GenomeNet

Database: RefSeq
Entry: NC_014470
LinkDB: NC_014470
Original site: NC_014470 
LOCUS       NC_014470              29276 bp ss-RNA     linear   VRL 31-DEC-2021
DEFINITION  Bat coronavirus BM48-31/BGR/2008, complete genome.
ACCESSION   NC_014470
VERSION     NC_014470.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Bat coronavirus BM48-31/BGR/2008
  ORGANISM  Bat coronavirus BM48-31/BGR/2008
            Viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes;
            Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae;
            Betacoronavirus; Sarbecovirus; unclassified Sarbecovirus.
REFERENCE   1  (bases 1 to 29276)
  AUTHORS   Drexler,J.F., Gloza-Rausch,F., Glende,J., Corman,V.M., Muth,D.,
            Goettsche,M., Seebens,A., Niedrig,M., Pfefferle,S., Yordanov,S.,
            Zhelyazkov,L., Hermanns,U., Vallo,P., Lukashev,A., Muller,M.A.,
            Deng,H., Herrler,G. and Drosten,C.
  TITLE     Genomic characterization of severe acute respiratory
            syndrome-related coronavirus in European bats and classification of
            coronaviruses based on partial RNA-dependent RNA polymerase gene
            sequences
  JOURNAL   J Virol 84 (21), 11336-11349 (2010)
   PUBMED   20686038
REFERENCE   2  (bases 1 to 29276)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (26-AUG-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 29276)
  AUTHORS   Drexler,J.F., Corman,V.M. and Drosten,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2009) Institute of Virology, University of Bonn
            Medical Centre, Sigmund Freud-Str. 25, Bonn 53127, Germany
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to GU190215.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..29276
                     /organism="Bat coronavirus BM48-31/BGR/2008"
                     /mol_type="genomic RNA"
                     /strain="BtCoV/BM48-31/BGR/2008"
                     /host="Rhinolophus blasii"
                     /db_xref="taxon:864596"
                     /country="Bulgaria"
                     /collection_date="2008"
     5'UTR           1..190
     gene            191..21384
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /db_xref="GeneID:9714832"
     CDS             join(191..13297,13297..21384)
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /ribosomal_slippage
                     /note="ORF1ab polyprotein is cleaved to yield the
                     RNA-dependent RNA polymerase and other nonstructural
                     proteins; polyprotein pp1ab"
                     /codon_start=1
                     /product="ORF1ab polyprotein"
                     /protein_id="YP_003858583.1"
                     /db_xref="GeneID:9714832"
                     /translation="MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDTVEEAVAEARQ
                     HLIEGTCGIVDLQKGVLPQLEQPYIFLKRCDARTAPHGHVMVELVAELDGVQYGRSGE
                     SLGVLVPHVGETPIGYRKVLVRKNGNKGAGGHLYGADLRFYDLGDELGTDPLDDFQQD
                     WNTKHGSGLRRDLFRELNGGVYTRYVDNNFCGPDGYPLECIKDLLARAGKSSAPLAEQ
                     LDFLESKRGVYCCREHEHEIAWYTERSDKSYELQTPFDITNAKKFDSFKGECPKFVFP
                     LNSTVKVLQPRVEKKKTEGFLGRIRTVYQVASPGECNSMHLSTYMNCNHCGEKSWQTC
                     DFLTATCEMCGNQNTVEEGPTTCGYVPSNAVVKMVCPACQNPEIGPDHSVADYHNNSK
                     IETRLRKGGRIKSFGGCVFSYVGCYNKRAFWVPRAAANIGSNHTGVVGEGVETMNEDL
                     LQILSRERVVINIVGEFCLNEEIAILLASLSASTSAFVETVKNLDFKTFKKIIESCGN
                     YKVTKGKFKPGVWNIGTSKSLLTPLHCFSSQAAGVVRSIFSRTLATANHSIVDLHRAA
                     MIIFSDISDQANRVLDAMVNTSDLVTESVVVMAYLTGGLVQQVSTWLSQLLNTSVDKF
                     SAVLRWLEQKLQGGIDFLRQAWGILKLLVTGAYVVIRGKIQVVNTSLIECVTSFVDVV
                     NKVFELCTDYITVAGARVRAINFGEVLIAQSRGLYRQCVRARDQLQLLMPLKSPKDVV
                     FLDGDAYDTLLTSEEVTVKNGTLEALDLELSDVVTGVAEGVPVCVNGLMLLELKEKEQ
                     YCALSPSLLATNNVFTLKGGAPTKGVTFGEDTVVEIQGYKSVKITFELDERVDKVLNE
                     KCASYTVETGTTAEELACVVAESVVKTLQPISELLTPMGIDLDEWSVAKFYLFDESGE
                     AVLSSHMYCSFYPPDEEEEEDLEESEDVEYGTEDDYTGAPLEFGASSTVEQDEVHDEE
                     EDWLAPQEESEVLYDQFTDYHKLTDNVFIKCADIVEESLKVNPTVVVNAANIHLKHGG
                     GVARALDKATGGSMQKESNDYISTNGPLRVGGSCLLSGHNLAKHCLHVVGPNKNAGED
                     IKLLDAAYENFNAYEVVLSPLLSAGIFGVSPIQSLETCKRVVRNTVYIVVNDSVVFDQ
                     LLAKTPGKTNERPVVESSEICEEVNQKPVVEFSETKELHEETNQKLKSSEEPVKTRIE
                     ELNTTVDEAKFLTTKLLLYADVNGNLSEDSKVLIGNDGASFKKGAPYIVGDIISEGEL
                     TCVVLPTKAVGGTTHMLTRALKNVPSDTYLTTYPGQGVSGYTLDEAKAALKKSRSVFY
                     ILPSANVNAKEEVLGTVAWNLREMLAHAEETRKVMPVCMDVRAIISTIQRKYKGIGIQ
                     EGLVDYKVRFYFYSSKTPIARVISNLNSLGEPLITMPLGYVTHGLNLEESARYMRSVK
                     VPVVVSVSSPDAVTSYNGYVTSASKSAEEHFIETVSLAGSYKDWSYSGQRTELGVEFL
                     KRGDKIVYHTVGNVIEFHMEGEVLPLEKLKTLLALREVKTIKVFTTVDNINLHTQVID
                     MSMTYGQQLGPTYMDGADLTKVKPHASHENKTFFVLPSDDTLRIEAFEYYHTVDESFF
                     GRYMSALNHTKRWKYPQVGGLTSIKWADNNCYLSSVLLSLQQIDIKFNAPALQDAYYR
                     ARAGDAANFCALVLAYSKKTVGELGDVRETMAHLLQHANLESAKRVLNVVCKHCGQKS
                     TTLSGVEAVMYMGTLSYDHLKRGVKIPCVCGREATQYLVKQESTFVMMSAPPAEYTLQ
                     TGEFLCANEYTGNYQCGHYTHITNRETIYKIDGALLTKITEYKGPVADVFYKETSYST
                     DIKPVSYKLDGVTYTEINPDLNGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFRFVCA
                     NTKFADDLNQMTGFKKPPSRDLTITFFPDLNGDVVAIDYRHYTPTFKKGAKLVHKPIL
                     WHVNQTTTKSTFKPNMWCLRCLYSTKPVPTSNSFEVLSSDDAQGMDNLACESQQTVAE
                     EVVDNPTIQKDIIECDVKTTEVVGNVILKPSADGIKVTSELEHEDLMAAYVNETSITI
                     KKPNELSIMLGLKTIATHGAAAINSVPWIKICAYVKPFLGYVAEQSKNCIKRCFRRVF
                     NDYMPFLLTLLLQLCTFTKSTNFRIKAAMPIVIARNSVIGGVRFCLDALTMYVKSPKF
                     SGILTVVMWLLLLSVCLGCLVYAVASFGAILSGFGLMSYCDGVRAGYVNSSNVTIPDY
                     CAGSLPCGVCLGGLDSLDAYPALETIQVTISSYKLDLTFVGMMAEWFLAYMLFTKFFY
                     LLGLFALMQLFFGLFATHFVNNSWLMWLIINVVQMAPISAMVRMYVFFASFYYVWKAY
                     IHVINGCTSSTCIMCYKRNRATRVECTTIVNGMKKSFYVYANGGQGFCKLHNWNCLNC
                     DTFCSGSTFISDEVARDLSLQFKRPINPTDQSSYNVDSVTVKDGTLYLYFQKAGKLTY
                     ERHPLSYFVNLDNLRANNVKGTLPINVIVFDGKSKCEEAAAKSASVYYSQLMCQPILL
                     LDQALISDVGDSTEVAVKMFDAYVNAFSSTFNAPMEKLKTFIATAHAEIAKGVSLDSV
                     LSTFLSAARQGFVDSDVDTKDVMECLKLSHHSDLEITSDSCNNFMLTYNKVENMTPRD
                     LGACIDCSARHINAQVAKSHNVSLVWNVKDYMSLSEQLRKQIRSAAKKNNIPFKLTCA
                     TTRQVVNVITTKISLKGGKFVSNNWFRFLLKMTVLMVLVAFIFYFITPTHTLMGHDVF
                     SSEIIGYKAIHNGVTRDVLTTDDCFANKHTGFDHWFSQRGGSYRNDKTCPVIAAVITR
                     EVGFIVPGLPGTVRRASNGDFLHFLPRVFSAVGNICYTPAKLIEYTDFATSACVLAAE
                     CTIFKDAQGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPSTYLEGSVRVV
                     TTFDSEYCRHGTCERSDAGVCLSTNGRWVLNNDYYRSIPGVFCGADASDLLFNIFTPL
                     VRPVGTLDISASVVAGGLIAILVTCVAYYFMKFRRAFGEYNHVVFANALLFLLSFTIL
                     CLTPAYTFLPGIYSLLYLYLTFYFTNDVSFLAHLQWLAMFSPIVPFWITVTYVVCISI
                     KHCHWFFSNYLKKRVVFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYL
                     ALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGF
                     RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTLEDMLNPNYDDLLIRK
                     SNHNFLVQASNVQLRVIGHTMQNCLLKLKVDIANPKTPKYKFVRIQPGQTFSVLACYN
                     GAPSGVYQCAMRSNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL
                     EGNFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGERWFLNRFTTTLNDFNLVAM
                     KYNYEPLTQDQVDILGPLSAQTGVAVMDMCAALKELLQNGLNGRTILGSTILEDEFTP
                     FDVVRQCSGVTFQGKFKKVVKGTHHWLLLTLLTSLLILVQSTQWSLFFFVYEHAFLPF
                     TMGVVCFAACAMVLVKHKHAFLCLFLLPSLITVAYFNMIYMPASWVMRVMTWLDLVDT
                     SLSGYRLKDCVMYALAAFLLILMTARTVYDDAARRVWTVMNVITLVYKVYYGNSLDQA
                     LAMWALVISVTSNYSGVVTTIMFLARAIVFLCVEYYPILFITGNTLQCIMLVYCFLGY
                     CCCCYFGLFCLLNRYFRLTLGVYDYFVSTQEFRYMNSQGLLPPKTSLDAFKLNVKLLG
                     IGGKPCIKVATVQSKMSDIKCTSVVLLSVLQQLRIESSSKLWAQCVQLHNDILLAKDT
                     TEAFEKMVSLLSVLLSMQGAVDINKLCDEMLNNRATLQAIASEFSSLPSYAAYATAQE
                     AYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
                     KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYN
                     TYKNTCDGNTFTYASALWEIQQVVDADSKVVQLSEINMDNSQNLAWPLIVTALRSNSA
                     VKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTSKGGRFVLALLSDHQDLKWA
                     RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRL
                     QAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITV
                     IPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCTNDPVGFILRNT
                     VCTVCGMWKGYGCSCDQLREPVMQAADAPAFLNRVCGVSAARLTPCGTGTSTDVVYRA
                     FDIYNEKVAGFAKFLKTNCCRFQEVDEEGNLLDSYFVVKRHTMSNYQHEETMYNLVKE
                     CPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYN
                     CCDDAYFNKKDWYDFVENPDILRVYACLGERVRQALLKTVQFCDAMRDAGIVGVLTLD
                     NQDLNGNWYDFGDFVQVAPGAGIPIVDSYYSLLMPILTLTKALAAESHMDCDTTKPLI
                     KWDLLKYDFTEERLCLFNRYFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPT
                     SFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHA
                     ASGNLLLDKRTTCFSVAALTNSVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHF
                     FFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNL
                     DKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRART
                     VAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVETPNL
                     MGWDYPKCDRAMPNMLRIMASLVLARKHSTCCNLSHRFYGLANECAQVLSEMVMCGGS
                     LYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYEC
                     LYRNRDVDHEFVEEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYY
                     QNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDD
                     IVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYS
                     VMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGSCIRRPFLCCKCC
                     YDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQ
                     VFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAETLKANEETFK
                     LSYGIATVREVLSDRELHLSWEIGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGD
                     YGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLTAPTLVPQEHYVRITGLYPTLNISDEF
                     SSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEK
                     ALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEVSM
                     ATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDM
                     FLGTCRRCPAEIVDTVSALVYDNKLRAHKGKSSQCFKMFYKGVITHDVSSAINRPQIG
                     VVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFAQTTET
                     AHSCNVNRFNVAITRAKVGILCIMSDKDLYDKLQFTSLEVPRRSVAVLQSENVTGLFK
                     DCSKLITGLHPTQAPTYLSVDTKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVN
                     GYPNMFITRDEAIKHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPTGYV
                     DTSAATEFSRVNAKPPPGDQFKHLIPLMYKGLPWNIVRVKIVQMLSDTLKDLSDRVVF
                     VLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWHHSVGFDYVYNPFM
                     IDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAIHECFVKRVDWSVEYPII
                     GDELRINVACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQADVEWKFYDVQPCS
                     DKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPSNAIVCRFDTRVLSNLNLPGCD
                     GGSLYVNKHAFHTPAFDKGAFANLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATC
                     ITRCNLGGAVCRHHASEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQSLEN
                     VAYNVVNKGHFDGQAGEKPVSIINNTVYTKVDGVDVEIFENKTTLPVNVAFELWAKRN
                     IKPVPEIKILNNLGVDIAANTVIWDYKRESPAYISTIGVCTMTDIAKKPTENACSSLT
                     VFFDGRVDGQVDSFRNARNGVLITEGSVKGLNPSKGPPQASLNGVTLIGESVKTQFNY
                     FKKVDGVVQQLPETYFTQSRSLDDFKPRSQMEVDFLQLAMDEFIERYKLEGYAFEHIV
                     YGDFSHGQLGGLHLMIGLAKRSLESLLKLEDFIPIDSTVKNYFVTDAQTGSSKCVCSV
                     IDLLLDDFVEIIKSQDLSVVSKVVTVTIDYAEISFMLWCKDGHVETFYPKLQANQTWQ
                     PGVAMPNLYKMQRMLLDKCDLHNYGENAVIPKGIMMNVAKYTQLCQYLNTLTIAVPYN
                     MRVIHFGAGSDKGVAPGSAVLKQWLPVGTLLVDSDINDFVSDADSTLIGDCSTVYTAN
                     KWDLIISDMYDPKTKHILKENDSKEGFFTYLCGFIKQKLALGGSVAIKITEHSWNADL
                     YKLMGYFSWWTAFVTNVNASSSEAFLIGVNYLGKQKESIDGYTMHANYIFWRNTNPIQ
                     LSSYSLFDMSKFPLKLRGTAVMSLKDNQINDMICSLLEKGRLIIRENNKVVFSSDVLV
                     NN"
     misc_feature    227..571
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Non structural protein Nsp1; Region: Nsp1;
                     pfam11501"
                     /db_xref="CDD:288369"
     misc_feature    2951..3133
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Protein of unknown function (DUF3655); Region:
                     DUF3655; pfam12379"
                     /db_xref="CDD:289172"
     misc_feature    3245..3568
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Macro domain; Region: Macro; pfam01661"
                     /db_xref="CDD:279930"
     misc_feature    order(3257..3259,3278..3280,3284..3289,3521..3523,
                     3527..3535)
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239150"
     misc_feature    4139..4564
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Single-stranded poly(A) binding domain; Region:
                     SUD-M; pfam11633"
                     /db_xref="CDD:152069"
     misc_feature    4577..4774
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Coronavirus polyprotein cleavage domain; Region:
                     Nsp3_PL2pro; pfam12124"
                     /db_xref="CDD:288939"
     misc_feature    4781..5734
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Papain like viral protease; Region: Viral_protease;
                     pfam08715"
                     /db_xref="CDD:285877"
     misc_feature    5810..6148
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Nucleic acid-binding domain (NAR); Region: NAR;
                     pfam16251"
                     /db_xref="CDD:292868"
     misc_feature    9599..9877
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Coronavirus nonstructural protein 4 C-terminus;
                     Region: Corona_NSP4_C; pfam16348"
                     /db_xref="CDD:292959"
     misc_feature    9968..10801
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Coronavirus endopeptidase C30; Region:
                     Peptidase_C30; pfam05409"
                     /db_xref="CDD:283148"
     misc_feature    11672..11920
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="nsp7 replicase; Region: nsp7; pfam08716"
                     /db_xref="CDD:285878"
     misc_feature    11921..12514
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="nsp8 replicase; Region: nsp8; pfam08717"
                     /db_xref="CDD:285879"
     misc_feature    12515..12853
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="nsp9 replicase; Region: nsp9; pfam08710"
                     /db_xref="CDD:285872"
     misc_feature    12887..13246
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="RNA synthesis protein NSP10; Region: NSP10;
                     pfam09401"
                     /db_xref="CDD:286486"
     misc_feature    13309..14367
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Coronavirus RPol N-terminus; Region: Corona_RPol_N;
                     pfam06478"
                     /db_xref="CDD:284009"
     misc_feature    16894..>17286
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="P-loop containing Nucleoside Triphosphate
                     Hydrolases; Region: P-loop_NTPase; cl21455"
                     /db_xref="CDD:304359"
     misc_feature    16903..17307
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="AAA domain; Region: AAA_11; pfam13086"
                     /db_xref="CDD:289831"
     misc_feature    17392..17805
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; cl22977"
                     /db_xref="CDD:304668"
     misc_feature    17875..19653
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="NSP11; Region: NSP11; pfam06471"
                     /db_xref="CDD:284002"
     misc_feature    20494..21378
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="Coronavirus NSP13; Region: NSP13; pfam06460"
                     /db_xref="CDD:283991"
     CDS             191..13312
                     /gene="ORF1ab"
                     /locus_tag="BtCoVBM48_gp1"
                     /note="polyprotein pp1a; ORF1a polyprotein is cleaved to
                     yield nonstructural proteins"
                     /codon_start=1
                     /product="ORF1a polyprotein"
                     /protein_id="YP_010229071.1"
                     /db_xref="GeneID:9714832"
                     /translation="MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDTVEEAVAEARQ
                     HLIEGTCGIVDLQKGVLPQLEQPYIFLKRCDARTAPHGHVMVELVAELDGVQYGRSGE
                     SLGVLVPHVGETPIGYRKVLVRKNGNKGAGGHLYGADLRFYDLGDELGTDPLDDFQQD
                     WNTKHGSGLRRDLFRELNGGVYTRYVDNNFCGPDGYPLECIKDLLARAGKSSAPLAEQ
                     LDFLESKRGVYCCREHEHEIAWYTERSDKSYELQTPFDITNAKKFDSFKGECPKFVFP
                     LNSTVKVLQPRVEKKKTEGFLGRIRTVYQVASPGECNSMHLSTYMNCNHCGEKSWQTC
                     DFLTATCEMCGNQNTVEEGPTTCGYVPSNAVVKMVCPACQNPEIGPDHSVADYHNNSK
                     IETRLRKGGRIKSFGGCVFSYVGCYNKRAFWVPRAAANIGSNHTGVVGEGVETMNEDL
                     LQILSRERVVINIVGEFCLNEEIAILLASLSASTSAFVETVKNLDFKTFKKIIESCGN
                     YKVTKGKFKPGVWNIGTSKSLLTPLHCFSSQAAGVVRSIFSRTLATANHSIVDLHRAA
                     MIIFSDISDQANRVLDAMVNTSDLVTESVVVMAYLTGGLVQQVSTWLSQLLNTSVDKF
                     SAVLRWLEQKLQGGIDFLRQAWGILKLLVTGAYVVIRGKIQVVNTSLIECVTSFVDVV
                     NKVFELCTDYITVAGARVRAINFGEVLIAQSRGLYRQCVRARDQLQLLMPLKSPKDVV
                     FLDGDAYDTLLTSEEVTVKNGTLEALDLELSDVVTGVAEGVPVCVNGLMLLELKEKEQ
                     YCALSPSLLATNNVFTLKGGAPTKGVTFGEDTVVEIQGYKSVKITFELDERVDKVLNE
                     KCASYTVETGTTAEELACVVAESVVKTLQPISELLTPMGIDLDEWSVAKFYLFDESGE
                     AVLSSHMYCSFYPPDEEEEEDLEESEDVEYGTEDDYTGAPLEFGASSTVEQDEVHDEE
                     EDWLAPQEESEVLYDQFTDYHKLTDNVFIKCADIVEESLKVNPTVVVNAANIHLKHGG
                     GVARALDKATGGSMQKESNDYISTNGPLRVGGSCLLSGHNLAKHCLHVVGPNKNAGED
                     IKLLDAAYENFNAYEVVLSPLLSAGIFGVSPIQSLETCKRVVRNTVYIVVNDSVVFDQ
                     LLAKTPGKTNERPVVESSEICEEVNQKPVVEFSETKELHEETNQKLKSSEEPVKTRIE
                     ELNTTVDEAKFLTTKLLLYADVNGNLSEDSKVLIGNDGASFKKGAPYIVGDIISEGEL
                     TCVVLPTKAVGGTTHMLTRALKNVPSDTYLTTYPGQGVSGYTLDEAKAALKKSRSVFY
                     ILPSANVNAKEEVLGTVAWNLREMLAHAEETRKVMPVCMDVRAIISTIQRKYKGIGIQ
                     EGLVDYKVRFYFYSSKTPIARVISNLNSLGEPLITMPLGYVTHGLNLEESARYMRSVK
                     VPVVVSVSSPDAVTSYNGYVTSASKSAEEHFIETVSLAGSYKDWSYSGQRTELGVEFL
                     KRGDKIVYHTVGNVIEFHMEGEVLPLEKLKTLLALREVKTIKVFTTVDNINLHTQVID
                     MSMTYGQQLGPTYMDGADLTKVKPHASHENKTFFVLPSDDTLRIEAFEYYHTVDESFF
                     GRYMSALNHTKRWKYPQVGGLTSIKWADNNCYLSSVLLSLQQIDIKFNAPALQDAYYR
                     ARAGDAANFCALVLAYSKKTVGELGDVRETMAHLLQHANLESAKRVLNVVCKHCGQKS
                     TTLSGVEAVMYMGTLSYDHLKRGVKIPCVCGREATQYLVKQESTFVMMSAPPAEYTLQ
                     TGEFLCANEYTGNYQCGHYTHITNRETIYKIDGALLTKITEYKGPVADVFYKETSYST
                     DIKPVSYKLDGVTYTEINPDLNGYYKKDNAYYTEQPIDLVPTQPLPNASFDNFRFVCA
                     NTKFADDLNQMTGFKKPPSRDLTITFFPDLNGDVVAIDYRHYTPTFKKGAKLVHKPIL
                     WHVNQTTTKSTFKPNMWCLRCLYSTKPVPTSNSFEVLSSDDAQGMDNLACESQQTVAE
                     EVVDNPTIQKDIIECDVKTTEVVGNVILKPSADGIKVTSELEHEDLMAAYVNETSITI
                     KKPNELSIMLGLKTIATHGAAAINSVPWIKICAYVKPFLGYVAEQSKNCIKRCFRRVF
                     NDYMPFLLTLLLQLCTFTKSTNFRIKAAMPIVIARNSVIGGVRFCLDALTMYVKSPKF
                     SGILTVVMWLLLLSVCLGCLVYAVASFGAILSGFGLMSYCDGVRAGYVNSSNVTIPDY
                     CAGSLPCGVCLGGLDSLDAYPALETIQVTISSYKLDLTFVGMMAEWFLAYMLFTKFFY
                     LLGLFALMQLFFGLFATHFVNNSWLMWLIINVVQMAPISAMVRMYVFFASFYYVWKAY
                     IHVINGCTSSTCIMCYKRNRATRVECTTIVNGMKKSFYVYANGGQGFCKLHNWNCLNC
                     DTFCSGSTFISDEVARDLSLQFKRPINPTDQSSYNVDSVTVKDGTLYLYFQKAGKLTY
                     ERHPLSYFVNLDNLRANNVKGTLPINVIVFDGKSKCEEAAAKSASVYYSQLMCQPILL
                     LDQALISDVGDSTEVAVKMFDAYVNAFSSTFNAPMEKLKTFIATAHAEIAKGVSLDSV
                     LSTFLSAARQGFVDSDVDTKDVMECLKLSHHSDLEITSDSCNNFMLTYNKVENMTPRD
                     LGACIDCSARHINAQVAKSHNVSLVWNVKDYMSLSEQLRKQIRSAAKKNNIPFKLTCA
                     TTRQVVNVITTKISLKGGKFVSNNWFRFLLKMTVLMVLVAFIFYFITPTHTLMGHDVF
                     SSEIIGYKAIHNGVTRDVLTTDDCFANKHTGFDHWFSQRGGSYRNDKTCPVIAAVITR
                     EVGFIVPGLPGTVRRASNGDFLHFLPRVFSAVGNICYTPAKLIEYTDFATSACVLAAE
                     CTIFKDAQGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPSTYLEGSVRVV
                     TTFDSEYCRHGTCERSDAGVCLSTNGRWVLNNDYYRSIPGVFCGADASDLLFNIFTPL
                     VRPVGTLDISASVVAGGLIAILVTCVAYYFMKFRRAFGEYNHVVFANALLFLLSFTIL
                     CLTPAYTFLPGIYSLLYLYLTFYFTNDVSFLAHLQWLAMFSPIVPFWITVTYVVCISI
                     KHCHWFFSNYLKKRVVFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLLPLTQYNRYL
                     ALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSITSAVLQSGF
                     RKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTLEDMLNPNYDDLLIRK
                     SNHNFLVQASNVQLRVIGHTMQNCLLKLKVDIANPKTPKYKFVRIQPGQTFSVLACYN
                     GAPSGVYQCAMRSNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDL
                     EGNFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGERWFLNRFTTTLNDFNLVAM
                     KYNYEPLTQDQVDILGPLSAQTGVAVMDMCAALKELLQNGLNGRTILGSTILEDEFTP
                     FDVVRQCSGVTFQGKFKKVVKGTHHWLLLTLLTSLLILVQSTQWSLFFFVYEHAFLPF
                     TMGVVCFAACAMVLVKHKHAFLCLFLLPSLITVAYFNMIYMPASWVMRVMTWLDLVDT
                     SLSGYRLKDCVMYALAAFLLILMTARTVYDDAARRVWTVMNVITLVYKVYYGNSLDQA
                     LAMWALVISVTSNYSGVVTTIMFLARAIVFLCVEYYPILFITGNTLQCIMLVYCFLGY
                     CCCCYFGLFCLLNRYFRLTLGVYDYFVSTQEFRYMNSQGLLPPKTSLDAFKLNVKLLG
                     IGGKPCIKVATVQSKMSDIKCTSVVLLSVLQQLRIESSSKLWAQCVQLHNDILLAKDT
                     TEAFEKMVSLLSVLLSMQGAVDINKLCDEMLNNRATLQAIASEFSSLPSYAAYATAQE
                     AYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSED
                     KRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVVPDYN
                     TYKNTCDGNTFTYASALWEIQQVVDADSKVVQLSEINMDNSQNLAWPLIVTALRSNSA
                     VKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNTSKGGRFVLALLSDHQDLKWA
                     RFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRL
                     QAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTHTGTGQAITV
                     IPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCTNDPVGFILRNT
                     VCTVCGMWKGYGCSCDQLREPVMQAADAPAFLNGFAV"
     gene            21391..25170
                     /gene="S"
                     /locus_tag="BtCoVBM48_gp2"
                     /db_xref="GeneID:9714824"
     CDS             21391..25170
                     /gene="S"
                     /locus_tag="BtCoVBM48_gp2"
                     /codon_start=1
                     /product="spike protein"
                     /protein_id="YP_003858584.1"
                     /db_xref="GeneID:9714824"
                     /translation="MKFLAFLCLLGFANAQDGKCGTLSNKSPSKLTQTPSSRRGFYYF
                     DDIFRSSIRVLTTGHFLPFNTNLTWYLTLKSNGKQRIYYDNPNINFGDGVYFGLTEKS
                     NVFRGWIFGSTLDNTTQSAVLFNNGTHIVIDVCNFNFCADPMFAVNSGQPYKTWIYTS
                     AANCTYHRAHAFNISTNMNPGKFKHFREHLFKNVDGFLYVYHNYEPIDLNSGFPSGFS
                     VLKPILKLPFGLNITYVKAIMTLFSSTQSNFDADASAYFVGHLKPLTMLVDFDENGTI
                     IDAIDCSQDPLSELKCTTKSFTVEKGIYQTSNFRVTPTTEVVRFPNITQLCPFNEVFN
                     ITSFPSVYAWERMRITNCVADYSVLYNSSASFSTFQCYGVSPTKLNDLCFSSVYADYF
                     VVKGDDVRQIAPAQTGVIADYNYKLPDDFTGCVIAWNTNSLDSSNEFFYRRFRHGKIK
                     PYGRDLSNVLFNPSGGTCSAEGLNCYKPLASYGFTQSSGIGFQPYRVVVLSFELLNAP
                     ATVCGPKQSTELVKNKCVNFNFNGLTGTGVLTNSTKKFQPFQQFGRDVSDFTDSVRDP
                     KTLEILDIAPCSYGGVSVITPGTNASSSVAVLYQDVNCTDVPTMLHADQISHDWRVYA
                     FRNDGNIFQTQAGCLIGAAYDNSSYECDIPIGAGICAKYTNVSSTLVRSGGHSILAYT
                     MSLGDNQDIVYSNNTIAIPMNFSISVTTEVLPVSMTKTSVDCNMYICGDSTECSNLLL
                     QYGSFCTQLNRALAGIAVEQDRNTRDVFAQTKAMYKTPSLKDFGGFNFSQILPDPAKP
                     SSRSFIEDLLYNKVTLADPGFMKQYGDCLGGVNARDLICAQKFNGLTVLPPLLTDEMI
                     AAYTAALISGTATAGFTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFN
                     KAISQIQDSLSTTTTALGKLQDVINQNAIALNTLVKQLSSNFGAISSVLNDILSRLDK
                     VEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCG
                     KGYHLMSFPQAAPHGVVFLHVTYVPSQEQNFTTAPAICHEGKAHFPREGVFVTNGTHW
                     FITQRNFYSPQPITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHT
                     SQNVSLDGLNNINASVVDIKKEIEHLNEIAKSLNESLIDLQELGKYEQYIKWPWYVWL
                     GFIAGLIAIVMATIMLCCMTSCCSCLKGVCSCASCCKFDEDHSEPVLTGVKLHYT"
     misc_feature    <21703..22254
                     /gene="S"
                     /locus_tag="BtCoVBM48_gp2"
                     /note="Spike glycoprotein N-terminal domain; Region:
                     Spike_NTD; pfam16451"
                     /db_xref="CDD:293060"
     misc_feature    22351..23100
                     /gene="S"
                     /locus_tag="BtCoVBM48_gp2"
                     /note="Spike receptor binding domain; Region:
                     Spike_rec_bind; pfam09408"
                     /db_xref="CDD:286493"
     misc_feature    23341..25140
                     /gene="S"
                     /locus_tag="BtCoVBM48_gp2"
                     /note="Coronavirus S2 glycoprotein; Region: Corona_S2;
                     pfam01601"
                     /db_xref="CDD:279881"
     gene            25179..25994
                     /gene="ORF3"
                     /locus_tag="BtCoVBM48_gp3"
                     /db_xref="GeneID:9714825"
     CDS             25179..25994
                     /gene="ORF3"
                     /locus_tag="BtCoVBM48_gp3"
                     /codon_start=1
                     /product="ORF3 protein"
                     /protein_id="YP_003858585.1"
                     /db_xref="GeneID:9714825"
                     /translation="MDLFLNIFTLGSITRQPGKVENVSPASSFHSTASIPLQATLPFG
                     WLVVGVAFLAVFQSAAKLIPFNSLWQRCLYQSFQLLCNVLLIALTVYSHLLLVAAGLE
                     APFLYLLALIYFLQCVVFGRLLVRCWLCWKCKSKNPLIYDSNYFVCWHTHTHDYCIPY
                     NSITNTIVLTAGDGVTIPIRTQDYQIGGYFEKWESGVKDYLTLIGPFTEVYYQLESTQ
                     ISTDTGINNATFFLFSKNDEREQESVQVHTIDGSSGVVNPIYDEPTPTTSVPL"
     misc_feature    25179..25988
                     /gene="ORF3"
                     /locus_tag="BtCoVBM48_gp3"
                     /note="Coronavirus accessory protein 3a; Region:
                     APA3_viroporin; pfam11289"
                     /db_xref="CDD:288183"
     gene            26018..26248
                     /gene="E"
                     /locus_tag="BtCoVBM48_gp4"
                     /db_xref="GeneID:9714826"
     CDS             26018..26248
                     /gene="E"
                     /locus_tag="BtCoVBM48_gp4"
                     /codon_start=1
                     /product="envelope protein"
                     /protein_id="YP_003858586.1"
                     /db_xref="GeneID:9714826"
                     /translation="MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC
                     NIVNVSLVKPTFYVYSRVKSLNSSQEVPEFLV"
     gene            26299..26982
                     /gene="M"
                     /locus_tag="BtCoVBM48_gp5"
                     /db_xref="GeneID:9714827"
     CDS             26299..26982
                     /gene="M"
                     /locus_tag="BtCoVBM48_gp5"
                     /codon_start=1
                     /product="membrane protein"
                     /protein_id="YP_003858587.1"
                     /db_xref="GeneID:9714827"
                     /translation="MTNSSASPPTETITVEQLKHLLEQWNLVIGFLFFAWILLLQFAY
                     SNRNRFLYIIKLVFLWLLWPITLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFV
                     ASFRLFARTRSWWSFNPETNILLNVPLRGTILTRPLLESELVIGAVIIRGHLRMAGHS
                     LGRCDIKDLPKEITVATSRTLSYYRLGASQRVASDSGFAVYHRYRIGNYKLNTDHIGS
                     DDNIALLVQ"
     misc_feature    26332..26976
                     /gene="M"
                     /locus_tag="BtCoVBM48_gp5"
                     /note="Coronavirus M matrix/glycoprotein; Region:
                     Corona_M; pfam01635"
                     /db_xref="CDD:279907"
     gene            26993..27181
                     /gene="ORF6"
                     /locus_tag="BtCoVBM48_gp6"
                     /db_xref="GeneID:9714828"
     CDS             26993..27181
                     /gene="ORF6"
                     /locus_tag="BtCoVBM48_gp6"
                     /codon_start=1
                     /product="ORF6 protein"
                     /protein_id="YP_003858588.1"
                     /db_xref="GeneID:9714828"
                     /translation="MFSLVAFQVTVAELLILIMKSFGLALTHIQIGIVSLLKILTNRL
                     DRRYSKLDEEEPMEIDHP"
     misc_feature    26993..27175
                     /gene="ORF6"
                     /locus_tag="BtCoVBM48_gp6"
                     /note="Open reading frame 6 from SARS coronavirus; Region:
                     Sars6; pfam12133"
                     /db_xref="CDD:288948"
     gene            27188..27544
                     /gene="ORF7a"
                     /locus_tag="BtCoVBM48_gp7"
                     /db_xref="GeneID:9714829"
     CDS             27188..27544
                     /gene="ORF7a"
                     /locus_tag="BtCoVBM48_gp7"
                     /codon_start=1
                     /product="ORF7a protein"
                     /protein_id="YP_003858589.1"
                     /db_xref="GeneID:9714829"
                     /translation="MKFLLLVAIVSIASAELYHYQECARGTTVLLKEPCQPNTYEGNS
                     PYHPLADNKFAITCTNTKFSFVCQDETRHVFQLRARSISPRLFASPKHHSDDFTPVIL
                     IIVTLLFVIYCCMKRQ"
     misc_feature    27233..27448
                     /gene="ORF7a"
                     /locus_tag="BtCoVBM48_gp7"
                     /note="SARS coronavirus X4 like; Region: SARS_X4;
                     pfam08779"
                     /db_xref="CDD:285932"
     gene            27541..27663
                     /gene="ORF7b"
                     /locus_tag="BtCoVBM48_gp8"
                     /db_xref="GeneID:9714830"
     CDS             27541..27663
                     /gene="ORF7b"
                     /locus_tag="BtCoVBM48_gp8"
                     /codon_start=1
                     /product="ORF7b protein"
                     /protein_id="YP_003858590.1"
                     /db_xref="GeneID:9714830"
                     /translation="MIHLTLFDFYLCVLSLLLFLVIIMLIIFCFVLELQDLNEQ"
     gene            27665..28918
                     /gene="N"
                     /locus_tag="BtCoVBM48_gp9"
                     /db_xref="GeneID:9714831"
     CDS             27665..28918
                     /gene="N"
                     /locus_tag="BtCoVBM48_gp9"
                     /codon_start=1
                     /product="nucleocapsid protein"
                     /protein_id="YP_003858591.1"
                     /db_xref="GeneID:9714831"
                     /translation="MTDNGQSNSRNAPRITFGVSDTSDNNQNAERAGARPKQRRPQGP
                     PNNTASWFTALTQHGKEGLSFPRGQGVPVNTNSTRDDQIGYYRRATRRVRGGDGKMKE
                     LSPRWYFYYLGTGPEAALPYGANKDGIVWVATEGALNTPKDHIGTRNPNNNAAIVIQL
                     PQGTTLPKGFYAEGSRGGSQASSRSNSRSRGNSRNSTPSSSRGSSPARMAAGGDTALA
                     LLLLDRLNQLESKVSGKTPQQSQVVTKKTAAEASKKPRQKRTATKAYNVTQAFGRRGP
                     EPTQGNFGDQELIRLGTDYKNWPQIAQFAPSASAFFGMSRIGMEVTPTGTWLTYNGAI
                     KLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADEVQSLPQRQKKQATVTLL
                     PAADLDDFSKQLQNSMNASPDSTQA"
     misc_feature    27704..28759
                     /gene="N"
                     /locus_tag="BtCoVBM48_gp9"
                     /note="Coronavirus nucleocapsid protein; Region:
                     Corona_nucleoca; pfam00937"
                     /db_xref="CDD:279305"
     3'UTR           28919..29276
ORIGIN      
        1 tttaaaatct gtgtagctgt cacttggctg catgcccagt gcacttacgc agtatatctt
       61 ataaactttt actgtcgttg acaggacacg agtaactcgt ctatcttctg caggctgctt
      121 acggtttcgt ccgtgttgca gccgatcatc agcataccta ggtttcgtcc gggtgtgacc
      181 gaaaggtaag atggagagcc ttgtccctgg tttcaacgag aaaacacacg tccaactcag
      241 tttacctgtt ttgcaggttc gtgacgtgct cgtacgtgga ttcggtgaca ccgtagaaga
      301 ggctgtcgct gaagcacgcc aacatttaat tgaaggaaca tgtggcattg ttgatctcca
      361 gaagggtgtt ttaccccaac tggaacaacc ttacattttc cttaaacgct gtgatgcccg
      421 tactgctccc cacggccatg ttatggtcga attggtggca gagcttgatg gcgtccagta
      481 tggtaggagc ggagaatctc ttggtgtgtt agtcccgcat gtgggtgaaa caccaattgg
      541 ttaccgcaag gttcttgtcc gtaagaacgg taataaggga gccggtggtc acttgtacgg
      601 cgccgatcta aggttttacg atctaggtga cgaacttggc actgaccccc ttgatgactt
      661 ccaacaagat tggaatacta agcatggcag tgggcttcgc cgcgatctct ttagggagct
      721 caatggtggt gtctacacac gctatgttga taacaacttc tgcggaccag atggttatcc
      781 tctggaatgc ataaaagact tgcttgcgcg agctggcaag tcaagcgcac ctcttgctga
      841 acagcttgac tttttggagt ctaagagagg tgtgtactgt tgccgtgaac atgagcatga
      901 gattgcttgg tacacggagc gctctgataa gagctatgag cttcagacac cttttgacat
      961 tactaatgcc aaaaagtttg attctttcaa aggcgaatgt cctaaattcg tcttcccact
     1021 taattccaca gttaaagtct tgcaaccacg tgttgaaaag aagaagactg agggattttt
     1081 aggccgtatt cgtacggttt accaagttgc atcacctggt gagtgtaact ctatgcacct
     1141 gtctacctac atgaattgta accattgtgg tgaaaagtca tggcagacat gtgatttctt
     1201 aacagccact tgtgaaatgt gtggcaacca gaatactgtt gaagagggac ctaccacatg
     1261 tgggtatgta cctagtaatg ctgtagtaaa gatggtttgc cctgcctgtc agaacccaga
     1321 gattgggccc gaccatagtg tggcagatta ccacaacaac tcaaagattg aaactcgact
     1381 ccgcaaggga ggtaggatta aatcttttgg tggctgtgtt ttctcttatg ttggctgcta
     1441 caacaagcgt gccttctggg tgccgcgtgc cgcagccaat attggttcca accatactgg
     1501 cgttgtcggt gaaggagttg aaaccatgaa tgaggacttg cttcagatct taagtcgtga
     1561 acgtgttgtt atcaacattg ttggcgagtt ttgtctgaac gaggagattg ctatcttact
     1621 tgcttctctt tcagcgtcta ctagtgcttt tgtagagaca gttaaaaatc ttgattttaa
     1681 aactttcaag aaaatcattg agtcttgtgg taattataaa gtgaccaagg gcaagtttaa
     1741 acctggtgtc tggaatattg gcactagtaa atcattgctt acacctctgc attgcttttc
     1801 atcgcaggct gcaggtgtag ttcgctcaat cttctctcgc acacttgcta cagctaatca
     1861 ttcaattgta gacctgcaca gagctgctat gattattttc tctgatatat cagatcaagc
     1921 caatcgtgtg ctggatgcca tggtcaacac atctgactta gtcactgaaa gtgttgttgt
     1981 catggcttat ctcacaggtg gattggtgca acaggttagt acctggttga gccaattact
     2041 taatacttct gtagacaagt ttagcgcagt tttgcgctgg cttgagcaaa agctccaagg
     2101 tggcattgat tttcttcgtc aagcttgggg cattcttaaa cttctagtca ctggcgctta
     2161 tgtggttata agaggtaaaa ttcaagttgt taacactagt ctcatagagt gcgttacatc
     2221 atttgttgac gtcgttaaca aggtttttga gctctgtact gattacatta ctgttgctgg
     2281 tgctagagtg cgtgctataa attttggtga ggttttgatt gcgcaaagtc gaggcctcta
     2341 ccgtcagtgt gtacgtgcca gagatcagct tcagttgttg atgcctttaa aatcgccaaa
     2401 ggacgttgtt ttccttgacg gtgatgctta tgacacactt ttaacctctg aggaggtaac
     2461 agttaaaaat ggaactcttg aagcacttga tcttgaactc agtgacgtag ttactggtgt
     2521 tgcggaggga gtccctgttt gtgttaatgg tctaatgctc ttagaattga aggaaaagga
     2581 gcaatactgt gcattgtctc cttctctact tgcaactaat aacgtcttta cattaaaagg
     2641 aggtgcccct acaaagggag tcacatttgg tgaagacaca gttgtggaaa tccagggtta
     2701 taaaagtgtt aaaatcactt ttgagttgga tgaacgtgtt gataaagttc ttaatgagaa
     2761 gtgtgcatcc tatacagtag agaccggcac tacagctgaa gaacttgctt gtgttgtggc
     2821 tgagtctgtt gtaaagactt tacaaccaat ctctgaatta ctaacaccca tgggtatcga
     2881 ccttgatgaa tggagtgtag ctaaatttta cctgtttgat gagtctggtg aagcagttct
     2941 ttcatcacac atgtattgtt ccttctatcc tcctgacgaa gaggaagaag aagatttgga
     3001 agagtctgaa gatgtcgaat acggtactga agacgattac acaggcgccc cgctcgaatt
     3061 cggtgctagt agcactgttg agcaggacga ggtccatgat gaagaggaag actggcttgc
     3121 accacaggaa gagtccgaag tgttatatga ccagtttacc gattatcaca aactcacaga
     3181 caatgtcttc ataaagtgtg ctgatattgt tgaagagtct ctgaaagtca acccaacagt
     3241 tgtagtgaat gctgctaaca tacacttgaa acatggtggt ggtgttgcac gagcactaga
     3301 taaagcaact ggcggtagta tgcaaaaaga atctaatgat tacatttcta ctaatggtcc
     3361 tcttagagta ggaggttcct gtcttctctc aggccataac ttagctaaac attgtttgca
     3421 tgttgttggc ccaaataaaa atgcaggaga ggatattaaa ctccttgatg cagcctatga
     3481 gaacttcaat gcatatgaag tagttttatc accactactg tcagcaggta tctttggtgt
     3541 aagtcctatt caatcactag agacttgcaa gcgcgtggtg cgtaacacag tctacattgt
     3601 tgtaaacgac agtgtggtat ttgatcagct tttagccaaa acccctggaa agactaacga
     3661 gaggcctgtt gttgaatctt cagaaatttg tgaggaggtc aaccagaagc ctgttgttga
     3721 gttttcagaa actaaggagt tgcatgaaga gaccaatcag aagcttaagt cttcggaaga
     3781 gcctgttaaa acccgcattg aggagttgaa cacaactgtt gatgaggcta aatttctaac
     3841 cactaagttg ctattatatg cagatgtcaa tggtaatctt agtgaagatt caaaggtgtt
     3901 aattggcaat gatggcgcgt cctttaaaaa gggtgctcct tacattgttg gtgacatcat
     3961 tagcgaaggt gaattgacct gtgttgtttt accaactaaa gctgtgggtg gtacaactca
     4021 tatgcttact agggctctga agaatgtacc ttcagacacc tatcttacaa cctatcctgg
     4081 tcagggtgtt tcaggctaca ctttggatga agctaaagca gctcttaaaa agtccagatc
     4141 agtcttttac atattacctt cagcaaatgt taatgctaag gaagaggttt taggcactgt
     4201 tgcctggaac ttgcgtgaaa tgttagctca cgctgaggaa actaggaaag ttatgccagt
     4261 ctgtatggat gttagggcga ttatttccac aattcagcgt aagtataaag gaattggaat
     4321 acaggaaggt cttgtagatt ataaagtaag attttacttt tactctagca aaacacctat
     4381 tgctagggta atctcaaacc ttaattctct tggagagccc ctgattacta tgcctttggg
     4441 ctatgtcaca catggactca atttagaaga atcagcgcgc tacatgcgtt ctgttaaggt
     4501 tcctgttgta gtttctgtgt cttcacctga tgcagtcact tcttacaacg gttatgttac
     4561 atctgcttct aagagtgctg aagaacactt tattgaaaca gtttccttag cgggttcata
     4621 caaggattgg tcatattctg gccaacgtac tgaacttggt gttgaattcc tcaagagagg
     4681 tgacaaaatt gtctaccata cagtaggaaa tgttatagaa tttcacatgg aaggtgaagt
     4741 tcttcctctt gagaagttaa aaactctctt agctttaaga gaggttaaaa ctattaaggt
     4801 gttcacaact gtagataaca tcaacttaca cacacaagtc attgatatgt ctatgactta
     4861 tggacaacag ctaggaccca cctatatgga cggtgctgat cttactaaag tcaaacctca
     4921 tgctagtcat gagaacaaga ctttctttgt cctacctagt gatgatacgc tacgtattga
     4981 agcttttgag tactatcata ccgtagacga gagttttttt ggtagataca tgtcagcatt
     5041 aaaccatact aaaagatgga agtatcctca agttggtggt ttaacatcta taaaatgggc
     5101 agataacaat tgttacttgt ctagtgttct tttgtcacta caacaaattg acattaagtt
     5161 taatgcacca gcacttcagg atgcttatta tagagcgcgt gctggtgatg ctgctaactt
     5221 ctgtgcactt gtgctcgcat acagcaagaa gactgtaggt gagctgggtg atgtacgtga
     5281 aacaatggcc catttattac agcatgcaaa cttagagtcc gctaaacggg ttcttaatgt
     5341 tgtgtgcaaa cactgtggac agaaaagcac tacacttagt ggtgttgaag ctgtcatgta
     5401 catgggaacc ctctcttatg atcatcttaa gagaggtgtt aagatacctt gtgtatgtgg
     5461 tcgtgaagct acacaatact tagtgaaaca agagtcaact tttgttatga tgtcagctcc
     5521 acctgcagag tacactcttc aaaccggtga gtttttgtgt gctaatgagt acactggtaa
     5581 ttaccagtgt ggtcattata cacatattac aaatagagaa actatctata aaattgatgg
     5641 tgctctcttg actaaaatta ctgaatataa gggtcctgtt gctgatgttt tctataagga
     5701 aacatcctac agtacagata taaaacctgt gtcatacaaa ctcgatggag tgacttacac
     5761 agagataaat ccagatctaa atgggtatta caaaaaggac aatgcttact atacagaaca
     5821 gcctattgac cttgtaccaa ctcaaccttt gcctaatgca agttttgaca atttcagatt
     5881 tgtttgtgct aacaccaaat ttgctgatga cttgaaccag atgactggct ttaaaaagcc
     5941 tccatctagg gatttaacaa ttacgttctt ccctgatttg aatggtgatg tggttgctat
     6001 tgattataga cactacacac ctactttcaa aaagggtgct aaacttgtcc ataagccaat
     6061 actgtggcat gttaatcaga ctactactaa gtcaacgttt aaacccaata tgtggtgtct
     6121 gcgttgtctt tatagtacaa agcctgttcc cacttcaaat tcgtttgagg tgttaagttc
     6181 agatgacgca caaggaatgg acaatcttgc ttgtgaaagt caacaaactg tcgctgaaga
     6241 agtagtggat aatcctacca tacagaaaga catcatagag tgtgacgtga aaactaccga
     6301 agttgtaggc aatgtcatac taaaaccatc agcagatggc attaaagtta catcagagtt
     6361 ggaacatgag gatcttatgg ctgcttatgt gaatgaaact agcattacca ttaagaagcc
     6421 caatgagctt tctatcatgt tgggtttaaa aacaattgct acacatggtg ctgctgctat
     6481 taatagtgta ccctggatta agatttgtgc ttatgtcaag ccctttcttg gttacgttgc
     6541 agagcaatct aagaattgta ttaagcgctg ttttaggcgt gtttttaatg attatatgcc
     6601 attcttgttg acgcttttat tgcaattatg cacttttact aagagtacaa attttagaat
     6661 aaaagctgct atgcccattg ttatagctag aaatagtgta ataggtggtg ttagattttg
     6721 tctagatgct ttgactatgt atgttaaatc acctaagttt tctggaatac tcactgttgt
     6781 tatgtggtta ttattattaa gtgtctgctt aggatgttta gtctatgcag tagcttcttt
     6841 tggtgccatc ttatctggtt ttggtctgat gtcttattgt gatggcgtta gggcgggtta
     6901 tgttaactcg tctaatgtca ctattcctga ctactgcgca ggcagtttac cttgtggtgt
     6961 ttgtttgggt ggtttggatt ctttagatgc atacccagct ttagagacga ttcaggttac
     7021 catttcttcc tacaagttag acttgacttt tgtgggaatg atggctgaat ggtttttggc
     7081 atatatgttg tttactaaat ttttttattt attaggtctc tttgccttaa tgcagttgtt
     7141 tttcggtctt tttgctacac actttgtgaa taattcctgg ttaatgtggc ttattataaa
     7201 tgtagtgcaa atggctccca tttctgctat ggttagaatg tatgtgttct ttgcctcttt
     7261 ctactatgtg tggaaagctt atatacacgt tattaatggc tgtacatcat ccacttgtat
     7321 catgtgttac aagcgtaatc gtgcaacacg tgttgaatgc accaccattg tcaacggcat
     7381 gaagaagtcc ttctatgttt atgctaatgg tggtcaaggt ttttgcaaac ttcacaactg
     7441 gaattgtttg aattgtgaca ctttctgttc tggaagtaca tttatcagtg atgaggtagc
     7501 acgtgaccta tcattacagt ttaagagacc tattaatcca acagaccagt cttcttacaa
     7561 tgttgatagt gttacagtaa aagatggtac actctacttg tattttcaga aggctggtaa
     7621 actcacctat gagagacatc cactttctta ctttgttaat ttggacaacc tgagagctaa
     7681 taacgttaaa ggcactttgc ctattaatgt tatagttttt gatggtaagt ctaaatgtga
     7741 agaagctgct gctaaatctg catctgttta ctatagtcag ttgatgtgtc aacctatatt
     7801 actattagac caagctctta tttctgatgt tggcgatagt actgaagtgg ctgttaaaat
     7861 gtttgatgcg tatgttaatg cattctcatc aacatttaac gctcctatgg aaaaactaaa
     7921 gacattcatt gcgacagccc atgctgaaat agctaaaggt gtttctttgg atagtgtttt
     7981 gtctacattt ttgtctgcag ccagacaagg atttgtggat tctgatgtag acactaagga
     8041 tgtcatggag tgtcttaaac tgtcacacca ttctgatttg gagattacga gtgacagttg
     8101 taacaatttt atgcttactt acaacaaggt tgaaaacatg acacctagag atctaggtgc
     8161 ctgcattgat tgtagtgcgc gtcatattaa tgcacaagtg gcaaagagtc acaatgtttc
     8221 ccttgtttgg aatgtaaagg actatatgtc tttgtcagaa cagctacgta aacaaatacg
     8281 tagtgctgcc aaaaagaaca atataccatt taaactcact tgtgctacta ctagacaagt
     8341 tgtgaatgtt ataacaacaa aaatatcact aaaaggtggt aagtttgtta gcaataattg
     8401 gtttaggttc ctactcaaaa tgacagtttt gatggtattg gttgccttta tcttctattt
     8461 tattacaccc acccatactt taatgggtca tgatgtgttt tcttctgaaa ttatcggtta
     8521 taaagcaata cataatggtg ttaccagaga tgtgttgacc accgatgatt gttttgctaa
     8581 caagcacact ggctttgacc attggttcag tcagcgtggt ggttcatata gaaatgacaa
     8641 gacctgccct gttatagcgg ctgttattac gcgtgaggta ggctttatag tacctggtct
     8701 tcctggtact gtaaggcgtg cttccaatgg tgactttttg catttcttac ctagagtttt
     8761 tagcgctgtt ggtaacattt gttacacgcc agcgaaatta atagagtata ctgactttgc
     8821 aacttcagcc tgcgtgcttg ctgctgaatg tactatcttt aaggatgctc aaggtaaacc
     8881 tgtaccttat tgctatgata ctaatttgct tgagggttct atttcttata gtgagttacg
     8941 ccccgacact agatatgtgt taatggatgg ctcaattata caattcccta gcacttacct
     9001 tgaaggttct gtgagagtgg taacaacttt tgattctgaa tactgcagac atggtacttg
     9061 cgaacgatca gacgcgggtg tgtgtttgtc tactaatggt agatgggttc ttaataatga
     9121 ttattatcga tccattccag gtgtcttttg tggtgctgat gcttcagact tactctttaa
     9181 catcttcaca cctcttgtta gaccagtagg cacacttgac atttcagctt ctgttgtagc
     9241 aggtggcctt atagccatcc ttgttacatg tgttgcttac tactttatga agtttaggcg
     9301 tgcgtttgga gagtacaacc atgttgtctt tgctaatgca cttttgtttt tactgtcttt
     9361 tactatactc tgtttgacac ctgcgtacac atttttacca ggtatctatt cattgcttta
     9421 cttgtacttg accttctatt ttactaatga cgtgtctttc ttggctcacc tgcaatggct
     9481 agctatgttc tcaccaatag tgcctttctg gataacagtc acttatgttg tctgtatttc
     9541 tattaagcat tgccattggt tctttagtaa ttacctcaag aagagagttg tttttaatgg
     9601 agttacattt agcacttttg aggaggctgc tctgtgtacc tttcttttga ataaggaaat
     9661 gtatcttaaa ttgcgtagtg agacactttt gccacttaca caatataata gataccttgc
     9721 tctttataat aagtacaagt attttagtgg agctttagac acaactagct atagggaagc
     9781 tgcatgctgt cacttagcga aagctctaaa tgacttcagt aactctggtg ctgatgttct
     9841 ataccaacca ccacagactt ctattacctc agctgtttta cagagcggtt ttagaaagat
     9901 ggcattcccc tcaggcaaag ttgagggatg tatggtacag gtcacatgtg gaacaacaac
     9961 cctgaacggt ttgtggttag acgatgtggt ctattgccct agacatgtta tctgcacact
    10021 agaagatatg cttaacccaa attatgatga cttacttatt agaaagtcta accataattt
    10081 ccttgtgcag gctagtaatg tgcaattgcg tgttattggc catactatgc agaactgctt
    10141 gctcaaactt aaggttgaca tagctaatcc taaaacacct aagtataagt ttgtacgtat
    10201 tcaacctgga cagacttttt cagtgttagc ttgctacaat ggtgcaccct cgggtgttta
    10261 ccagtgtgca atgaggtcca accacactat taagggttca ttccttaatg gttcttgtgg
    10321 tagtgttggt tttaacattg actatgactg cgtgtccttc tgttacatgc accatatgga
    10381 gcttcctaca ggagttcatg ctggtacaga cttggaaggt aacttctatg gaccatttgt
    10441 tgatagacaa acagcacaag cagcaggaac tgatacaacc attacactta atgtgttggc
    10501 ttggctctat gctgctgtta ttaatgggga aagatggttc cttaataggt ttacaactac
    10561 cctaaatgat tttaatcttg ttgctatgaa gtacaactat gaacctctaa cacaagatca
    10621 agttgacatc cttggaccgc tttctgccca aactggagtg gctgtcatgg atatgtgtgc
    10681 agcactgaaa gaattgttgc aaaatggctt aaatggtcgt accatactcg gtagtaccat
    10741 tttagaagat gagtttacac cttttgacgt tgttagacaa tgctcaggtg taacctttca
    10801 aggtaaattc aagaaagtcg tcaaaggtac ccatcattgg ttgctgttga cactcttgac
    10861 ttctttgtta atacttgtcc aaagtacaca gtggtcactg tttttctttg tgtatgaaca
    10921 tgcctttttg ccgtttacaa tgggtgttgt gtgttttgct gcatgcgcta tggttcttgt
    10981 taagcataag catgcatttt tgtgtttgtt tttgttacct tccttaataa ctgttgctta
    11041 ttttaatatg atctacatgc ctgctagttg ggttatgcgt gtcatgacat ggttagattt
    11101 agtcgacacc agcttgtctg gttatagact taaggactgt gttatgtatg cgttagctgc
    11161 tttcttactc atccttatga cagctcgtac tgtttatgat gatgctgcta gacgtgtttg
    11221 gacagttatg aatgttataa cacttgtcta caaggtctac tatggtaatt cgcttgatca
    11281 agcacttgct atgtgggctc ttgttatttc tgtaacctct aactattctg gtgtcgttac
    11341 gactatcatg tttttagcta gagctatagt gtttttgtgt gttgagtatt atcctatttt
    11401 gtttattact ggcaacacct tacagtgtat aatgcttgtt tattgtttct tgggctattg
    11461 ttgctgttgt tactttggtc ttttctgttt actcaaccgc tatttcagat taactcttgg
    11521 tgtgtatgac tattttgtct ccacacaaga gtttaggtat atgaattcac agggactttt
    11581 acctcctaag actagtttgg atgcctttaa actcaatgtt aaattattgg gtattggagg
    11641 taagccttgt attaaagtgg ccactgttca gtctaaaatg tctgatataa agtgcacttc
    11701 tgttgtattg ctttcagttc tacaacaact tagaattgaa tcctcatcca aattgtgggc
    11761 acagtgcgtg caattgcaca atgacatctt acttgctaag gatacaactg aggcatttga
    11821 aaagatggtc tcattgttat ctgttctgct ttctatgcaa ggcgctgtag atattaataa
    11881 gttgtgtgat gaaatgctca acaatcgtgc tactttacaa gccattgctt cagagtttag
    11941 ttctctacca tcttatgcag cttatgctac agcccaggag gcttatgagc aggctgttgc
    12001 taatggagac tctgaagttg ttcttaagaa attgaaaaag tctttaaatg tggctaaatc
    12061 tgaatttgac agggatgccg ccatgcaacg taagttggaa aagatggcgg accaggccat
    12121 gacccaaatg tacaagcagg ctagatctga agacaagagg gcaaaagtta ctagtgccat
    12181 gcagacaatg ctattcacta tgcttagaaa gcttgataat gatgctttga acaatattat
    12241 taacaatgca cgtgatggtt gtgtaccact caacatcata ccattgacaa ctgcagccaa
    12301 actcatggtt gttgtccccg attataacac ctacaagaat acttgtgatg gcaacacatt
    12361 tacgtatgct tccgctctct gggaaatcca gcaggttgtg gatgcagata gtaaagttgt
    12421 tcagttgagt gaaattaaca tggacaattc tcaaaacctt gcttggcctc ttattgttac
    12481 agcattgagg tccaattctg cagtcaaatt acagaataat gaactgagtc ctgttgcact
    12541 gcgccagatg tcgtgtgccg caggtactac acaaacagct tgcactgatg acaatgcact
    12601 tgcctattac aacacttcta agggaggtag gtttgtgctt gcattattat cagaccacca
    12661 agatctcaaa tgggcacgtt tcccaaagag tgatggtaca ggtactatat acacagaact
    12721 ggaaccacca tgtaggtttg ttacagacac accaaaaggc cctaaagtga agtacttgta
    12781 ctttatcaag ggccttaaca acctaaatag aggtatggta ctgggtagtt tagctgctac
    12841 agtacgttta caagctggca atgctacgga agttcctgcc aattctactg tgctttcttt
    12901 ttgtgcgttt gctgtggatc cagctaaggc atataaagat tacctagcta gtggtggaca
    12961 accaattacc aattgcgtaa agatgctgtg cacacacaca ggtacaggac aggctataac
    13021 tgtaatacca gaagccaata tggaccaaga gtcctttggt ggtgcttcat gttgcttgta
    13081 ttgtagatgc cacattgatc atccaaatcc taagggattt tgtgacttga agggtaagta
    13141 tgtccaaata cctaccacat gcactaatga ccccgtgggt tttattctta gaaacacagt
    13201 ctgtactgtc tgcggtatgt ggaaaggtta tggctgtagt tgtgatcaac tccgcgagcc
    13261 cgtgatgcag gcagctgatg ccccagcgtt tttaaacggg tttgcggtgt aagtgcggcc
    13321 cgtcttacac cgtgcggcac aggcacaagc actgatgtcg tttacagggc ttttgatatt
    13381 tataatgaga aagttgctgg ttttgcaaag ttcctaaaaa caaattgttg ccgtttccag
    13441 gaagttgatg aagagggcaa cttattagac tcctattttg ttgttaagag acatactatg
    13501 tctaattatc aacatgagga gactatgtat aatttagtta aagagtgtcc agctgttgct
    13561 gtgcacgact tctttaaatt tagagtagat ggtgacatgg taccacacat atcacgccag
    13621 cgtcttacta aatacacaat ggcagactta gtctatgcac ttcgtcattt tgatgaaggt
    13681 aattgtgaca ccttaaaaga aatattagtc acatacaatt gttgtgatga cgcatatttc
    13741 aataaaaagg attggtacga ctttgtggaa aatcctgata tactacgcgt atacgcatgc
    13801 ctaggtgagc gtgtgcgcca agctttgtta aagactgtac agttctgcga tgccatgcgc
    13861 gatgcgggca ttgttggtgt actcaccttg gataatcaag atctgaatgg gaattggtac
    13921 gatttcggtg acttcgtaca agtggcacca ggtgcaggta ttcctattgt agattcttat
    13981 tattcattgc tgatgcccat tcttacgtta acgaaggcat tggcagccga gtcccatatg
    14041 gactgtgata ctacaaagcc tctcattaag tgggacttgt tgaagtatga tttcacggaa
    14101 gaaagattat gtctttttaa ccgttatttc aagtattggg atcaaacata ccaccctaat
    14161 tgtattaact gtttggatga taggtgtatc ctacactgtg caaactttaa tgttttattt
    14221 tccacggtgt ttccgccaac aagttttggc ccacttgtga gaaaaatttt tgtggatggt
    14281 gttccttttg ttgtatcaac aggctaccat ttccgtgagt tgggagttgt acataatcag
    14341 gatgtaaact tacacagctc acgtctcagt tttaaggaac ttttagtgta cgctgctgat
    14401 cctgctatgc atgctgcatc aggcaacctg ttgcttgata aacgcactac atgcttttca
    14461 gtggctgcac tgacaaatag tgttgctttt caaactgtca aacctggtaa ttttaataaa
    14521 gacttttatg actttgctgt gtctaaaggt ttcttcaagg aaggaagttc tgttgaattg
    14581 aaacacttct tctttgcaca ggatggcaat gccgctatta gtgattatga ttactatcgt
    14641 tataatcttc ctacaatgtg tgacatcaga caactgcttt ttgtggttga ggtggtcgac
    14701 aaatactttg attgttacga tggcggttgc ataaatgcta accaagtcat tgttaacaat
    14761 ttggataaat cagctggatt cccctttaat aaatggggaa aggctagact ttattatgat
    14821 tctatgagtt atgaagatca ggatgcgttg ttcgcttata ctaagcgcaa tgtgatccct
    14881 accattactc agatgaatct taaatatgcc attagtgcta agaatagagc gcgcaccgta
    14941 gctggtgttt ctatctgtag cactatgacc aatagacagt tccatcagaa attattaaag
    15001 tctatagccg ctacaagagg tgccacagtt gtaataggca ctagtaaatt ctatggtggc
    15061 tggcataaca tgttaaaaac tgtttacagt gatgttgaaa ctcctaacct tatgggttgg
    15121 gattacccaa aatgtgatag agccatgcct aacatgctta ggataatggc atcacttgtt
    15181 cttgctcgca aacatagtac ttgttgtaac ctttcacacc gtttctacgg gttagctaat
    15241 gagtgtgctc aggtacttag tgaaatggtt atgtgtggcg gttcactcta tgtgaaacca
    15301 ggcggtacat cttcaggaga tgccaccact gcttatgcta atagtgtctt taacatttgt
    15361 caagctgtta cagctaatgt taatgcactt ttgtctactg atggtaataa aattgctgac
    15421 aagtatgtcc gcaatttaca acatagactt tatgaatgtc tctatagaaa tagagacgtt
    15481 gatcatgaat ttgtagaaga attttacgct tatttgcgta aacacttttc tatgatgatt
    15541 ctctctgatg atgctgttgt ttgctataat agcaactatg cagctcaagg tttagtagct
    15601 agcattaaga actttaaagc agttctttat tatcaaaaca atgtttttat gtctgaggca
    15661 aaatgctgga ctgagaccga ccttactaaa ggacctcatg aattttgctc tcagcataca
    15721 atgctagtta aacaaggaga tgattacgtg tacctgcctt acccagaccc atctagaatt
    15781 ttaggcgctg gttgttttgt tgatgatatc gtcaaaaccg atggtacact tatgatagaa
    15841 cggtttgtgt ccctagcgat agacgcctac ccacttacaa agcaccctaa ccaggagtac
    15901 gctgatgtct tccatttgta tttgcaatac attaggaagt tgcatgatga gcttactgga
    15961 cacatgttag acatgtattc agtcatgcta acaaatgata acacttctag gtattgggaa
    16021 cctgagtttt atgaggctat gtacacacca catacagtct tgcaggctgt aggcgcgtgt
    16081 gtgttatgca attcacagac ttcacttcgt tgcggctcat gcatcagacg accattcctg
    16141 tgttgcaagt gctgctatga ccatgtcatt tcgacttcgc ataaattagt gctgtccgtt
    16201 aatccctatg tttgcaatgc ccccggttgt gatgtcacag acgtgacgca actttattta
    16261 ggaggtatga gctactactg caagtcgcac aagccaccta ttagctttcc tttgtgtgct
    16321 aatggtcagg tttttggtct ttataagaac acttgtgttg gcagcgataa cgtaactgat
    16381 ttcaatgcca tagccacatg tgactggact aatgccggtg attacatact tgctaacacc
    16441 tgcactgaga gattgaaact ctttgctgct gaaactttaa aagctaatga agagacattt
    16501 aaactatcct atggcatcgc cactgtgcgt gaagtgctgt ctgatagaga attacatcta
    16561 tcttgggaga ttgggaagcc tcgacctccc ttgaatagaa attatgtctt tactggctat
    16621 agagttacta agaacagtaa agtgcagata ggagagtaca cctttgaaaa aggtgactat
    16681 ggtgatgctg ttgtgtatag aggtactaca acttataagt taaatgtggg cgattacttt
    16741 gtgttaacat cacacactgt aatgcccttg actgcaccta ctttagtgcc acaagagcac
    16801 tatgtgagaa taactggctt ataccctaca cttaacatct ctgatgagtt ttctagcaat
    16861 gttgctaact atcaaaaagt aggtatgcag aagtattcta ctttgcaagg accaccaggt
    16921 acaggtaaga gccactttgc cattgggttg gcattgtact atccatctgc acgcatagtc
    16981 tacacggcat gctcacacgc ggctgtggat gctctatgcg agaaggcgct aaaatacttg
    17041 ccaatagaca agtgtagcag aataatacct gcgcgagctc gcgtggagtg cttcgacaaa
    17101 ttcaaggtta attcaacact tgaacagtat gttttctgta cagtcaatgc gctgcctgaa
    17161 actactgctg atattgtagt ctttgacgag gtttcaatgg ccacaaatta tgacttgagc
    17221 gtcgttaatg ctagattacg tgctaagcat tatgtctaca ttggtgatcc tgctcaatta
    17281 cctgcaccac gcacattgct tacaaagggc acactagaac ctgaatattt taactctgtg
    17341 tgtcgtctaa tgaaaacaat aggtcccgac atgttccttg gtacgtgtcg ccgatgtcct
    17401 gctgaaatag tcgacactgt cagtgcttta gtttatgata ataaacttag ggcacataaa
    17461 ggcaagtcat cacaatgttt taaaatgttt tataaaggag tgattacaca tgacgtgtca
    17521 tctgcaatca acagaccaca gattggcgtg gttagagaat ttctgacacg caaccctgct
    17581 tggagaaaag ctgtttttat ttcaccttat aactcacaga atgctgtggc ttcaaaaata
    17641 cttggactgc ctacgcaaac tgtagattct tcacaaggtt ctgaatatga ctacgtcata
    17701 tttgctcaga ccacagaaac agctcattca tgcaatgtta atagatttaa tgttgctatt
    17761 acaagagcca aagtaggtat tttgtgcata atgtccgata aggacctcta tgataaatta
    17821 caatttacta gtctggaagt cccacgtaga agtgtggctg tattgcaatc agagaatgta
    17881 actggacttt ttaaggactg tagtaagcta ataactggct tacatcctac acaagcacct
    17941 acatacctta gtgttgatac taaattcaaa actgaaggtt tgtgtgtcga cataccagga
    18001 ataccaaagg acatgaccta tcgtaggctc atctctatga tgggttttaa aatgaactac
    18061 caagttaatg gttaccctaa catgtttatt acccgtgatg aagcaatcaa gcatgttcgt
    18121 gcttggattg gctttgatgt agagggttgt catgcaacta gggatgccgt aggtacaaac
    18181 ctaccactcc agttagggtt ttcaactggt gttaacttag tagctgttcc tacaggctat
    18241 gttgacacaa gtgcagccac agagttctct agagtaaatg caaaaccacc acctggggac
    18301 cagtttaaac atctaatacc gcttatgtac aagggtttac cttggaacat agtgcgtgtt
    18361 aagattgtac aaatgcttag tgatacacta aaagaccttt cagatagagt cgtgttcgtc
    18421 ctttgggcac atggctttga acttacttca atgaagtatt ttgtcaagat tggaccagaa
    18481 cggacgtgtt gtctgtgtga caagcgcgca acttgctttt caacttcatc agatacatac
    18541 gcttgctggc accactctgt gggttttgac tatgtctata atccatttat gattgatgtc
    18601 cagcagtggg gatttactgg caatttgcag agtaaccatg accaacattg ccaagttcat
    18661 ggcaatgcac atgttgctag ttgtgatgcc atcatgactc gttgtcttgc cattcacgag
    18721 tgctttgtga agcgcgtgga ttggtctgta gaatacccta ttataggtga cgagctgaga
    18781 attaatgtag catgcagaaa agtacaacat atggttgtaa agtctgcttt gcttgcggat
    18841 aagtttccag ttcttcacga tattggtaat ccaaaggcta taaagtgtgt ccctcaggct
    18901 gatgtagaat ggaagttcta cgatgtgcaa ccttgtagtg acaaagctta caaaatagaa
    18961 gagttgttct attcttatgc aacccatcat gataaattta cagatggcgt gtgtttgttt
    19021 tggaactgta acgtggatcg ttacccttct aatgcaattg tttgccggtt tgatactaga
    19081 gtgttatcta acttgaatct gcctggctgt gatggtggta gtttgtatgt aaataaacat
    19141 gcattccaca cacctgcctt tgataaaggt gcttttgcta acttgaagca attaccattt
    19201 ttctattatt ctgacagtcc ttgcgagtca catggtaagc aagtcgtgtc agacattgat
    19261 tatgtgcctc ttaaatctgc tacgtgtatt acacgatgca acttaggcgg tgccgtttgt
    19321 cgtcatcatg catctgagta cagacagtat ttagatgctt ataacatgat gatttcggcc
    19381 ggctttagcc tttggattta caagcagttt gacacttata atctctggaa tacctttact
    19441 aggttacaga gtttagagaa tgtggcttac aatgttgtta ataaaggaca ttttgatggt
    19501 caagctggtg aaaaaccagt ttccatcatt aataataccg tctacacaaa ggtggatggt
    19561 gttgatgtag aaatctttga aaataaaacg actttgcctg ttaatgttgc atttgagctt
    19621 tgggctaaac gtaacattaa acctgttcca gaaataaaga tactcaataa tttgggtgtt
    19681 gatattgctg ctaatactgt tatttgggat tataaaagag aatcaccagc ctatatttca
    19741 acaataggtg tctgtacaat gactgacatt gctaagaaac ctactgaaaa cgcttgttcc
    19801 tcactcaccg tcttttttga tggtagagtt gatggacagg ttgattcttt tagaaatgca
    19861 cgtaatggtg ttttaattac agaaggctca gtgaaagggt taaacccttc taaggggcca
    19921 ccacaggcta gtcttaatgg agtcacattg attggagaat ctgtaaaaac acagtttaat
    19981 tactttaaaa aagtagatgg cgttgttcaa caactgccag aaacctactt tactcagagc
    20041 agaagtttag atgatttcaa acccaggtca caaatggagg ttgatttcct acaacttgca
    20101 atggatgaat tcatagagcg gtataagctc gagggttacg cctttgagca tatcgtctat
    20161 ggagatttta gtcatggaca attaggtggg ctacatctta tgattggtct cgccaaaagg
    20221 tctttagaat cactactgaa acttgaggat tttatcccga ttgacagtac tgtgaaaaat
    20281 tattttgtaa cggatgcaca aacaggttca tctaaatgtg tgtgctctgt cattgatctt
    20341 ttacttgacg attttgttga aataataaaa tctcaggatt tgtctgtcgt ttcaaaagtg
    20401 gtcacggtca ccattgacta tgctgaaatt tcatttatgc tttggtgtaa agatggacat
    20461 gttgagacat tttacccaaa actgcaagca aatcaaacat ggcaacctgg tgtcgccatg
    20521 cccaatttgt ataagatgca aagaatgctt cttgataagt gcgaccttca caattatggt
    20581 gaaaatgctg tgataccaaa aggaataatg atgaatgtcg ctaaatatac tcaactgtgt
    20641 caatatttaa atacacttac tatagcagtg ccttataaca tgcgagttat acattttggt
    20701 gcgggatctg ataaaggtgt cgcaccaggc tctgctgtac tcaaacaatg gttgccagtt
    20761 ggcacgttgt tggttgattc agacataaat gattttgtgt ctgatgctga ttctacatta
    20821 ataggagact gctctactgt ttatacagct aataaatggg atcttattat tagtgatatg
    20881 tacgatccga agacaaagca catattaaaa gaaaacgact ccaaggaagg atttttcact
    20941 tacttatgtg gttttattaa acaaaagctt gccttgggag gttccgtggc tataaagata
    21001 acagaacatt cttggaatgc cgatctttat aagctcatgg gatatttctc atggtggact
    21061 gcttttgtca ctaatgtaaa cgcttcttct tcagaggctt tcttaatagg tgttaactac
    21121 cttggtaaac agaaagaatc cattgacgga tataccatgc atgctaacta catattttgg
    21181 aggaacacaa accctataca attgtcttcc tactctcttt tcgacatgag taaattccca
    21241 ctaaagctta ggggaactgc tgtcatgtcc ttaaaagata atcagatcaa cgatatgatc
    21301 tgttctcttt tagaaaaggg tagacttatc attagagaga ataataaagt tgttttctct
    21361 agtgatgtcc tagtaaataa ttaaacgaac atgaaatttt tggcttttct ctgtcttctt
    21421 ggctttgcta acgctcaaga tggcaagtgt ggtacactat ctaataaaag tccatctaag
    21481 cttactcaga ctccttcttc taggaggggt ttttattatt ttgatgacat ttttaggtct
    21541 tcaattcgtg tgcttaccac tggccatttt cttcctttta atactaacct tacttggtat
    21601 ttgactttaa agtctaatgg taagcagagg atttattatg ataatcccaa cattaacttt
    21661 ggtgatggtg tttattttgg tctaaccgag aaatctaatg tttttcgagg ttggattttt
    21721 ggttcgacat tagacaacac aactcagtct gctgttctct ttaataatgg tacacacatt
    21781 gttatagatg tgtgtaactt taatttttgt gctgatccaa tgtttgctgt caatagtgga
    21841 cagccttata aaacctggat ttatactagt gcggctaatt gcacttacca cagagcacat
    21901 gcatttaata ttagcactaa tatgaatcca ggtaagttta aacattttag ggagcacctg
    21961 tttaagaatg tagacggctt cctatatgtc tatcataact atgaacccat tgatcttaac
    22021 agtggttttc cttctggctt ttctgtttta aaaccaatac ttaagctgcc ttttggtctc
    22081 aacattacat atgttaaggc cataatgaca ttgttttctt ccactcaaag taattttgat
    22141 gctgacgctt ctgcttactt tgtgggccat ctaaaacctc tcaccatgct tgttgacttt
    22201 gacgagaatg gcaccattat tgatgctata gattgctctc aagatccact ctcagagctt
    22261 aagtgtacca ctaagagttt tacagttgaa aaaggaattt atcaaacctc taacttccgt
    22321 gttacaccaa ccactgaagt tgttaggttt cctaacatta cacagctttg tccttttaac
    22381 gaagttttca atataacctc tttcccatcc gtttacgcgt gggagagaat gcgcattact
    22441 aattgtgttg cggactactc agtgctttac aattcttctg cctccttctc aacatttcag
    22501 tgttatggcg tttcacctac aaagctcaac gatttatgct ttagcagtgt ttacgcagac
    22561 tactttgttg tgaagggtga tgatgtacgc caaattgcac ctgctcagac aggtgtgatt
    22621 gctgattaca attacaaatt gcctgatgat tttacaggtt gtgtaatagc ctggaataca
    22681 aattctttgg acagttccaa cgaattcttt tacaggagat tcagacatgg aaagattaaa
    22741 ccttatgggc gtgacctttc caatgttctt tttaaccctt caggtggtac atgttcagct
    22801 gaaggtctta attgttacaa accacttgcc tcctatggat ttacacagtc ctctggaatt
    22861 ggctttcaac catacagagt ggttgtgctt tcttttgagt tgttaaacgc acctgctaca
    22921 gtttgtgggc ctaaacagtc tactgagcta gttaagaaca agtgtgttaa cttcaatttc
    22981 aacggactta caggcactgg tgtgcttact aattctacta aaaagttcca accttttcaa
    23041 cagtttgggc gtgacgtttc agattttacg gactccgtca gagaccctaa aacccttgag
    23101 attcttgaca ttgcaccttg ttcatacggc ggtgtcagtg ttataactcc tggtacaaat
    23161 gcttctagtt cagtggctgt tttgtatcag gatgttaatt gtacagatgt gcctactatg
    23221 ttacatgctg atcaaatttc tcatgattgg cgtgtgtatg ccttccgtaa tgatggcaac
    23281 atattccaaa cacaggctgg ttgtttgatt ggtgctgctt atgacaactc atcttatgag
    23341 tgtgatattc ctataggagc tggcatttgt gctaagtata cgaatgtttc tagcacactt
    23401 gtgcgctccg gtggacactc catactagct tacaccatgt ctcttggtga caatcaagac
    23461 attgtttatt ctaacaacac cattgctatt ccaatgaatt ttagtattag tgtcactact
    23521 gaggtcttgc ctgtttcaat gactaagact tcagtagatt gtaacatgta tatttgcggt
    23581 gactccactg aatgcagtaa tttgctgcta cagtatggta gtttctgcac gcagttaaac
    23641 agagctcttg ccggtatagc tgtggaacaa gacagaaata ctcgagatgt ctttgcacaa
    23701 actaaggcca tgtacaagac tccttctttg aaggattttg gtggttttaa tttttcacag
    23761 attttgccag accccgctaa accgtctagt agatctttta ttgaggactt gctttacaac
    23821 aaagtcacac ttgctgaccc aggttttatg aagcagtatg gtgattgttt aggtggtgtt
    23881 aatgctcgtg acctcatttg tgcacaaaag ttcaatgggc tcacagtact cccaccccta
    23941 ctcactgatg aaatgattgc ggcatacacg gcagcactaa taagtggaac ggctacggca
    24001 ggttttactt ttggtgcagg tgctgcgctt cagatacctt ttgcgatgca aatggcttac
    24061 agatttaatg gcattggtgt cactcaaaat gttttgtatg agaaccagaa acaaattgct
    24121 aatcagttca ataaggctat ctcacaaatt caggattcct taagtactac tactacagca
    24181 cttggcaaat tacaggatgt gattaaccaa aatgccatag cccttaacac actagttaaa
    24241 cagcttagct ccaattttgg tgctatttct agtgtactga atgatattct gtctcgactt
    24301 gacaaagtag aggccgaagt tcaaattgac aggcttataa caggacgttt acagagcttg
    24361 cagacttatg ttacacagca acttatcaga gccgcagaaa ttagagcctc tgctaatctt
    24421 gctgctacaa aaatgtccga gtgtgtactt ggccagtcta agagagtaga cttttgtgga
    24481 aaaggatatc atttgatgtc cttccctcag gctgctcctc atggtgtagt tttcttacat
    24541 gttacttatg taccatcgca ggaacaaaac ttcactactg cacctgctat ttgtcatgaa
    24601 ggtaaagcac actttcctcg tgaaggcgtc ttcgtcacaa atggcacaca ctggtttatc
    24661 actcagcgaa atttttattc gcctcagcct attactacag acaatacatt tgtgtcaggc
    24721 aattgtgatg ttgtcattgg cattgttaat aacactgtct acgacccact acagcctgaa
    24781 ctagactcat ttaaagaaga acttgacaag tattttaaaa accatacttc acagaatgtt
    24841 agtcttgatg gtcttaacaa cataaatgct tcagttgtgg acattaaaaa ggaaattgaa
    24901 catctcaatg agattgccaa aagcctaaat gaatcactca tcgacctaca agaactaggc
    24961 aagtatgagc agtacattaa atggccgtgg tatgtgtggc ttggctttat tgccggtctc
    25021 attgccatcg tcatggctac aattatgttg tgttgcatga ccagctgttg tagttgtctt
    25081 aaaggtgttt gctcatgtgc ttcatgttgc aaattcgatg aagaccactc cgaaccagtg
    25141 cttactggag tgaagttaca ttacacataa acgaacttat ggatttgttt ttgaacatct
    25201 tcactttagg atctattact agacaacctg gtaaagttga aaatgtttct cctgcaagtt
    25261 cttttcattc tacagcgtcc atccctttac aggccactct acctttcgga tggcttgttg
    25321 ttggcgttgc atttcttgct gtttttcaaa gcgctgcgaa attaatacct tttaacagtc
    25381 tttggcagcg ttgcttatac cagagctttc aattgctttg caatgtgctt cttattgctt
    25441 tgacagttta ctcgcactta ctgcttgttg ctgcagggct tgaagcacct ttcctttatc
    25501 tacttgcttt gatttacttc ttacagtgcg ttgtatttgg caggcttctt gtcagatgct
    25561 ggctgtgctg gaaatgcaaa tcaaagaatc cattaattta tgactcaaac tattttgttt
    25621 gctggcatac tcacactcat gactattgta ttccttacaa tagcattaca aacactatcg
    25681 tcctcactgc aggtgatggt gtcactattc ccattcggac acaagactac caaattggtg
    25741 gttacttcga aaaatgggaa tctggtgtta aggactatct tacacttatt ggtcctttca
    25801 ctgaagttta ttaccagctt gaatctaccc agatttccac agacactggt attaataatg
    25861 cgacattctt cctcttctca aagaatgatg aaagagaaca ggaaagtgtc caagttcaca
    25921 caatcgacgg ctcatcagga gttgtaaacc caatttacga tgagccgacg ccgactacta
    25981 gcgtgcctct ttaagcacat tgattgagta cgaacttatg tactcattcg tttcagaaga
    26041 aaccggtacg ttaatagtta atagcgtact tctttttcta gcttttgtgg tattcttgct
    26101 agtcacccta gccatcctta ctgcgcttcg attgtgtgca tactgctgca atattgttaa
    26161 cgtgagttta gtaaaaccga ctttttacgt ttactcacgt gtaaaaagct tgaattcctc
    26221 tcaggaggtt cctgaatttc tggtctaaac gaactaatta ttatttttat tcttttagga
    26281 actttaatat tgctctctat gactaacagt agtgcttctc ctcctacgga gaccattacc
    26341 gtagagcagt taaaacacct acttgagcaa tggaacctag ttataggttt tctgtttttc
    26401 gcttggattc tgctactaca gtttgcttac tccaacagga acaggtttct ttacataata
    26461 aagcttgtgt ttctctggct tctttggcca attacactag cctgctttgt gcttgctgcc
    26521 gtctacagaa ttaactgggt tacaggaggc atagctatag cgatggcctg cattgtgggt
    26581 ctcatgtggc ttagctactt tgtggcttca ttcaggcttt tcgcacggac caggtcttgg
    26641 tggtctttta acccagaaac caacattttg cttaacgtgc cactacgtgg taccattctg
    26701 accagaccgc ttcttgagag tgaacttgtc attggtgctg tgatcattcg tggtcacctc
    26761 cgtatggctg gacactccct tggacgctgt gacattaagg acctccctaa agaaatcact
    26821 gttgctacat cacgaactct atcttattac agattaggag cctcccagcg tgtagcatct
    26881 gattcaggtt ttgctgttta ccaccgctat cgtatcggta attacaagct aaataccgac
    26941 cacataggca gtgacgacaa tattgctttg ctagtacagt aagagacaac agatgtttag
    27001 tctagttgct ttccaagtta ccgtagcaga gttgttaatt ttaattatga aatcttttgg
    27061 attggcactt actcatatcc aaattggtat agtttcatta ttaaaaatcc taacaaaccg
    27121 tctagataga aggtattcta aactagacga agaagaacct atggaaattg atcatcctta
    27181 aacgaacatg aaatttcttt tactcgtggc aattgtaagt atagcatcag cagaacttta
    27241 ccattaccaa gagtgtgcta gaggtacaac cgtactctta aaggagcctt gccaacctaa
    27301 tacttacgaa ggcaactcac cttatcaccc tttggctgac aacaagtttg ctatcacttg
    27361 tacaaacacc aaatttagtt ttgtttgtca ggacgagaca agacacgtat ttcaattacg
    27421 tgcccggtct atttcaccca gactttttgc cagtccaaaa catcatagtg acgatttcac
    27481 cccggtgatc cttattattg tcacattgct ctttgtaatc tactgttgca tgaagagaca
    27541 atgattcatt taactttgtt tgatttctac ctttgtgtcc tatctttgct acttttcttg
    27601 gtcattataa tgctaatcat cttttgtttt gtgttagaat tacaagatct aaacgaacaa
    27661 taaaatgact gataatggac aatcaaactc gcgtaatgcg cctcgcatta cgtttggtgt
    27721 ctcagatacc tcagacaata atcagaatgc agaacgtgct ggagcgcggc caaagcaaag
    27781 aagaccgcaa ggccctccta acaacacagc atcctggttc acagctctca ctcagcatgg
    27841 taaagaaggt ctctcctttc cgcgaggaca gggagtgccc gttaatacca atagtaccag
    27901 ggacgaccaa attggctact atcgcagagc tacccgacga gttcgtggtg gtgatggtaa
    27961 gatgaaagaa ctcagcccgc gctggtactt ctactatcta ggaactggac cagaggccgc
    28021 attaccttat ggtgctaaca aagatggcat agtttgggtc gctacagaag gagccctaaa
    28081 cacgcctaaa gatcacattg gcacgcgcaa tcccaacaac aatgctgcca ttgtcataca
    28141 gttaccacaa ggtactacct tgccaaaagg cttctacgct gaaggaagtc gtggtggcag
    28201 tcaagcctcc tcgcgttcta actcacgtag ccgtggtaat tccagaaatt caacacctag
    28261 cagcagcaga ggttcatcac ctgcacgcat ggctgccgga ggagatacgg cacttgcatt
    28321 attgctgtta gacaggctga accagcttga gagcaaagtt tcaggtaaga caccacaaca
    28381 atcacaggtt gtcacaaaga aaacagctgc tgaggcttct aaaaagccca gacagaaaag
    28441 aacagctacc aaagcctata atgttactca ggcttttggt aggcgaggtc ccgaacctac
    28501 acagggaaat ttcggtgacc aggaattaat cagattaggt actgattaca aaaattggcc
    28561 acagattgca cagtttgcac ccagtgcttc tgcattcttt ggcatgtccc gtataggaat
    28621 ggaagtcaca cctacaggga cttggttaac ctataatggt gccataaaat tggatgataa
    28681 agacccaaat ttcaaagacc aagttattct gcttaataag cacattgatg cttataagac
    28741 atttccacct acagaaccta aaaaggacaa gaagaaaaag gctgatgaag tacagtcact
    28801 gccgcagcgt cagaagaaac aggcaactgt gactctgtta cctgcagcag atttggatga
    28861 tttttccaaa caacttcaga attccatgaa tgcttcacct gattctactc aggcctaaat
    28921 tcatgttgac cacacaaggc agatgggcta tgtaaacgtt ttcgctattc cgtttacgat
    28981 acatagtcta ctcttgtgca gaatgaattc tcgtagctaa acagcacaag taggtttagt
    29041 taactttaat ctcacatagc aatctttaat caatgtgtaa cattagggag gactggaaag
    29101 agccaccaca tagtcaccga ggccacgcgg agtacgatcg agggtacagt gactaatgct
    29161 agggagagct gcctatatgg aagagcccta atgtgtaaaa ttattttagt agtgctatcc
    29221 ccatgtgatt ttaatagctt cttaggagaa tgacaaaaaa aaaaaaaaaa aaaaaa
//
DBGET integrated database retrieval system