaaggggc cgctgggtga cacagacaac cctgacaaag
   172681 gccccccagg aaagaccccc ggggggcatc ggggggtgtt ggtggggcca tggggggtcg
   172741 gatttcgccc ttattgccct gttt
//
DBGET integrated database retrieval system