GenomeNet

Database: RefSeq
Entry: NC_030656
LinkDB: NC_030656
Original site: NC_030656 
LOCUS       NC_030656             133492 bp    DNA     linear   VRL 21-DEC-2020
DEFINITION  Pteropox virus strain Australia, complete genome.
ACCESSION   NC_030656
VERSION     NC_030656.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Pteropox virus
  ORGANISM  Pteropox virus
            Viruses; Varidnaviria; Bamfordvirae; Nucleocytoviricota;
            Pokkesviricetes; Chitovirales; Poxviridae; Chordopoxvirinae;
            Pteropopoxvirus.
REFERENCE   1  (bases 1 to 133492)
  AUTHORS   O'Dea,M.A., Tu,S.L., Pang,S., De Ridder,T., Jackson,B. and Upton,C.
  TITLE     Genomic characterisation of a novel poxvirus from a flying fox;
            evidence for a new genus?
  JOURNAL   J. Gen. Virol. (2016) In press
   PUBMED   27389615
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 133492)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 133492)
  AUTHORS   O'Dea,M., Tu,S.-L., Pang,S., De Ridder,T., Jackson,B. and Upton,C.
  TITLE     Direct Submission
  JOURNAL   Submitted (23-MAR-2016) Biochemistry and Microbiology, University
            of Victoria, 3800 Finnerty Rd, Victoria, BC V8P 5C2, Canada
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to KU980965.
            
            ##Assembly-Data-START##
            Assembly Method       :: MIRA v. 07-Jan-2016
            Assembly Name         :: Pteropox virus
            Coverage              :: 398.138
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..133492
                     /organism="Pteropox virus"
                     /mol_type="genomic DNA"
                     /strain="Australia"
                     /isolation_source="wing membrane"
                     /host="Pteropus scapulatus"
                     /db_xref="taxon:1873698"
                     /country="Australia"
                     /collection_date="20-Aug-2015"
     gene            complement(447..1193)
                     /locus_tag="BC341_gp001"
                     /old_locus_tag="PTPV-Aus-001"
                     /db_xref="GeneID:28340471"
     CDS             complement(447..1193)
                     /gene="PTPV-Aus-001"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268716.1"
                     /translation="MACENSGAKWSEIVEAADSSIGNEEQQPGASAPATPLASERAAV
                     PPVNADERKRRRSRSRCGGRSDEGCTPCSKHPDYSKLRVSVRNYGSCKQLTSVFSAEA
                     HPNELTSLNFYNEPAMFAPDSYDKTTLPKLTCVREGNLFAGSVRLTPCRFLLRGSFVC
                     WIEMGYNCVRMAAANVGLTDVTISHSQTPEQIRHGSQTCRISFAVRASGTSWVLPFLQ
                     TLETVVSESDPHPRIPGKFKVTFIDPVESE"
     gene            complement(1272..1700)
                     /locus_tag="BC341_gp002"
                     /old_locus_tag="PTPV-Aus-002"
                     /db_xref="GeneID:28340329"
     CDS             complement(1272..1700)
                     /gene="PTPV-Aus-002"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268717.1"
                     /translation="MEGNAAALEAYSRFNAIKESRKTRSSFLKPMILEGNRATVTVHA
                     PSVRSNVSVIDRVRFSSTKCEELYLRLELTDVEEQSICAVENLVKKCGVENSAANFVP
                     GTHGKRGTVIADLCSLGGGWAEALLGELERELARKIETLY"
     gene            complement(1744..2328)
                     /locus_tag="BC341_gp003"
                     /old_locus_tag="PTPV-Aus-003"
                     /db_xref="GeneID:28340330"
     CDS             complement(1744..2328)
                     /locus_tag="BC341_gp003"
                     /old_locus_tag="PTPV-Aus-003"
                     /codon_start=1
                     /product="schlafen protein"
                     /protein_id="YP_009268718.1"
                     /db_xref="GeneID:28340330"
                     /translation="MAAAKFLPHLDADAAVNKLHCFPGLSSNKAVDVTQFSHVVVNGC
                     RYETHRYMWVSSTIGERYIGGFLPYILIEGANKPEVGDLIYSEDGEPISCITRSKGDA
                     FCVSGIGYETLDLQSNVRVHHRTIVDKHSVYGGQQGPYCVIKQYALEKAARSSGSVTD
                     YYVWIGDNITHIVGTCANGKEVSRVRIKHGGIFS"
     gene            complement(2414..2941)
                     /locus_tag="BC341_gp004"
                     /old_locus_tag="PTPV-Aus-004"
                     /db_xref="GeneID:28340331"
     CDS             complement(2414..2941)
                     /gene="PTPV-Aus-004"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268719.1"
                     /translation="MAGYITFTLSLVLVFAFFDHAISARTTMHSSICVVKYPSESSKS
                     LTVRFQAKVLTVRVSDGVYWSACGSRRMPRKCTFTNDNQSNYNVKIDVNSEYIEEDSF
                     TYHHSLTSELTVFDVEKTAPVYTAKYLGLEVKEHVVDVWQVVHERNVKVCVEESSELF
                     WRHERIKKRIEHSEL"
     gene            complement(3047..4129)
                     /locus_tag="BC341_gp005"
                     /old_locus_tag="PTPV-Aus-005"
                     /db_xref="GeneID:28340332"
     CDS             complement(3047..4129)
                     /gene="PTPV-Aus-005"
                     /codon_start=1
                     /product="il-1 receptor antagonist"
                     /protein_id="YP_009268720.1"
                     /translation="MDMTPQNTFEIRSNGLVKVKTFLPEYLNGIKAMIRCAISRNVEW
                     RDSKVYNTNSKKEEISEDRKSKQVTILASDVSKYYLSCLRALLTESTNHYADNVLIDK
                     YVTVVEYLEGDYFNRHTDYENIVSNNCAEHHLVLYLDTPLKGGETCVEIENTVTMSKS
                     DILFDKRLPHWSNTVTEGVKKVALINVLIKYSSGGIKLFDVPLNYKSLSFYDTEGTRD
                     YCYCSIIINDPLAKANSFDIIINRAGHCILTAVNHRVVRNQSVYKKFNDLCLDKFFDT
                     YTVFEYFNEYFDNDDDKNIAWKNISPKNKKILIPRKRSDYKFIKKIVRNSKKINSEIF
                     YYTMSGKCNSEVKYVSFTVSRFYFSA"
     gene            complement(4202..5203)
                     /locus_tag="BC341_gp006"
                     /old_locus_tag="PTPV-Aus-006"
                     /db_xref="GeneID:28340333"
     CDS             complement(4202..5203)
                     /gene="PTPV-Aus-006"
                     /note="small subunit"
                     /codon_start=1
                     /product="ribonucleotide reductase"
                     /protein_id="YP_009268721.1"
                     /translation="MESNDAKTTCDIVQEPLLTPNDNRFVILPIQYPDIWSMYKKAEA
                     SFWTVEEVDLTKDLPHWKKLKPDEQYFISHVLAFFAASDGIVNENLVERFCNEVQVTE
                     ARCFYGFQIAIENIHSEMYSLLIDTYIQDPFEKSKLFNAIYTIPCVKKKANWALKWIK
                     DKASSFGSRLVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFA
                     CLLFGYLVNKPSKDKIKDIITEAVTIEQEFLTYALPVRLIGINCELMSQYIEFVADRL
                     LVALKCEKHYNATNPFDFMENISLEGKTNFFEKRVSEYQKFGVCSKSDMTFTLDVDF"
     gene            complement(5213..6514)
                     /locus_tag="BC341_gp007"
                     /old_locus_tag="PTPV-Aus-007"
                     /db_xref="GeneID:28340334"
     CDS             complement(5213..6514)
                     /gene="PTPV-Aus-007"
                     /codon_start=1
                     /product="phospholipase-d-like protein"
                     /protein_id="YP_009268722.1"
                     /translation="MNCKEQTSAYLVESIPEGMEFLSGTVSASTFDTWLKLLSMTEKS
                     LLIASFYWSLDDGSPNVMAIQGRTILETILKLPSKGVDVKIAVNKPKTSQVSPDLVKL
                     MNQGCGVKFVDVTKLTGGILHTKFWIVDGRHIYIGSANQDWRSLTEVKEIGIVLFNNS
                     CLAKDLTKIFYTYWFLTDFIPSSWSSCYETKINMITPLNTYINGVLTSIFIASSPMEF
                     SPLSRTNDIDSLTHCIQTANKFVHVSVMNYEPVLYTDNGQIYWPNINDEIIKYAIEKK
                     LEIKLLISCWERSSFSMRSFLLSLNSLRDNKKNIQVKLFIVPNIDPPIPYTRVNHTKY
                     MVTDNTAYIGTSNWTGNYFTETCGVSVNIVPSDNINIRKQLEDVFQRDWNSKYSFYLT
                     DTVDDCRCRLLKHPAGECKFIKSKINISIDDRGLPEYEYID"
     gene            complement(6504..7862)
                     /gene="PTPV-Aus-008"
                     /locus_tag="BC341_gp008"
                     /db_xref="GeneID:28340335"
     CDS             complement(6504..7862)
                     /gene="PTPV-Aus-008"
                     /locus_tag="BC341_gp008"
                     /codon_start=1
                     /product="ankyrin repeat protein"
                     /protein_id="YP_009268723.1"
                     /db_xref="GeneID:28340335"
                     /translation="MADFHYCNCFTQFVKLCSYDLVSRMIQENPNCVYQLSDFNMTAL
                     HHAVTDVIDIEIVELLVSNGAIVNAKNDFGETPLHLLMKQKHVPVNVLKYLLFKEASL
                     YEETNLGKTPVHYYLQNGILTKAVLKILIMHSVRFDQSFDMYGRKPIHYYLIRETIDC
                     NMLPLLLKNCDMQHEDVLSNNMLHYYLSYNANPKLKIFRILHESGVHFKPVNVFNETL
                     AYLAIMCNNEKIIYYLLGKDSFFVDEITTNGNTCLAIAISSLNYNLVSLIINLQPKVS
                     NVIYSIKKTIPLFENENVYKEGFKCFKKCIKYVASVSTVNIASAFENQTNTLALPCKI
                     CAYAAMDEIYNMKHFVLSKNLSVYDLVFKKNSDSLLYRFYKHPSLISFSKKEIYGLKI
                     CRMISRASFINDAVNKIIQFLNSTESGWNALPYDIKEKIILNLSFVNIIKLDDSLNNY
                     EL"
     gene            complement(7954..8610)
                     /locus_tag="BC341_gp009"
                     /old_locus_tag="PTPV-Aus-009"
                     /db_xref="GeneID:28340336"
     CDS             complement(7954..8610)
                     /gene="PTPV-Aus-009"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268724.1"
                     /translation="MLNFNPVVARGDVFRREENEENEENEQREQNLNAPYSLLQNELD
                     ESYFIQSDKCDLYLALSLYIKEKELQGLRGALSPNAEALYKAIKNTCDKTDVQFNAAF
                     RFIENMVDEENIMNTSDTYNSFVEDLTTQTLTPGKAIATVTLWGRMFSKWCEHGYVVR
                     SAAISQPLIIKLLNASPSNLQRFIQDYSKINNKFNYGFLAATIAAGTVVFLGIKCFFK
                     "
     gene            complement(8665..9180)
                     /locus_tag="BC341_gp010"
                     /old_locus_tag="PTPV-Aus-010"
                     /db_xref="GeneID:28340337"
     CDS             complement(8665..9180)
                     /gene="PTPV-Aus-010"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268725.1"
                     /translation="MDLLNKAKKNATTFFNRMSHSTQSSSFHRTASLPPKEIVRSKQK
                     VNSLSTDVRCKSSTLPKNTSSSFAEFSCAQKCDEPIYDKVTEDDDDEQDSEDEVWSDA
                     ILELINTLTKQRFELLSTLEHYLREDIKILETSAKKLRSSRRNYNHNIKPITEPNVLK
                     RTRSFNSLANI"
     gene            complement(9223..10209)
                     /locus_tag="BC341_gp011"
                     /old_locus_tag="PTPV-Aus-011"
                     /db_xref="GeneID:28340338"
     CDS             complement(9223..10209)
                     /gene="PTPV-Aus-011"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268726.1"
                     /translation="MVMKNTIIYMVFFLLGAIIQQIISPINFFEKEVKVPHFINVPYT
                     PKLFFSPYEKKIREPNCTVTKRIEGDSVLFKAWSVTGIPKSVTVRYTKTNKTFTVFSP
                     LSNSSNGYYPISNTKSSVVYRSYVVEKGLIIKKLKHSDAGVMLISIVDSTNTVITLCT
                     KLVVEPTIDEPTLKITRLETDGTKCLATIRCDAEQHNTLLSFMGNGFLDTQRNITWFN
                     TKTLIGKFIVNKKLTVSCVSINKFSVSESFTVSIDYQCYVNQKKVSDNNACSTVRFVL
                     DTRPCTVILISAFLILTVIACVLSYKAILQYNYYKRRKTYVNLIDVYNPNNI"
     gene            complement(10218..10556)
                     /locus_tag="BC341_gp012"
                     /old_locus_tag="PTPV-Aus-012"
                     /db_xref="GeneID:28340339"
     CDS             complement(10218..10556)
                     /gene="PTPV-Aus-012"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268727.1"
                     /translation="MFMSKIIIGANTLVFLISLKCFVYAAPVSTSTAAEDESPTERLK
                     SILFIVFIIVCGLLAFIACSACGIIHQMIYQVTCCCRTLVSSICKKKNNYSLLKQKYE
                     VPIDSTFTVG"
     gene            complement(10588..10893)
                     /locus_tag="BC341_gp013"
                     /old_locus_tag="PTPV-Aus-013"
                     /db_xref="GeneID:28340340"
     CDS             complement(10588..10893)
                     /gene="PTPV-Aus-013"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268728.1"
                     /translation="MSNSRISQDVEACLKFPNSCCSVCFENEVDGTVTHVGERCTVRF
                     ENEVDGTVTTVGEQCTVHFENECEVTNQSGEKKHLWLIGQKPRGELKDGEFDVEAPN"
     gene            complement(11105..11674)
                     /locus_tag="BC341_gp014"
                     /old_locus_tag="PTPV-Aus-014"
                     /db_xref="GeneID:28340341"
     CDS             complement(11105..11674)
                     /gene="PTPV-Aus-014"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268729.1"
                     /translation="MMAQILNFVSNRFYYDRGNFELEIQEGILDLARSIEAVANLPRQ
                     EGAVRTIHGDEYFVIETARRQNGDREENNQQILQPDNQFDNLDGNVEIPLVQQNQQPV
                     QPVLLPPPNQLVDDVQDQADSPMLAQSSNHMNTQEDVLSSDMLNLFDDIEWNDEFIQQ
                     VLNNPETIFPISEFDPNMDISCYENLDDM"
     gene            complement(11737..12279)
                     /locus_tag="BC341_gp015"
                     /old_locus_tag="PTPV-Aus-015"
                     /db_xref="GeneID:28340342"
     CDS             complement(11737..12279)
                     /gene="PTPV-Aus-015"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268730.1"
                     /translation="MSPFAIAAPDFVQEIEDLLTNKEAKLFSITSRLQALLVYMNVIS
                     SDYEASNVCALVESYGTTSASKICYTNATADFLQHSLTAIICLQNNGKTKIITMSNDK
                     EKPVNSGFVITLKKGAICIIPSSYDVYVENTCKQTLKELATKYMFIPLNKKNTLVNPV
                     TIRMNPSPLDCQSILLKMNS"
     gene            complement(12407..12622)
                     /locus_tag="BC341_gp016"
                     /old_locus_tag="PTPV-Aus-016"
                     /db_xref="GeneID:28340343"
     CDS             complement(12407..12622)
                     /gene="PTPV-Aus-016"
                     /codon_start=1
                     /product="cytoplasmic protein"
                     /protein_id="YP_009268731.1"
                     /translation="MNGDMKNRQKIPKQQYQKSKLYGSSFSIKHEPPSMDEINKFGLT
                     FSNGLIINAPTIIGAKYPDYIYARQIN"
     gene            complement(12701..13339)
                     /locus_tag="BC341_gp017"
                     /old_locus_tag="PTPV-Aus-017"
                     /db_xref="GeneID:28340344"
     CDS             complement(12701..13339)
                     /gene="PTPV-Aus-017"
                     /codon_start=1
                     /product="s-s bond formation pathway protein"
                     /protein_id="YP_009268732.1"
                     /translation="MAATKPVKTLYDMFADRYMELLAIYAVPTNITCAIHIGNISGTL
                     NGCALKIINRCNNNTKLSYSLLTQAFLETISKLPINEQKKIADKVGIDLNLKPGETSK
                     LEQQCSATASVTSIIDVQNLNIGTCVSPPGQHILIQFINTGSASANCGINTILQALVN
                     NYEIPIIKPTISFNNPWIIALSVIITFIIIISVSSLRRRIKLAYKYGATLRV"
     gene            complement(13326..14648)
                     /gene="PTPV-Aus-018"
                     /locus_tag="BC341_gp018"
                     /db_xref="GeneID:28340345"
     CDS             complement(13326..14648)
                     /gene="PTPV-Aus-018"
                     /locus_tag="BC341_gp018"
                     /codon_start=1
                     /product="ser/thr kinase"
                     /protein_id="YP_009268733.1"
                     /db_xref="GeneID:28340345"
                     /translation="MTEETTSLEIFPWNRDSLRKDITVLGDDIYLNYAISQIDTSQSW
                     APPVKLIRYFRNFSKDSLNKIINDDYVNPSYFQMKNKKFIPLNDDLYHVATGGYGIVF
                     KIEEYIVKFVFETKSFLTDIDTASEYTIPRFLYNNLKGDEKQFIVCALAMGINYKMNF
                     LHLLYKRVLSMIVLIFKIMDNKELNLDFSQKIFLQKFNERKNDTTFVKLISYFYPSVV
                     QSNINIINHFSHLVHFFEHEKRSKYEYDRGNIIIFPLARCSADQITQENVSMFGFKSV
                     SEYIKFLFLQVSLLYIKIYELPGCDNFMHADLKPDNILIFDSKKVIKIHVGKKTYTFK
                     EPIRCAVNDFDFARVCQIKNTKIKGNIKEPQNWFYDFHFLVHTLLRAYPEVTEDKDFL
                     STLEEFVMCCTKTTCEKFRLKTPITHPISFLKKIITRDIFSQWINGSD"
     gene            complement(14706..15944)
                     /locus_tag="BC341_gp019"
                     /old_locus_tag="PTPV-Aus-019"
                     /db_xref="GeneID:28340346"
     CDS             complement(14706..15944)
                     /gene="PTPV-Aus-019"
                     /codon_start=1
                     /product="rhoa signaling inhibitor"
                     /protein_id="YP_009268734.1"
                     /translation="MSFLKRIQRIFSRSRGTRTESQDLIVSSVVDSSSATSSMLSVKS
                     ADSQQKITYVESINNSLTLKDDVFCGKSPLSAKELIPNPRPDSTEFSKLIINNSSLSF
                     LLDDDGMFEVGSCFIVNLEAGSSLVKKVMQFGHYNNYLAVICLKNTGISGYCIPNTNY
                     VTKQSSVGDFTVSRALNGVRFFQQIGGESSYLLVTLVPSKKLHTRGFRVTRPLMHCRT
                     TMAELYKMIEDDREKAIKLLENVIDNRIAIESAYFNMCQAEDMFRTFKVKGCVFGKKL
                     IDKSLLELQESFESYVRTRSSSIGNSTNKLEQRNKINNNIACISNLFSTDEKDNKTIL
                     YAIQSYIDRILDELDNLFNELNELVTNLSKAANTDVSCLNAYVIKKVRESQIIKRRNE
                     LLSKYYVLDKIGFPEAEVLI"
     gene            complement(16003..17964)
                     /locus_tag="BC341_gp020"
                     /old_locus_tag="PTPV-Aus-020"
                     /db_xref="GeneID:28340347"
     CDS             complement(16003..17964)
                     /gene="PTPV-Aus-020"
                     /codon_start=1
                     /product="eev maturation protein"
                     /protein_id="YP_009268735.1"
                     /translation="MFNIFGKMCNSAPATQDSIKAIEHLLLVHANSAVVARTRSGKGL
                     LITRQNLQLAKITFRHTSIDVVLTVFLDFCDDEIIDPPEAAHTMHEVDTETFYSPKPS
                     ESPLSDILFKRADTCMDLLRTIYLHWPTEGIHTFSDINYWLSTVGMYDYRLVHFRDIR
                     KRKNSSTNLTIIDDMVIGLVGYHAIWVKNLNKYNRPELDVMKYDLSLIASKNMWTKYM
                     RTFNSSKMYAMCTTIALNGKSVIPVNISMYPGPTFTASSPTDNIIIDFLDWLTDANSS
                     CTNITIVGFMSNFLESILIQKEVKKSSDWTLIGDKTIMSDKGNTVTFFDVSQFALGLS
                     FSDYCKFWGGVSSSLPADLLSFSDFQKSVDSTIDTANSASMSLYETVTQQQVLLSKIL
                     PIGNVEQFNSIENMFITNAAVLGCSEHNGLYYPVHETAKEFIADTIHTSIIKSKTPVV
                     HKNTRRVAIKNLLNAISEYQYPLGKPTYVTVPEKEKMYIALCEVKTLSKLMIPIIEPP
                     NGNFDAPFCVPLTSVDIATITRVGGYKIRILGALQWESSDKVIFSGLEKITSSVKQFD
                     SKQTSEMFKKMSASVDLLLNDCVLESSPESLVMLAFAVSYCRAKVHTAIERIDNHFSA
                     KLVDQHDFASVWIREPAETASEIVKIAFC"
     gene            complement(18000..19160)
                     /locus_tag="BC341_gp021"
                     /old_locus_tag="PTPV-Aus-021"
                     /db_xref="GeneID:28340348"
     CDS             complement(18000..19160)
                     /gene="PTPV-Aus-021"
                     /codon_start=1
                     /product="eev envelope phospholipase"
                     /protein_id="YP_009268736.1"
                     /translation="MWPFSSVPDGANCIVVETIPKTLDLQSTNITTLECFEELIAKAT
                     KTIHIVTFCCNLRSTKDGENILSKLCDAARRGVKVVILVDYQSRDTDKEILENSGVEY
                     FKVKINNTGMSNMLGNFWTSDKERLYVGSASLTGGSLTTIKNLGLYSTCSVLAKDLEN
                     RFDTFKKLIDKKSSIFRKICCTPCMANTVCGVPLATDFHLDYSAGGVFFSDSPDTLLG
                     CFRTLDYDVVIERISKAQDSIDLSLMSFVPIVKSDEVIVFWPNLLNALLEAAINRSVK
                     IRVLVSHLKNNNPFSLAAISTLNAFSTENADISVRYFSNKDSDTVNNTKLLVVDSKFA
                     HLTVANFDGTHYKHHSFVSANAESLVLVKKLSEVFNRDWESKYSVPVAKNIN"
     gene            complement(19220..19411)
                     /locus_tag="BC341_gp022"
                     /old_locus_tag="PTPV-Aus-022"
                     /db_xref="GeneID:28340349"
     CDS             complement(19220..19411)
                     /gene="PTPV-Aus-022"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268737.1"
                     /translation="MIDPVEQDSLVDEGMELSEELEELLDSLEENSDLSSIVSDSDLE
                     SLIDELEDFNYYLIEDITH"
     gene            complement(19483..19641)
                     /locus_tag="BC341_gp023"
                     /old_locus_tag="PTPV-Aus-023"
                     /db_xref="GeneID:28340350"
     CDS             complement(19483..19641)
                     /gene="PTPV-Aus-023"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268738.1"
                     /translation="MFIDIVLYIGIATFTIGIILTSLDCVIACRRAAKDFKETNRDEE
                     MESLLVYV"
     gene            complement(19719..20159)
                     /locus_tag="BC341_gp024"
                     /old_locus_tag="PTPV-Aus-024"
                     /db_xref="GeneID:28340351"
     CDS             complement(19719..20159)
                     /gene="PTPV-Aus-024"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268739.1"
                     /translation="MEVSTLEDIIALKPFYSMSKTKRNEEQNCIMGNRCFVKVSSVRH
                     IPSRSIDATAPIFLRNQKFYLEDLLFSPFHFSRMQYQYLSPGFVMKCINRAKPKKTVF
                     CVTEKTLNDNKLSIDVFVPTTDPTKYLIIGLRVVDFWKSKFEII"
     gene            complement(20161..20367)
                     /locus_tag="BC341_gp025"
                     /old_locus_tag="PTPV-Aus-025"
                     /db_xref="GeneID:28340352"
     CDS             complement(20161..20367)
                     /gene="PTPV-Aus-025"
                     /codon_start=1
                     /product="ring-h2 zinc finger"
                     /protein_id="YP_009268740.1"
                     /translation="MPVTVTFWRPVVLKRYKNCDGICHICRLRRHCNTCTFIASACGH
                     GYHTHCLKNNNICFVCREPIQVRK"
     gene            complement(20398..21999)
                     /locus_tag="BC341_gp026"
                     /old_locus_tag="PTPV-Aus-026"
                     /db_xref="GeneID:28340353"
     CDS             complement(20398..21999)
                     /gene="PTPV-Aus-026"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268741.1"
                     /translation="MTDALLIHMITRFFDDVYDIVDCSQAKSLLMLIQAKKIKQSTFC
                     MCLEQAVMRKTWTLPGEILGEVEELDVAFMHRINCIRDNINGVMQISLYDWERVEDDF
                     QVDSYFIKLFESKFRCLIDAKLRYMLKSHKFYVDLGEWFWNAESLFKYETLVNLNKSI
                     LRNYHVIVNNIVCYHENNIINMYQLIIDMFKYKNDSGALSSFLKKLISKVSKGIAVRD
                     YEALTNSCYEISSSVTEYIELMQSLLPKEHFNKSVLKAINEEYEKSKKTNDESLYFKL
                     VSMYYEIIKEKNIKKYSFFQCPAKWYRKIVAYIDDESKSQQEIESFMTYIFDILNKID
                     YKDFTEMQNYTSVKVMKRLLTSDIVDRGTLLLVKKVLKLPLEVVAKYIYNLETTFMRI
                     TNIYAFYVDSYNTPIMLNDELDIEKHAPELVNVINFAKSWIPDADFIVTPHSGYIEFT
                     ISDETDKVDVIGNTAHYLIYNKSYESKSGISIDDLNAMLKSELLVKTAIKAMVNEKLI
                     TVANGIVYANRFIQQTGVDRIVLNN"
     gene            complement(22056..22766)
                     /locus_tag="BC341_gp027"
                     /old_locus_tag="PTPV-Aus-027"
                     /db_xref="GeneID:28340354"
     CDS             complement(22056..22766)
                     /gene="PTPV-Aus-027"
                     /codon_start=1
                     /product="conserved non-functional serine recombinase"
                     /protein_id="YP_009268742.1"
                     /translation="MKKHHYYSKNTITKMKTLKPSVIVLSDNDLYFSRNKFKLLACLK
                     YCKNNFLKNVAQITISGHVSPKKLAISVSDHLKSGVLDFVLYSPKDVLTSTRDMFKLI
                     NNTNEKICVHSVVNNAKYTKNKCFLNEETKKKIKDLIKLLNIKSCSKSLIKSHINKNF
                     NNISELINIVKKHVLWTSVTVYKLSNPYTFCKYKKRKVKLTASTVYKKFVNKLIMLKK
                     SESESINEICYDLEHIII"
     gene            22792..23166
                     /locus_tag="BC341_gp028"
                     /old_locus_tag="PTPV-Aus-028"
                     /db_xref="GeneID:28340355"
     CDS             22792..23166
                     /gene="PTPV-Aus-028"
                     /note="vp11"
                     /codon_start=1
                     /product="DNA-binding phosphoprotein"
                     /protein_id="YP_009268743.1"
                     /translation="MSNMHKTPFYINTAMGRVLVLKYIKVCEIPEVQCAATKAMCVLK
                     TEEPMSPKCERAPASCPLSPSRQPQPPACPLSPSRQQPVCPLSPTRQTVVPRNNNVPF
                     MNTNLLENLFSSNKNAVSKILG"
     gene            complement(23163..24578)
                     /locus_tag="BC341_gp029"
                     /old_locus_tag="PTPV-Aus-029"
                     /db_xref="GeneID:28340356"
     CDS             complement(23163..24578)
                     /gene="PTPV-Aus-029"
                     /note="vp55"
                     /codon_start=1
                     /product="poly(a) polymerase catalytic subunit"
                     /protein_id="YP_009268744.1"
                     /translation="MQSTKQVITEYLGREPEISSYYLISAYYKNITKILKFNKTVFIS
                     LLRKNKRKFFSHQTNATPTAISKRVSEYFSKQKHTIQVGKILSIIELQTVLVTTYTQT
                     LGVLTTKAPSLYSSVMTLNVSCTVILAKTAVESYNVATPNSKVMGRHNASDLVNSVNE
                     LMDEYLRRHNKSCLCYGSYSLHLLNSDIEYGDIDIVQTNSRTFLINMAFLIYFITGRQ
                     VTLLKVPYLKNYIVLHDEDGKHILDSFNIRQSTMDAVPKILINNIYIIDPLIQLMTML
                     KMLSQIDRLEDLAKNPLKLIERLSTLLEYARVELCVNFSEKADGFPLFATIDEVSRIV
                     TVDCRPLNSSFNQAKVYLDETVLAHDILYMNSDENVLDFESITNSAFLVSKNVLYTYF
                     SNTILLSNENVIHDISRRAITAHIILFLLLTDYESGKKAVSLLLKSLISTKESIFKVI
                     SRDKKTGNHSIIDISKDIISH"
     gene            complement(24578..26797)
                     /gene="PTPV-Aus-030"
                     /locus_tag="BC341_gp030"
                     /db_xref="GeneID:28340357"
     CDS             complement(24578..26797)
                     /gene="PTPV-Aus-030"
                     /locus_tag="BC341_gp030"
                     /codon_start=1
                     /product="iev morphogenesis"
                     /protein_id="YP_009268745.1"
                     /db_xref="GeneID:28340357"
                     /translation="MLNIAAIKRDVAEAKCQNVKLSCVFRNLKSNEIDEFIKKGFHPS
                     KLSRKNYSSVVQNTPLKLYLFKPQHVNPLDLLMVLQYQTNPTIYANHIQYHQSYILQH
                     GSFELVSRCVPHMILTDNDVRYISEKYPEQSDILLATVSYKSIRRLSYLFTEEIARDM
                     ILNDDIIADALYEHQLFSEEFLWDMHFSYGIVPANKGIDSVSPKDLKTILAGVTTPKS
                     AINLISVLPKSILMSTPIKTYILSCIVDGEKLEHYISYAKEFLKDHVQDVGIYVNIIF
                     PENGIDLNSYPNELSRIQLSNVCKFIDCYTVSIDFIINVLIEKEYYDLLGLIIEKIDT
                     SVMDETLCVNIVKHSINPIKVRHIPVHSLAVATECAKKKYVDLVDFLDCLDLTTLLSV
                     AEQTLFTTYAFETNWLNDNFELLALYVHQYGFCAYRMKKLLFEYPLQSDTVNLLLNLM
                     FIGSKESLFSDKVINSLEYFMCSTELGNFKPLTLKTVNVTISLYDNQANHETYPSVYS
                     NDLKNALQTIIIPNLQSLLFRDVSTVKMAKGICLQYYLDVNWLTDEERLCKQISDIAT
                     FATYGLFYIPDCAPNWVPASQLAKCEPMEQPTVLKGDIDALVLNKLTKFINLGMETTK
                     QYKLLEPMSNDQAALNSLLVTIVSYLVIGSVRYVGVNNIQRFVTKIISQYCEVLKSDE
                     SVYESVTEVVQELTELKKSIRHISDVIDIKLKKIVNTVELGATLVRVFYNNHNNKFT"
     gene            complement(26860..27540)
                     /locus_tag="BC341_gp031"
                     /old_locus_tag="PTPV-Aus-031"
                     /db_xref="GeneID:28340358"
     CDS             complement(26860..27540)
                     /gene="PTPV-Aus-031"
                     /codon_start=1
                     /product="dsRNA-binding ifn resistance/pkr inhibitor"
                     /protein_id="YP_009268746.1"
                     /translation="MACCSCTGSSALVAFDVRRLKDKISVLLDAAPEPYLAKDVAFML
                     RCPVKQVNICLYSMEKECSVKRLENCHGSAPLWVCTSQKNNNEEEKEESKEEEEKNKE
                     TEDVANNNYRKRFNPFGDELTKEKIEHLKCVPPASAINEYCQLTARTQSFIFSQVETV
                     PCPKFSCLALIDNIILASACGFSKRSAKNLACAEALKVLLEKFVKVNQPQRQRSVSVE
                     SYGPEFYI"
     gene            complement(27640..28383)
                     /locus_tag="BC341_gp032"
                     /old_locus_tag="PTPV-Aus-032"
                     /db_xref="GeneID:28340359"
     CDS             complement(27640..28383)
                     /gene="PTPV-Aus-032"
                     /note="rpo30"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268747.1"
                     /translation="MESEQYDMVSIISKYISNSELISNVVSWATVSASKNMIKNISNS
                     KVNIEEPKFNHIHNIGIEYSKDSKNKLLYKTKPTIEVDTKYKYISDLIKTTSGIEKEV
                     LRYILFALKCIDAKVEYDIEKLQDYDYSKYFNVLDQSKNIRCPGCKGKNTIPLMIQHR
                     AADEAPLVIHVCKDCKKRFKPPKFKANPKTKELREEDEEIELEADNDYASDNESLDEF
                     KNEDNEMQEIESLMVTPNGNQDGSPYELN"
     gene            28471..28701
                     /locus_tag="BC341_gp033"
                     /old_locus_tag="PTPV-Aus-033"
                     /db_xref="GeneID:28340360"
     CDS             28471..28701
                     /gene="PTPV-Aus-033"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268748.1"
                     /translation="MYLSNSTSDMQEAITINYILLLSICALIIVLIFAFLLYYCIKLC
                     KLNYRNEISNNYTEFDENFTHDYSKFNHVTFV"
     gene            28754..29074
                     /locus_tag="BC341_gp034"
                     /old_locus_tag="PTPV-Aus-034"
                     /db_xref="GeneID:28340361"
     CDS             28754..29074
                     /gene="PTPV-Aus-034"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268749.1"
                     /translation="MNKRKLLTMIRFSIKLLNTNYSDVLCGKYSLKSVLPRIKKKLVC
                     KYTAQMCNGSESWYYIVLSLFKFVELRKHISCVNCDKKLSPREFASLVNKCVQFLNVY
                     DRYL"
     gene            29080..30780
                     /locus_tag="BC341_gp035"
                     /old_locus_tag="PTPV-Aus-035"
                     /db_xref="GeneID:28340362"
     CDS             29080..30780
                     /gene="PTPV-Aus-035"
                     /codon_start=1
                     /product="imv protein, virion morphogenesis"
                     /protein_id="YP_009268750.1"
                     /translation="MDFIRRKYLIHVIENNINVLRDDAVNKVSNFTLNHVLALRYLIT
                     TFPKAILTKDVFSNPNFFVFLHMAQSRDVFDAVLKAAFDAPTMYIKALVKHYTLFSNA
                     IQTYKDLCQKLITDDRFIEVVKFSSALKDVIGVNYDLTLNPLFYKEEPIQDIEIVFTK
                     LFKETKFKAVKKLPVLRLMIWAYLSKQDTGIEFEDNDRQDIFTIFQKVGPVIHSHLTE
                     QFREFMFSKDKTSYWIWLNDKISNDSDIYKDRLAETMYEKILSYIYFEVTQGRVNKNM
                     LKLVYIFEDNVEIKQMLLEIIYGVPGDILGIINNENEEWKQYFIHLYKESFIDGNTFV
                     NEKTFYDNLFNVVAAIDPVYFKAERITSLFTVDVNSREMFDKMKINSTYISQIIYETL
                     DIDMYLLEKQVSCQIYNENTVYYIKEYNTYKFLSEDDPLVINKGSLVKLSSINDIKER
                     IDLFSLNILKYYLDGRLASIGLVLDDYAVDIVSKMLSHMKCIENVSCFIKFAVEKNES
                     IIPAIIRTIIANFNVPVIVLFRDFLKQNLHHVETFFDNTKYLQENDKKYIRAVIEHGR
                     "
     gene            30786..31595
                     /locus_tag="BC341_gp036"
                     /old_locus_tag="PTPV-Aus-036"
                     /db_xref="GeneID:28340363"
     CDS             30786..31595
                     /gene="PTPV-Aus-036"
                     /codon_start=1
                     /product="er-localized membrane protein, virion core
                     protein"
                     /protein_id="YP_009268751.1"
                     /translation="MSGRRMWDVDAAVQIRNDDQKTFFTKGLSPVMKHTYLFHNYAYG
                     WIPETALWSSRFADFSLLDYYPISLEFIKKIEFMLSLYKGPVPDYESKLNTEFVDRGS
                     FSGRYNDFLKRFVILPTGEFISFLLLTSMPVFNLLFWFKNTTFDIKKHTLFSEVYTTN
                     ERHIELARYFRKSGDYKPIFSRLDQDAIYTNPVTNIATVGNPGPLGNLFPSDYETLAN
                     LSTILYFTNYDPVLMFLMFYVPGLSITTKITPAVEYLMSKLSLTKKDIVLV"
     gene            31634..32068
                     /locus_tag="BC341_gp037"
                     /old_locus_tag="PTPV-Aus-037"
                     /db_xref="GeneID:28340364"
     CDS             31634..32068
                     /gene="PTPV-Aus-037"
                     /codon_start=1
                     /product="dutpase"
                     /protein_id="YP_009268752.1"
                     /translation="MLGESRLYVTLLSEHATVPTKGSEGSAGYDLYSAYDYVVEAKSR
                     ALVKTDIQISLPSGCYGRIAPRSGLAVKHFIDVGAGVIDSDYRGNVGIVLFNFGEKSY
                     SIKKGDRVAQLICEKIEMPQIEVANYLDCTKRGAKGFGSTGN"
     gene            32137..33264
                     /locus_tag="BC341_gp038"
                     /old_locus_tag="PTPV-Aus-038"
                     /db_xref="GeneID:28340365"
     CDS             32137..33264
                     /gene="PTPV-Aus-038"
                     /codon_start=1
                     /product="3 beta-hydroxysteroid dehydrogenase/delta 5->4
                     isomerase"
                     /protein_id="YP_009268753.1"
                     /translation="MESYYYSPPRDGLVYLVTGGCGFLGEHIVKMLLERESRLKELRI
                     LDIEYKDWLNELVFKFRSVEIVFIKASITDNDIVLNATAGVDLIIHTACIVDVFGKFS
                     DRQIMEVNVTGTKNLLEACITNGVGYFIFTSSMEAVGPNTDREPFIGDEDTAYTVKHP
                     HVYSRSKAEAEKLVLSYNGRAVCGGRFMTTAAIRPTGVYGEGDALTMKSFHQAKKLRN
                     KMYRTISPTVEHSRVYVGNAAWMHVLLAKQMPYKSKIVGGQVYYTYDNSPTGLSYEDF
                     NLLFFKFFGVKLVGETKPVIPHNMLKALAYVNKGIQTCLKPFCKFTPMLNPATLAIAT
                     TTFAVKTNKANEHFGYRAVYCWEASQLRTIKWIFNTELLEV"
     gene            33283..33708
                     /locus_tag="BC341_gp039"
                     /old_locus_tag="PTPV-Aus-039"
                     /db_xref="GeneID:28340366"
     CDS             33283..33708
                     /gene="PTPV-Aus-039"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268754.1"
                     /translation="MSNFYSSDKYREYCNRQKMAVNILSYYLMKNNDIEPYMMLVNFY
                     NRCNNTELKFYALKSFTNALIFYKESKQNILSNSHIKTVNEWQKDVKKFEQVCDKEIS
                     KYSCMSRVRKYFYIRRLKCKKDTLSKIILMKIKYNEINA"
     gene            33721..34551
                     /locus_tag="BC341_gp040"
                     /old_locus_tag="PTPV-Aus-040"
                     /db_xref="GeneID:28340367"
     CDS             33721..34551
                     /gene="PTPV-Aus-040"
                     /note="trail, membrane-associated"
                     /codon_start=1
                     /product="tnfsf10-like protein"
                     /protein_id="YP_009268755.1"
                     /translation="MVKYAYTKIKNELLDDEETKKLSYYKTYIILAFVLAVFQTITFS
                     FIYYGLVNHFNEYSYQLQIDVVNCLDGKNTALHRCQDIRNSLSSYVNKNNVQMFKDIL
                     KSVARYKKCKYSKFNTSVAHVTGNNNWNERLYPNNYSFLGNKITSWSNTSNNVVLSNS
                     YYIDGEIIVTVSGLYYIYAQTYFKLIFGYNSKGNSKNIQMVQYIYKNTSSYGDPLMLM
                     KSARSNCWDKTAEYGLYSVYQGGIHYLKKGDSVFVTVTNKNFLAMDYRSDYFGAFLIK
                     "
     gene            34613..35101
                     /locus_tag="BC341_gp041"
                     /old_locus_tag="PTPV-Aus-041"
                     /db_xref="GeneID:28340368"
     CDS             34613..35101
                     /gene="PTPV-Aus-041"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268756.1"
                     /translation="MENVLIRDVSVLSDDSLTKFVHICALRLVENGSKHQYNALFVFI
                     ENTKSASFKQYAASALIAALHIRLRASKKHLPVLEKHREMIRTWTASRNIVLEEVNKL
                     VNSFNTKTSEDKHTAFINAVRCYASGNISGYLALKQMYLLHGHIPAKNMLEEIAILMN
                     NA"
     gene            complement(35102..38113)
                     /locus_tag="BC341_gp042"
                     /old_locus_tag="PTPV-Aus-042"
                     /db_xref="GeneID:28340369"
     CDS             complement(35102..38113)
                     /gene="PTPV-Aus-042"
                     /codon_start=1
                     /product="DNA polymerase"
                     /protein_id="YP_009268757.1"
                     /translation="MDIKCLNWFESKGENRALFLKARDRNNDSVFIKFEHNYYYVVRE
                     STKNELTIVPKYSKCLGDMNIVNIDERVITNTAVKNYVPENSTLWLIAHPSKLVIKEE
                     LMAEFLNITWFFLINNIVPDGCFRLNTDYLTLIRKGCYFCNNPELCFKNPIPRFDVSK
                     TYLYFDIECQFEKKFPSVFTNPVSHISCCYIDKFNKEYKFTIVNKELLSQEELDKAGD
                     ILQIDTVNEMDYDADIVLCSEITLLRIVKKLLELSFDYIVTFNGHNFDIKYLSTRLTI
                     LTNEYILFKTPDKAEAVRLCVYERNLASHKGAGGMANTTYHVNNNNGTLFFDLYAYIQ
                     KTEKLDSYKLDSIAKHAFYCKSVACPDKNGNYMFVGNNSTDAKGKAELFSAVLATGNY
                     ITINDHVCKVVRKEIYPSEFKVVLDMKNAFTPITNETYELSFGKDNVSLSDMYKNFTL
                     VTAIEMANYCLHDAVLCKHLWKHYGIETKIDAAAATYILPQCLAFEYRASTLIKGPLL
                     QLLLETKTVLVKSGKQKKLPYEGGRVFAPKKKMFTNNVMIFDYNSLYPNVCIYGNLSP
                     ETLVSVVVSSNRLEYDINLKQLKKKFPQPNYILVECEPRSEDLISEVAIFDRQQRGII
                     PKLLLNFLDKRAKYKKMLKEAENSSDKEIYDSMQYMYKIIANSVYGLMGFRSSVLYSY
                     ASAKSCTSIGRSMITYLDSVLNGAKLVDGFLELASNPTNPFFGGFGKKEISTSIDPSI
                     TMNFNSVYGDTDSVFLEVDSKDVETTLVVAKELEKIINSIVLFDNFRIEFEAVYKNLI
                     MQSKKKYSTLKIAAGSKNADSAVRINKGTSETRRDVSKFHKCMIKKYKTQLSDTLSAG
                     ILTDKQVCVDTLKSLELDLMLEFEMRQSPLEMFLLSRTHHCNYKLNDNPNMALVNKYN
                     SENVEAIEIGERYYFAYVCPETLPWQKKLTNIKTFERIVDKSFTLDGERIFYEIYFKR
                     LATEIVNLLDNKVLSTQLFEKLFGTKPIFYS"
     gene            38143..38433
                     /locus_tag="BC341_gp043"
                     /old_locus_tag="PTPV-Aus-043"
                     /db_xref="GeneID:28340370"
     CDS             38143..38433
                     /gene="PTPV-Aus-043"
                     /note="fad-linked"
                     /codon_start=1
                     /product="sulfhydryl oxidase"
                     /protein_id="YP_009268758.1"
                     /translation="MEPRFWGRSMWTVIFIILSQAKVHKDVELCKKHLYVICTTLPCV
                     VCRKHATKAIEKNNVMSSSDLNFIYYFFIRLFNNLATDERYKIDVTKVQPLV"
     gene            complement(38430..38846)
                     /locus_tag="BC341_gp044"
                     /old_locus_tag="PTPV-Aus-044"
                     /db_xref="GeneID:28340371"
     CDS             complement(38430..38846)
                     /gene="PTPV-Aus-044"
                     /codon_start=1
                     /product="virion core protein"
                     /protein_id="YP_009268759.1"
                     /translation="MEIINIFLDTESGKIKFSSPAFTCGECTRVNYIKNTINTFLDEL
                     DKYIDVDKSDFYIAIKDKDIFYFHCVNGTTSMVNNEFYIFNHGLLVSDSEKKETDDVQ
                     SVVFVITDTLPATVFPRKNVSVTFYSCNNKFDVTSL"
     gene            complement(38833..40890)
                     /gene="PTPV-Aus-045"
                     /locus_tag="BC341_gp045"
                     /db_xref="GeneID:28340372"
     CDS             complement(38833..40890)
                     /gene="PTPV-Aus-045"
                     /locus_tag="BC341_gp045"
                     /note="modulates raf/mek/erk pathway"
                     /codon_start=1
                     /product="virulence protein"
                     /protein_id="YP_009268760.1"
                     /db_xref="GeneID:28340372"
                     /translation="MFLYTKEARLALKKLISANLKIEKLSKKHVSSLLRFSLHGMLPS
                     DLYDEAIGVSVINVRFFNLDTIKVSDLIASLKYFDTVPKELENTIMYHKKTIIESGDE
                     SALKFLMANDLIYIEDVKAILEKQITTTTFLLINSPRLACGYMQLTALELVATLLLIN
                     KEDWVNVISKINISEKQLLYFCERLSYPPVNPTLKKIKDEAKCLEFIKKHFEYPVIKY
                     VCETVKASKTFVYGCIEIIDKKLPKLNKHLNEFIASTIVPEELVLKYGIRAIVMFGIK
                     IPLNIDTLTVSEQCFVEQHIALYDAAASRFSIRFRDRSQRLSKRTLTMRSGDKLVNHP
                     LVRHIKCQNAVLDDILKYVDAANYKISKGELDNLMSDFCMDPLACQTIIMSTVSLKTK
                     LLAIKVIRNWKTYSLSSTSTFSRMVSGIIYMDLFDYTGARILQTYKKTYDEIIRCSNT
                     PMPPECDCFNCIITYNPITKRKLFSKVLQLSHTNLIKDNLVVGAVTDSVLLSILSDLI
                     LLARHGVVDLDFLNTRAWGPLVTLFAGTKSLNVSIFRQATAMEQLEQANICSDGLSDS
                     SNLVKLSNVYLCDIIKGYSPINPEYVSVVLFFNCIIEYMQAICMYRIHICKNTKRTRE
                     FITKVISTVLDTLNIPHEEIPVNSIVVTEMLEIESCALQVHSLHLFLKVVLMVLEDIN
                     GNY"
     gene            complement(40938..43436)
                     /locus_tag="BC341_gp046"
                     /old_locus_tag="PTPV-Aus-046"
                     /db_xref="GeneID:28340373"
     CDS             complement(40938..43436)
                     /gene="PTPV-Aus-046"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268761.1"
                     /translation="MEFVLNAEVREALEQRFNTHDELTISSLCKTTLCGTLHKYSDFD
                     VVKLVIKLSEYTTLSALYVHPSYIYAHHVVDMILNCTRIHDDCIPYVNKHVPSCVKIL
                     DHDMLIKLVQIHSTKYKTVYAERCKQREYNYFCASYAFSHPLKPFLTEAIRKGYSKYH
                     KTFPYWLVKGIPSAVEFIHDDKLEWFLDDNFRVVTEALNYRYVPSQILLKLFKSYNIL
                     PYNHGLLEIKDPNVLCDIVFHFMKNPEIDFTSFVDHKTFCSEKVCKVIINNLCPHVSK
                     PLIRTCLTTFYTNVELRAIIGMSYYVCVATEDEIIEMGQLETFNMLTMDDINMLLKNV
                     YVLELMDIKDLVKTLVIQLAELAPSKIFSCAVSNPEGYLKLMENSLSEEHCAVLIRSC
                     ARKIYAVIPHSVTTPCIFEALIATNTFSIQLMEVEELANIASYPHLQKIIDSIELEDL
                     LCIDFHYINALVSDNKLDLFRIYAEKFSEHPCYFGVVTSHKFKPVREILLNHTFAGRF
                     PMTYLHHVMYTEAYKWCPKSMSLNTPLNITKTMHLEIQSDKNIESTLSDGSIVLVGSF
                     VRRRAIISEVFSKSFNGGNEPTKRFKSEECYKIIIPNIQESPNHNNQYFDVWREFGHS
                     YVNIISQADAFVGLNFHRVQVKLSAVNAINQLLLDLLTLMERGIFFKLFNTTNTDLYE
                     HVMDCSIINIIRHDAIKLCYDSYITLDDELATITMSFKKTNLYLARVRIYAHYLLQYI
                     LYTSVLWFRYNNTTIQFDHVLKLLCITLTDGNTDIYDDDIFKLAADELYSLFNFIIPL
                     NEEYSGTVNSTTYIDALMSKVLALSIKARLSRCK"
     gene            complement(43458..43598)
                     /locus_tag="BC341_gp047"
                     /old_locus_tag="PTPV-Aus-047"
                     /db_xref="GeneID:28340374"
     CDS             complement(43458..43598)
                     /gene="PTPV-Aus-047"
                     /codon_start=1
                     /product="virus entry/fusion complex component"
                     /protein_id="YP_009268762.1"
                     /translation="MLLIVIFLLAFVFCSWLSISYLMPYLAILPETAFKPKKTNKVLM
                     KR"
     gene            complement(43613..44545)
                     /locus_tag="BC341_gp048"
                     /old_locus_tag="PTPV-Aus-048"
                     /db_xref="GeneID:28340375"
     CDS             complement(43613..44545)
                     /gene="PTPV-Aus-048"
                     /codon_start=1
                     /product="DNA-binding core protein"
                     /protein_id="YP_009268763.1"
                     /translation="MMSDCEDKLVLNSISARTLKAYLTSKINDIVDELVTRRPLAKKK
                     QQTKRTEFRIPTDLINEKFVKRFKLCQYKSGVLTSLINSLVENNYFMPDGKLNLEIAK
                     ELVLTDIEVKILNSIAPSSSLYIDTSDVRVLAGRLKKPATEICFNDFTYKIDHERIEE
                     LINQMAIDGTIILDDVCSVKDSVYIISKELISVIKSRMFKAPQVKDGCITKTRLYDFF
                     NKVTKQEDPKIYVILRDPCIATILNIDIVKVGEFYYTKHNILVNAISSNVDRCMKKFE
                     PEFYEKLAPFVKDNEKVNVSRVVECLTIQSVNVS"
     gene            complement(44546..44767)
                     /locus_tag="BC341_gp049"
                     /old_locus_tag="PTPV-Aus-049"
                     /db_xref="GeneID:28340376"
     CDS             complement(44546..44767)
                     /gene="PTPV-Aus-049"
                     /codon_start=1
                     /product="imv membrane protein"
                     /protein_id="YP_009268764.1"
                     /translation="MNKLYTAIFGVYISNPDDDFEKFINAVKSVIVDDDDTCKKKPCS
                     LQSWIFFVIIFIILFISLVVLYLKLTQQH"
     gene            complement(44771..45610)
                     /locus_tag="BC341_gp050"
                     /old_locus_tag="PTPV-Aus-050"
                     /db_xref="GeneID:28340377"
     CDS             complement(44771..45610)
                     /gene="PTPV-Aus-050"
                     /codon_start=1
                     /product="ssdna-binding phosphoprotein"
                     /protein_id="YP_009268765.1"
                     /translation="MRKTSSTGTKAAAASAVKTNKKVNEKRDMTPADVVCFAKSISKS
                     TTKCIDYVTLTQSQYPSCSNINITLTEELSAKLTSPLIMIEGDGKIYKNKSNDNFRQQ
                     NCGFFLRIRPKSASPLLYQLLEHIYTNIDQNVRIPPSLSTLQVTNIVEKTIKEDFIYV
                     NKLSGAIVEYTSSSSCERSRQKCILDELESLALRDPQIIKVLLVPLVVYRTGNETKIT
                     FALKKIMVEKDCSITVLDINGESAKIKMSAEDEEDEEDCVRKLCVVEDVNVEEDDDDS
                     FNV"
     gene            complement(45653..45886)
                     /locus_tag="BC341_gp051"
                     /old_locus_tag="PTPV-Aus-051"
                     /db_xref="GeneID:28340378"
     CDS             complement(45653..45886)
                     /gene="PTPV-Aus-051"
                     /note="vp13"
                     /codon_start=1
                     /product="imv protein"
                     /protein_id="YP_009268766.1"
                     /translation="MNKYDIASIIAVTFLALIMVISGSVLLFKLVAPTRLVSFISPAK
                     ARFMYFMEVLAVNLFVPGTIALYVNYMNALFKK"
     gene            complement(45911..47056)
                     /locus_tag="BC341_gp052"
                     /old_locus_tag="PTPV-Aus-052"
                     /db_xref="GeneID:28340379"
     CDS             complement(45911..47056)
                     /gene="PTPV-Aus-052"
                     /codon_start=1
                     /product="telomere-binding protein"
                     /protein_id="YP_009268767.1"
                     /translation="MNQFVKHSASNIKKPTKLLTFQSNLSMKQCTVNFNFLAFYYNNE
                     LIFTKQTNTLDDVAKSLLILNSFKYEHQILKKIIKSIRDLPSAYISDFYFTPIGWLAG
                     VGDRQSTHAAIRFVYQGNAVTVEKKIREILSKYAVNQISFSHITSELVLPVVEAPATA
                     PTSVITFYPLDPKYAIAILFFGRVEDFHCGIIYTFSKDYLADVVAYIRRISTSVHIIN
                     DEIGKFSTVTLSGNKEGMANIPAQITALCEIEHEFDTSNLYHVAPTVDASTLIPKKII
                     NILDLPSNVEIRCVHKNYMDIITHIGGKKLDIILVIAKDKFLRDVVFEGTFEKENVIW
                     RNKYTYRITKSSFNAPTLKATKSRNKPQSNFSVVPLNFKTKALTYII"
     gene            complement(47040..48350)
                     /gene="PTPV-Aus-053"
                     /locus_tag="BC341_gp053"
                     /db_xref="GeneID:28340380"
     CDS             complement(47040..48350)
                     /gene="PTPV-Aus-053"
                     /locus_tag="BC341_gp053"
                     /codon_start=1
                     /product="virion core cysteine protease"
                     /protein_id="YP_009268768.1"
                     /db_xref="GeneID:28340380"
                     /translation="MDRYTDLVINKIPELGFTNLLYNIYSVVGLCTPLDVSKFATNCN
                     GYVVERFDKSKSAGLVSCIPIGELLALAKNNLLKVIPEVQKPITESTTLDEELEKKKE
                     LVLALKRQYPNFKDVINLPSKIPLSFYFKPQLREKVSHAIDFSQMNLNVDDLAKIGIH
                     TGINPKVVKLQIRPEIDAWMTNRSIASLVAPFAYKSEVTYLGQFNFNFMNKVPVYEKT
                     EKFRRDLMYYTIKDAVSTATTRYVMFGFCYFSHWKCAIYDKENKLIAFYDSAGNNPQQ
                     FYHYENFYFYSFSDGFNLNKKHSVLEQINCDVDVMMRFFVDCFGAKKGCINYEVNQLL
                     ESECGMFSSLFMILCAINPPDSFRSLRQTYTFFRFLADKKMTMLKSILFNVQEQTIET
                     TKTKSEGIKEYVRMERWTKKSIKVLEEKITSRINSLLVNYEPVC"
     gene            48357..50417
                     /locus_tag="BC341_gp054"
                     /old_locus_tag="PTPV-Aus-054"
                     /db_xref="GeneID:28340381"
     CDS             48357..50417
                     /gene="PTPV-Aus-054"
                     /codon_start=1
                     /product="RNA helicase, dexh-nph-ii domain"
                     /protein_id="YP_009268769.1"
                     /translation="MQNIPNLYLFPNCVDIFTHEYSDEDFDKMSKSEKDMFKFAVFPL
                     LKHRWKSAYVVKHNNVIKLNKENVTKTSKDTIWKKVNRSTLKTIHVTSVDKKKRMFKS
                     GKSLITYECYAFLKCDINKDLNSFDEYTLRGLMDAGNKLKIFSNSVGNAKNTINVLGN
                     NKPFSVVPLASLKPVAQREIFSAWINKQYVILTGGTGVGKTSQVPKLLLWFNYLFGGF
                     LSYSKVSNFEEKPIVLSLPRIALVRMHGNTFLSALGFSTWTGSPISIKFSAISEEEIN
                     KNPRPYGMVISTHKLTLSNLFNFSTIILDEVHEHDQIGDIVISVTKKKFKELDSVFLM
                     TATLEDDRERFTEFLPNPVFIHIPGDTLFPISDVYIRNSVSITDYRNYTAQELKNIST
                     AIKKYTPPAKACGIVFVATVSQCKAYLDFLAKELPSVTFFIIHGKIINIDEIINKIYS
                     NEGVSIIISTPYLESSVTIKNATHVYDTGKVFIPYPFGGKQRIISLSMRDQRRGRVGR
                     TRPGTYVYFYDTKYLKPIIRIDSEFLHPYVLYAKYFNLNLPDDLLIIPSDLTLLNKTI
                     EYIDSFNISNDQWMKIISNYYITMVEYAKLYVKGKSLAIEMDNFERFGIMTDNVFKNI
                     ISLQLRAKIISSRYNNVTYIHNCKVMFGPFSGTMFKVAYKRALKGYIYMITETTFVPE
                     TVVN"
     gene            complement(50410..52191)
                     /locus_tag="BC341_gp055"
                     /old_locus_tag="PTPV-Aus-055"
                     /db_xref="GeneID:28340382"
     CDS             complement(50410..52191)
                     /gene="PTPV-Aus-055"
                     /codon_start=1
                     /product="metalloprotease"
                     /protein_id="YP_009268770.1"
                     /translation="MIVFSNGVKVFFQENMKKDIFVGISNFGFSQDIDNILGIAHLLE
                     HVLISFDHTKFVANASTARSFMSFWCKSIRGSPMESVKELVSWFFNKGQLKNDFSSVN
                     IKNYIRELENEYYFRNELFHCMDILTFINGGDLYNGGRISMLEKENEVKQLLSLRMKQ
                     LSGSSVVIFVKQINCKIVDLLKSTFGTLPDCPSYVSIPTLYEQKGKIAMIPSPFYTVM
                     VEIENTLNNVLAILCLTEYYHLIDYETINKKLYLLISFVNEYDYESFLHGNSSLNFQI
                     PGNVSFSHSDDFKMNMYLNFPWISHDIFDYWLETNDNKEKILKSLEENVHLSIVNRNI
                     IVVYPSFSSSIFNVSDQQNHKLVVLDALPSTNTASKTNVISLMKKSMVNKVYVNYSDS
                     ELLSFVSFALTPKFRYGNINKTHDGISFKHTFSADDMNTILESDTFIKYSKSRPAITY
                     QFVFLAFFVSGRSIDDILEHRESAFSMAKGNYNKIIFPKKVKYSVTAKSSFVCGILKG
                     SNLSSVYITGLMWTMKRKGLIYSLDHTKLKEKNTYYVFAFSIYPEKAYNFLINQSHVS
                     SYCIILANKDTVENFSSLNKNVYIVLN"
     gene            complement(52188..52523)
                     /gene="PTPV-Aus-056"
                     /locus_tag="BC341_gp056"
                     /db_xref="GeneID:28340383"
     CDS             complement(52188..52523)
                     /gene="PTPV-Aus-056"
                     /locus_tag="BC341_gp056"
                     /codon_start=1
                     /product="entry/fusion complex component"
                     /protein_id="YP_009268771.1"
                     /db_xref="GeneID:28340383"
                     /translation="MTYCLLNFILFIIFVILLYTMTFGSSNKMQLTIKNMNYWQNASQ
                     KIDNSLPSILDTVIFQDYNNPIYAKVNATYDSQNKKITIKFGKDTKTFNLDSSSDRQT
                     VFPILLLSK"
     gene            52517..53182
                     /locus_tag="BC341_gp057"
                     /old_locus_tag="PTPV-Aus-057"
                     /db_xref="GeneID:28340384"
     CDS             52517..53182
                     /gene="PTPV-Aus-057"
                     /note="vltf"
                     /codon_start=1
                     /product="viral late transcription elongation factor"
                     /protein_id="YP_009268772.1"
                     /translation="MSFRELILFNVLKFIIMSDTKSLKTLASLSLAFGSDIVEKNLSK
                     FNKRYYKHILQITQCTEYVPILDLEFDSDVIREIIKLRLLSFNHTIKPLSKLKLTMKG
                     VITVSRNKVYIYDANDELLEMVMKQYNPSMYNYISSKKPKVIKGSNILVCGFPKISYF
                     AYSISKIYVNVPTTVVVTDTCISTLLKDKHCDILKNIFNNGSGVLNESFKQLFYFLYD
                     QSP"
     gene            complement(53155..53523)
                     /locus_tag="BC341_gp058"
                     /old_locus_tag="PTPV-Aus-058"
                     /db_xref="GeneID:28340385"
     CDS             complement(53155..53523)
                     /gene="PTPV-Aus-058"
                     /codon_start=1
                     /product="glutaredoxin-like protein"
                     /protein_id="YP_009268773.1"
                     /translation="MTETLILIGKPLCGICELASELLKKIEGNYNVLRINIMSLFSKE
                     GAVRVLGMDVYSLITELTEYFSTDYVLLLKYSPEKNECAYVPFKQFIVVAQIDKDAVN
                     YKEMQKVIESASYGDWSYKK"
     gene            53526..54842
                     /locus_tag="BC341_gp059"
                     /old_locus_tag="PTPV-Aus-059"
                     /db_xref="GeneID:28340386"
     CDS             53526..54842
                     /gene="PTPV-Aus-059"
                     /codon_start=1
                     /product="fen1-like nuclease"
                     /protein_id="YP_009268774.1"
                     /translation="MGIKNLKLLLVNQHTLKQCVEFPNGKYPGVFVDTMSIFMTLAYA
                     CGSQEELICAFAEKIQYWKSLGSDVILFVDKGEITIKTKLREKRKKVLTAAVEKKITD
                     RDSILETIKCLENNQDEFADEMLADAQLKLEKKMFHISLGESVFVNNLVGKIISMLGE
                     DVTVKVCEGIDAEMQMCIDAYQVAVETGLWPILASGDQDALLFATIDDLPKYFDTLSC
                     IYEFLPCAYSAYISKLAVLANGCDFFPGLKGIMLTQKSIENMELFETFNAENAAISLA
                     TRNLVYTKGFDTLKAPCDEIVDFINRYAAGDITIYDDSLLEECDARCFIFTALRKKWL
                     EFFKYGDNIKKLSIPKQLVLLLEERVRISKNDIDTLVNIIYDESIRTDLAISNVVEIL
                     GYEVNSDSEIPVIGISESLGILLYLSNDIYLNETRIIKTTDVIKIG"
     gene            54844..55035
                     /locus_tag="BC341_gp060"
                     /old_locus_tag="PTPV-Aus-060"
                     /db_xref="GeneID:28340387"
     CDS             54844..55035
                     /gene="PTPV-Aus-060"
                     /note="rpo7"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268775.1"
                     /translation="MVFTLVCSTCGRDLSEARYNLLVKNISLQEVLKSFQHMCCRLKI
                     STQIEPHRNLTVLPLLDIN"
     gene            55036..55587
                     /locus_tag="BC341_gp061"
                     /old_locus_tag="PTPV-Aus-061"
                     /db_xref="GeneID:28340388"
     CDS             55036..55587
                     /gene="PTPV-Aus-061"
                     /codon_start=1
                     /product="nlpc/p60 superfamily protein"
                     /protein_id="YP_009268776.1"
                     /translation="MTTASYEFIKAYVPRGAIIFVNSWHSLTEQFNPSNDKHAAIYFG
                     DKLCTHLLKTRCVSYDNICDSTLYAIESTAVKGAHIIPLKTLITKSDIKIYILDNFDS
                     PYKIMEQAADNALELVGAPYGFNSNNLYCFKMVANCFEAAGVDVSTYRLLGKDIYLSQ
                     SFTNDPKWKKIYSSESNNMCSIV"
     gene            complement(55584..56795)
                     /locus_tag="BC341_gp062"
                     /old_locus_tag="PTPV-Aus-062"
                     /db_xref="GeneID:28340389"
     CDS             complement(55584..56795)
                     /gene="PTPV-Aus-062"
                     /codon_start=1
                     /product="early morphogenesis virion phosphoprotein"
                     /protein_id="YP_009268777.1"
                     /translation="MIDEQRASCLYSTISSSIVRSVTKGIIKNPNSLEKLARSVYNCD
                     AAKRDQLLSALYAKIEADISVSDTLTLLTILKRLKPHSAYVYNLNEFDRLYCSLMRFT
                     HCNSFFNVFQHTVNSTLSVLITLILSNQLFYAADIVESVENYLFNTQKPLSVELFELL
                     QMKYALINLVQYKMFPVILGKPVQVIGGSPIHDNVAESTQIEVEKMIDMPIKCDAIND
                     MYKFLAEKGIAASINQAEFMAGLKIQEVQDLATTVETALQTQPVQQIARRPSPQLSIQ
                     QNQAQLYNQQQQILNTAKDFNDGKILNGRVTSPLGNAENTSEFIKLSDSELTKYSILE
                     YLYAIRVLANAIKTRSLACASKGITVNINSPFKSLTVPQKISDTLSKVPAKSVQTCAI
                     TNQRQQQFIRP"
     gene            56824..57606
                     /locus_tag="BC341_gp063"
                     /old_locus_tag="PTPV-Aus-063"
                     /db_xref="GeneID:28340390"
     CDS             56824..57606
                     /gene="PTPV-Aus-063"
                     /note="vltf-1"
                     /codon_start=1
                     /product="viral late transcription factor"
                     /protein_id="YP_009268778.1"
                     /translation="MSLRIKLDRLRQIVIYFSEFSEEVSINVDAANGQMYIFAALGGS
                     VNIWAIIPLSASVYYDGVDNCVFNIPVIKVKACLCSFHNDAIICIEPDKENNLVTLSS
                     YHVVSVDCNREPIPHRTDTCISLSIDQKKSYVFNFHLYENKCCGRTVVHLDLLLGFIK
                     CISQYQFLTVGFSDKNLILKTPGKKDTFLREYSMTEWSPELERFNFKMAISSLNKLRG
                     FKKRVSMFETKIVMDKDDNILGMLFSDKIASYRINIFMAFQD"
     gene            57624..58637
                     /locus_tag="BC341_gp064"
                     /old_locus_tag="PTPV-Aus-064"
                     /db_xref="GeneID:28340391"
     CDS             57624..58637
                     /gene="PTPV-Aus-064"
                     /codon_start=1
                     /product="entry/fusion complex component myristylprotein"
                     /protein_id="YP_009268779.1"
                     /translation="MGGGITLPERTPPPPVPTGESKLKVTDVLMAIPNLKIGDFLRIG
                     NKENSPNVTAMLPEFALHDVGIGTLSEITRIKYNASNQFCCSSFKNKYYWLLPDKSIS
                     LNYKDNAVLYTCDPDTFDKGNCDMFLFNLCKTTTDNSDLCSQWIVESFNRHELPSRIS
                     ITSFDKLKKMLIDSCSKDATTQLCKSWLQALRNHRSEANDLLVDQILLSQSVDFKQKY
                     MKCSFPSIETEEKALKINEPRECWDPECAQGEIHYMLTKNFNNLGLCQLTRCNISINQ
                     LSMDDNSKLRMACKTNSENFSSAPVNQAEVIYKNVQDSFSINFELMIVMFFLIICITI
                     VMF"
     gene            58638..59384
                     /locus_tag="BC341_gp065"
                     /old_locus_tag="PTPV-Aus-065"
                     /db_xref="GeneID:28340392"
     CDS             58638..59384
                     /gene="PTPV-Aus-065"
                     /codon_start=1
                     /product="imv membrane protein"
                     /protein_id="YP_009268780.1"
                     /translation="MGASVSVQTVVNTINDKIRTKLEQQASASATAVCDVTIGSLIIR
                     KNLGCSVSVRNLCSAQADAQLDAILSAVTDVYNNLSDSQKAYVPELLTASLNIQTTVN
                     TAVKDFETYLKQTCNSDAIIHNKIKVQNVVMDECASPPGAITHIDFTNTGTAKGNCGV
                     KAVLDVLTKASTKESSSQIANIPTYYLIIAIVLVIFAMIFLYYAKHMLVTSTTDKIKL
                     ILASKPDVHWTTYLDTFYTYSPSVLSNKQV"
     gene            59431..59706
                     /locus_tag="BC341_gp066"
                     /old_locus_tag="PTPV-Aus-066"
                     /db_xref="GeneID:28340393"
     CDS             59431..59706
                     /gene="PTPV-Aus-066"
                     /codon_start=1
                     /product="crescent membrane/immature virion protein"
                     /protein_id="YP_009268781.1"
                     /translation="MMNQVLIAKLNNIERQLQRDELFINAIEHYIIGNMVMVSKLLKL
                     LLDIVFTIYVIIGLLIRFTYRNQWVLVFLILVMLFTWISDYFQKYFL"
     gene            complement(59707..60738)
                     /locus_tag="BC341_gp067"
                     /old_locus_tag="PTPV-Aus-067"
                     /db_xref="GeneID:28340394"
     CDS             complement(59707..60738)
                     /gene="PTPV-Aus-067"
                     /codon_start=1
                     /product="internal virion protein"
                     /protein_id="YP_009268782.1"
                     /translation="MDTNELRTFKTRKKNTFKNQPNSFIKDKPKNVDYEKPPQNPKPA
                     FNQPVNKIIHNEYKDYIDNRICEYYKKIPLSIYNSSSSTYSVKHVSEEEASCWIELSS
                     AVVGKFAVNFPLVIGSSSYNYGRTIFLEEFPNSKVSELNPHDYCVAVPILFQLAVALY
                     CMYKKNIYADCLEFLIVTIPRTTIVYSINQMIFSTNTDSLLILSKSSRLFRAELPQSC
                     YLNYIKTFYALRNWKHFTTDYFFEWLLRNHFDYFSKQQNDLFKHKKKNSPRTQINKST
                     DPGTLVYVSRDDSFVVGVTLTNVSINENIRIMFSSDGLIFEVDDFNINDVYFANELFV
                     RSQLSAITV"
     gene            60763..61524
                     /locus_tag="BC341_gp068"
                     /old_locus_tag="PTPV-Aus-068"
                     /db_xref="GeneID:28340395"
     CDS             60763..61524
                     /gene="PTPV-Aus-068"
                     /note="vp8"
                     /codon_start=1
                     /product="DNA-binding virion core protein"
                     /protein_id="YP_009268783.1"
                     /translation="MSLILEHIIDDDSVFSGGAAIPCLEDMPIVIAGARVKFPKSMLS
                     LFHIIPRTMSRYNLELVNTENIVGGTFTTAYNIRRNMGITSDPLTIKLIEKYFLDSAN
                     EVLTLMIRNTSFSNLKQFKKKGKRNNNPVIFRSGSSPLLLIIESKTKQISIYKEDTSK
                     QNDSYTPVGENVALVSKYAGITLLDVHTPSKFMELTAIYGIKGNNTLKKLSTDKDLKE
                     YQESPLSEPVRLNDFINLFESIKQNIPMTSVPVSD"
     gene            61542..61913
                     /locus_tag="BC341_gp069"
                     /old_locus_tag="PTPV-Aus-069"
                     /db_xref="GeneID:28340396"
     CDS             61542..61913
                     /gene="PTPV-Aus-069"
                     /codon_start=1
                     /product="entry/fusion imv membrane protein"
                     /protein_id="YP_009268784.1"
                     /translation="MSTTVNLSPVFVAPTFEHSLLRADKYIFIELFEFIVVVFLVYVF
                     FKDEIVSMFTPVTPINELDKYKDTYLTCYGNKLYIISDNKQLPALSLNFKQIEFEGCS
                     TILRNINGSRTVRISDVLNRQ"
     gene            61867..62337
                     /gene="PTPV-Aus-070"
                     /locus_tag="BC341_gp070"
                     /db_xref="GeneID:28340397"
     CDS             61867..62337
                     /gene="PTPV-Aus-070"
                     /locus_tag="BC341_gp070"
                     /codon_start=1
                     /product="imv membrane protein, virion morphogenesis"
                     /protein_id="YP_009268785.1"
                     /db_xref="GeneID:28340397"
                     /translation="MDHAQYVLAMFLTDNNSFYSYMADQSDQDALEIVSEITEYLNYL
                     LKLLLQSKQKLEAIGYCYEHLAENFKSVVCFEDMRILKRLVDKTPTSKIDQIKLNKDH
                     LADFVVALHRLKKNMPLDIPLSVTQVNMSQNTFLNNILDILTESENKDNKTKIK"
     gene            62376..63377
                     /locus_tag="BC341_gp071"
                     /old_locus_tag="PTPV-Aus-071"
                     /db_xref="GeneID:28340398"
     CDS             62376..63377
                     /gene="PTPV-Aus-071"
                     /note="vp39"
                     /codon_start=1
                     /product="poly(a) polymerase small subunit"
                     /protein_id="YP_009268786.1"
                     /translation="MTAKSLNKPFMYYDEIDGEEEYSKTIEQLAPVKFSSQGQLKLLL
                     GELFFLNKLHVHGILDGATIIYIGSSPGTHIKWLYDYFTQIGIVLQWILIDGRKHDVM
                     LSKLRYVTLVHKFCDEEYLRELKRTNKNARIVLISDIRSKKSGDEPSTEDLLSDYSLQ
                     NMMLSILKPVASSLKWRCPFPDQWVKEFYIPTGREMLQPFAPPYSAELRIINIYTSDK
                     AQLRLITIEDAKIYERKMFYYNNTVRKKVIINFDYPNQEYDFFLMYYILRSVYSDKKF
                     SSTKEKVLFLQQSIFKFLKIPLTVTTKLNNEQTQHKVPSKNPVPKGKGRARPVRDNK"
     gene            63292..63849
                     /gene="PTPV-Aus-072"
                     /locus_tag="BC341_gp072"
                     /db_xref="GeneID:28340399"
     CDS             63292..63849
                     /gene="PTPV-Aus-072"
                     /locus_tag="BC341_gp072"
                     /note="rpo22"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268787.1"
                     /db_xref="GeneID:28340399"
                     /translation="MNKHNIKYLAKILCLKAKVAHDPFATISKDVLSMYDITTNYGDI
                     VSIVTVVHKIDTKVTVFQVFNEASVNYSPINNDYGVPIIITSYLQPEHNKFPISFLYI
                     DAVASDLFPTFKRLTQEEYTTVTSVLLTGNKKESLKLPRMLDTELSAKILYHKEYPAK
                     IIRFFRSNLVTGLEIADRSVANVIE"
     gene            complement(63851..64264)
                     /locus_tag="BC341_gp073"
                     /old_locus_tag="PTPV-Aus-073"
                     /db_xref="GeneID:28340400"
     CDS             complement(63851..64264)
                     /gene="PTPV-Aus-073"
                     /codon_start=1
                     /product="imv membrane protein"
                     /protein_id="YP_009268788.1"
                     /translation="MDPKTDKEIYEYCDANPTDIRCRCLNPDPSIVKIGKETRLPYYC
                     WYEPCKRADALLPAFLKKNISRCNVSDCSVSLGHVSLQKGNMNVFNVCGSHTHTTVKF
                     SAKYLNQDIVYPIFDPKQWLPFIIIAFSIVILISK"
     gene            64337..68197
                     /locus_tag="BC341_gp074"
                     /old_locus_tag="PTPV-Aus-074"
                     /db_xref="GeneID:28340401"
     CDS             64337..68197
                     /gene="PTPV-Aus-074"
                     /note="rpo147"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268789.1"
                     /translation="MAVIAKVSYSLYSQNEINATDVLISHIKNDDEIGTVKDPRLGAN
                     DGALCKTCNKTELECFGHWGKVRLYESHIVKPEYINEVVRLLGHICIRCGLMRSRDPY
                     IVENIEKLDSHSIKKLKDKVLSKKKICWNNKCMQPYQKVTFSKKKICFVNKADDIPIP
                     NALIYQKLTSIHRKFWPLLDLQQYPGTLFYRGSFPVPPLIIRPSVNFWVDSIPKETNE
                     LTYLLGVIVKLCNNNAEEHAIQKAVIEYDNIKIIANNSTSINLAYITSGKQNMIRSYI
                     VARRKDQTARSVIGPDPNLSINNVGVPNYIRNTLTEKIFVNNFTISLVKELFEKNEIK
                     FYYNKQLKQLTRIKSGKFIRNKIHLVPGDWVEVSMRENTSIIVGRQPSLHKYNVIASS
                     AKPADGFTITIPPGIANSQNADFDGDEEWMILEQNPKSVVEQSILMYPTTILKHDIHG
                     APVYGSIQDEIVAAYSLYKENDLSLSSVCNILGKYSLSFTGNKKTFTGKDIFEFLINE
                     KISYPGIIDDGKLITDVIDNNFVVSMRQMSFAGLISDYASNVEGAAFVDKLSYVLKRY
                     LTQYGFSVTFRDLRPSPTFTNQLRALNLNKMELIKESYKNYLNDVAAKKILPMFEADE
                     SDAVETVFANLTNLNITEINTYMQETLKNNPNNNLLKMAQAGYKVNSTELMYILGTYG
                     QQRVNGEIPKPRVLGRILPYNLPDSKDPEGFGYITNSLMQGLTGSQYYYAMLVARSQS
                     TDIVCETSRTGTLARKVIKKMEDMVIDGYGQVVYGNILIKYAANYTKISGQYGKPVEL
                     LFPNENMTWYLEISALWNSIYKGFIYSQRQKLTKKILSPFNFQVFVKKAKDNETAISA
                     KELYDMIQNVILNIKENYYFNITNIQFIEYVLLTHLNPSRVKITKQTAILIFEKLYEK
                     LNYTLGGGTPIGIISAQVLSEKFTQQALSSFHTTEKSGGVMRKLGFNEFHNLTNLSKN
                     KAEIITLITEDVDKLKTLKVNFEFVCLGELLPDISVTKEPDYYVISVVINRLYIKRLN
                     LTELIVEHIIERFVSYNVMVTEWGLDTIIEDDQTIKFNIYANFAEPQVLNVNKFMIVL
                     PGAASKGKISKFKIPITEYLAYYDFDSTKKMYRITVELMSLKELGSFDLENVNVIPGV
                     WNTFEIFGIESVQNYLCESLLNTYGDGFDYLYQACDLLSSLLCSNYEPESINKFKFWS
                     VSALKKATFGDNRALLNAALHNKTEPVNDNSSCHFFSKVPKIGTGYYKYYINLDMLTR
                     LEKKISANIATKKVEEIDETAEEF"
     gene            complement(68194..68709)
                     /locus_tag="BC341_gp075"
                     /old_locus_tag="PTPV-Aus-075"
                     /db_xref="GeneID:28340402"
     CDS             complement(68194..68709)
                     /gene="PTPV-Aus-075"
                     /codon_start=1
                     /product="tyr/ser phosphatase, ifn-gamma inhibitor"
                     /protein_id="YP_009268790.1"
                     /translation="MDKKSLYEDLLMKSTNVIPVQAPKNITKITNYIYLGNFNNVLNM
                     HLYGINFKYTLNLTTSTYTPTIPGVTVFNIPIKDDNVTDVTKYFDDVTGFLQKCEERK
                     MPVLVHCVAGVNRSGVMIMAYLMSQKPLNVPSFVYFLYVYHSLKEKRSAFLENASFKK
                     QVIKYYVTDKL"
     gene            68724..69299
                     /locus_tag="BC341_gp076"
                     /old_locus_tag="PTPV-Aus-076"
                     /db_xref="GeneID:28340403"
     CDS             68724..69299
                     /gene="PTPV-Aus-076"
                     /codon_start=1
                     /product="entry/fusion imv membrane protein"
                     /protein_id="YP_009268791.1"
                     /translation="MTDYTTLTVRGLDLNYVNTQEVKGISAVRTSTLCFFTLILAVSA
                     LILWLYVSNNTVLEELSRYVRIKNTVRGWKPLVNAKSNLESDRGRQISADRPELFKFQ
                     CVDFGTYFLPVRLNKDNYLPEAIQRGTGDGWVIQKAAKVDLSAQQFCQYVIQKYSQNT
                     ITCGNEMMKKIGYSGFFEGDHWCALYHNLLT"
     gene            complement(69296..70441)
                     /locus_tag="BC341_gp077"
                     /old_locus_tag="PTPV-Aus-077"
                     /db_xref="GeneID:28340404"
     CDS             complement(69296..70441)
                     /gene="PTPV-Aus-077"
                     /codon_start=1
                     /product="imv p35 heparan binding surface protein"
                     /protein_id="YP_009268792.1"
                     /translation="MAQRLRPNLKDDPPSPEKYYAFVIPIVDRKATEVFPTLTYLFDG
                     DSTPDDRTTNIYKNVNQGHNFKCLNEGSNSLGADPPTPQPQPQPQPQPTPTPPSPSGD
                     HVITVTLWHVTKDDLEHDKDYPHFFSNSCKALCANETKYRLTQHFSLWEHYVNEIDKS
                     KQQKTPPPPDPENEFVIIVEDDNTVLKPELLKPLIMAMKSQKIDIIQFGDTVTAPGLS
                     PINLTLLVQNPPIYGYVGGIDFSLSAYIVRLSALYGIYKNIINTGGSSAGLSFEISKI
                     ESELNLTRYVVSNPSEILRHEPYYVIQKRLGGMSGCFWQKLGLWLSKWYPKLVYFSTT
                     PIFSIMGLFDVNVVDIIILIYIAFLIIFYVRSPFLWFIAGLLLTAII"
     gene            complement(70442..72826)
                     /locus_tag="BC341_gp078"
                     /old_locus_tag="PTPV-Aus-078"
                     /db_xref="GeneID:28340405"
     CDS             complement(70442..72826)
                     /gene="PTPV-Aus-078"
                     /note="rap94"
                     /codon_start=1
                     /product="RNA polymerase associated protein"
                     /protein_id="YP_009268793.1"
                     /translation="MDSKEAVLTEIVPKIKQYLLDPNTGPKSYTDFIDKNKSIFVVNL
                     YNVSSVTDEDIKLLYVTIEQNPNTDDQTLISIFSYIGYKFEKNVREDVTVSLSVGERI
                     TDDMTYAIYYLFFNTLDLYIRQKFVSILVNDESTSDVAVNYKQSNIVSSFDTNIETEI
                     REIPFSMKDLLPYLAKNLDQLRFSKKYLEFAYLCRHIGIPISKRKFNVRYVYSYKVND
                     IVVPIVIKDYLDVKYVYLEDTNTVYKNSFSEENNKALADWGKLALPKIKNKKIYHYLF
                     LSSYHLRDLFIDLIDIQNTLFKTKTKTDIIYIDNIDNWNEGISFEYTPCAHQVKLEEV
                     LKIDVDYFVKINNFVTEFIYYEDGVAYCSICGMNVPMFNADAADVVKSNVIVSTFNKS
                     IFLTEPYSYFVHSQRFIFNIIMSFDTIMKSQAWIMKYNINRLILNFLIAINSKRHEYE
                     KKFVNEIKQGVFFLRLTANLFDIHVSASELFYASKVLNLNYIVSLVIILNSSADFIVT
                     YMKNKNKTVTEESLKYSISVIIYDFLVKTNAAEKGSLDTIILLTDVYTSIMPDELNAH
                     YARIVIELNRLESIQRTALQAFYDVESTAKEDALRAIMFFKSTMIASKRLISDKADEY
                     PTQVIKPTATAKDTKEHREEFEKLLGVESRVLIRMYDTNAINLEIFAEHLKIEIEKKK
                     VIIPIKSLFVSNVLKYYFSKTEMLVFKFGDPFPFNDMLIDKEHVQYKVNGYNLFRREL
                     LPESDIFVYFSDSLVRYDLEYAFYLFLSSYVDVPKWISENSAKIKELYMINYNN"
     gene            72944..73567
                     /locus_tag="BC341_gp079"
                     /old_locus_tag="PTPV-Aus-079"
                     /db_xref="GeneID:28340406"
     CDS             72944..73567
                     /gene="PTPV-Aus-079"
                     /note="vltf-4"
                     /codon_start=1
                     /product="viral late transcription factor"
                     /protein_id="YP_009268794.1"
                     /translation="MAWTITPTAGSSFQTLDSLREHLKESVENPQDEEEGPDNVDCLF
                     PADEITKPKRKPRVTKTKKQSPPKSEEDSACLKPKRTPKMASKEISSSDEEDDCGTSP
                     QPSCPRNSFENIQNQEKDFCEEQDISTDVDEFTDLTVAVTEITKALKAITVKVTAVSS
                     VLSDVQAASVTRTYTSLQKAVNNLSDLANCGKSLTTRSKRKAAPKKR"
     gene            73573..74532
                     /locus_tag="BC341_gp080"
                     /old_locus_tag="PTPV-Aus-080"
                     /db_xref="GeneID:28340407"
     CDS             73573..74532
                     /gene="PTPV-Aus-080"
                     /codon_start=1
                     /product="DNA topoisomerase type I"
                     /protein_id="YP_009268795.1"
                     /translation="MKGLYYKDNKLFFDKELTQNVPNSNPAYSVLKSIKIPAHLTDVV
                     VYEQTLEEAVNGLMFVGLDSKGRKQYFYGKNHVKNRNEKRNKIFINVYLVINKINNFI
                     DNNLSKPNKDNKDFKSQLAVFMLMETSFFIRMGKMRYFKDNDTVGLLTLKNKHIIISK
                     NTVKVKFVGKKCIEHEFVIRKSDRLYEPILALVNKKKPDDFLFNKLNEKKVYDFVSQY
                     NIRVKDLRTYGVNYTFLYNFWSNVQSITPIPPIKKLISISLSQTADTVGHTPSMSKNA
                     YMANTVLDLVKDKSIYETINSSTFDEFLNHVIDYVKNTNVVNG"
     gene            74525..74959
                     /gene="PTPV-Aus-081"
                     /locus_tag="BC341_gp081"
                     /db_xref="GeneID:28340408"
     CDS             74525..74959
                     /gene="PTPV-Aus-081"
                     /locus_tag="BC341_gp081"
                     /codon_start=1
                     /product="crescent membrane/immature virion protein"
                     /protein_id="YP_009268796.1"
                     /db_xref="GeneID:28340408"
                     /translation="MDEKIKVLCSTIFIDKLSTTDLLALELFLNKKNIFSQMICVDEN
                     NSLVLDFKFESYNVSDYLTVELTQLTSKDRKKHISEIAKHLTTVNVIQSNPEDYVKKS
                     PTLKTFVKVYKNKKRIDKAKRLMKIAEEKGINCAFVADTLLI"
     gene            74996..77542
                     /locus_tag="BC341_gp082"
                     /old_locus_tag="PTPV-Aus-082"
                     /db_xref="GeneID:28340409"
     CDS             74996..77542
                     /gene="PTPV-Aus-082"
                     /note="large subunit"
                     /codon_start=1
                     /product="large subunit mRNA capping enzyme"
                     /protein_id="YP_009268797.1"
                     /translation="MEKSKVSDSLSCFLHALVNEIDSLPPHNPKEDKHHELELVFIHP
                     PLITLSNILNISTLVDSYVQFTVTMSEDNSKIRTRTPMTNVHGLDIKNNQLVDNIQRI
                     VWEKKSLISQKEFCYKECILRHATEENYVFVDFRKFNSSIKIELVNRVRAKLKNVMAE
                     FKIKYFLGSGSQSKSSMLHALNHPKSKPNTTLEIEILSTEDERPSKEELRDEVFKLSK
                     LLFMGHPDNIFFYYQSPKMYPKTIMLKKQELLTLQLENLYIVGKTDGVTTHVLVDQSG
                     ILCYFKHLGYAIKYKCNKKLTGVIELVCEAVKNQSNNTWTLYVIKVIKPSMNDRLSEL
                     EFVNEELKNICDRITFKTKKFNGPFTTHTELIESLSKMMEDQPEGVIVFYSKGPKSTL
                     DYKIKKDNTIDLFLNITYRYMSSEPVIFGENNLFLEYKKFANDKGFPKDFGTGKLIIS
                     DSVKYLNNLYCISFHNMFNDVGIKTVTVPIKFVGEFSYNGEFIKPRLDKTMQFFTDLG
                     YYGNQYNVVMTHINDQELKINEIFDTDKLADVGKRSQFDDTSRLNQDTAYFTKKRTRG
                     PLGILTNFVKTLLISLYCSKTFMDNTARRKVLAIDFGNGADLEKYFFGEISLMVATDP
                     DARAIETGMERYNKLNAGVKSKYYKFNYIQETIRSSSFVSSVREVFYFGKFDLVDWQL
                     AIHYSFHPKHYSTIMKNLSELTASRGTVLITTMDGDFLETLTEKKTFVIHKDLPPSEN
                     FMSLEKIDDSKVLAYSPATMSKPMVEYIVKKNTITRVFSEYGFELIDYVSFYDVIKRS
                     KDFITGVSKLEKRQSTKNFFELNRSVVHSLDSLDVEDLLRYYVVYVFSKR"
     gene            complement(77504..77890)
                     /locus_tag="BC341_gp083"
                     /old_locus_tag="PTPV-Aus-083"
                     /db_xref="GeneID:28340410"
     CDS             complement(77504..77890)
                     /gene="PTPV-Aus-083"
                     /codon_start=1
                     /product="virion core protein"
                     /protein_id="YP_009268798.1"
                     /translation="MSIETKINDFIVIDRGEDGLPNIIYIYDSIARFENYSIYKIAKY
                     VFRNNITALAAIFPNSEFLDSIPFLIPKKTFHIRDSKTNELETLSPEYIKRVLINLFN
                     SFRTFDDSLNISYYLPLRKNIHNVIS"
     gene            77883..78680
                     /locus_tag="BC341_gp084"
                     /old_locus_tag="PTPV-Aus-084"
                     /db_xref="GeneID:28340411"
     CDS             77883..78680
                     /gene="PTPV-Aus-084"
                     /codon_start=1
                     /product="virion core protein"
                     /protein_id="YP_009268799.1"
                     /translation="MDIYTVKDNLYPDSISNKCYVLLGNHDIFIKKSLNSLSDIVMFS
                     KFEISARSPCDFLANIVHSSAVLNNRFLSPVEFLEASCPAFCSNVSVDDLEKHISCNN
                     TTISVYVTVFKDVYKNWKSVVFVQCPSEISVPNNITINNIKISNLDIILSNPYLAFTS
                     SLDSDTNQRLFNNLVLRASVNEMIIYNNKSKLVSFLKKIIPNSFDVNFIALVNESDTS
                     NVKLALLNNNSNALKAFTHAWFSGQLSANDEENIKITNTYKSVITLF"
     gene            78687..79346
                     /locus_tag="BC341_gp085"
                     /old_locus_tag="PTPV-Aus-085"
                     /db_xref="GeneID:28340412"
     CDS             78687..79346
                     /gene="PTPV-Aus-085"
                     /codon_start=1
                     /product="uracil-DNA glycosylase, DNA polymerase
                     processivity factor"
                     /protein_id="YP_009268800.1"
                     /translation="MRVIELTVSPYKLEYHEDWEPIIEQLVDGYTEIAPWILQHETSP
                     PPDKFFVQLKEPLRNKRLCVCGIDPYPTGATGVPFESPSFVKKTIIAFAEAASKATKV
                     TSYSGYNVAQIPGVLAWNYYLSCRVGETKSHAIHWEKISKLLLQHITKYISVLYCLGR
                     TDFSNLKARLNKPITIVSGYHPAARNGQFLKERALEIVNVLLELNNHEPVDWAKGFLY
                     N"
     gene            79379..81742
                     /locus_tag="BC341_gp086"
                     /old_locus_tag="PTPV-Aus-086"
                     /db_xref="GeneID:28340413"
     CDS             79379..81742
                     /gene="PTPV-Aus-086"
                     /codon_start=1
                     /product="ntpase, DNA primase"
                     /protein_id="YP_009268801.1"
                     /translation="MATQVENNIIFVLKKLAVTKSCRESEDERYVEAFTCEELEAYIK
                     QHPTCSLFETLRNEEEFSVVRLFLDIDVSYPMDEQEYVLALKELITAYTKFVTSFVSV
                     HCSVKNTDKIKKCMMTNFSITLSNDTDKTSSHIIFLDVYTTMDTLIAMKKPLLKFIKS
                     SENPLIRSIDPAIYRKSTTLRVVDTRKTKTNNYVHQRRPPHTKISDYLFTYVEMSEKT
                     CYFTIDAEKTDNAAIEKIWEPNFISFSDAMKRVKKAIVNEIVNIDEITDSNFVSVPLI
                     IDYVSPCAICKKKSHKHTHHLSVRDDTLRIYKSGNPYSCKVKVISLEGNRLFSAAQHI
                     FNANVVQMNERGDHIVWLKNSWRYNDESLLTKLILSMRDNLLEYNIDILCPRKRKIIE
                     SNLRDMIVDTVETDLYFDKLPFNNGVLDIATNKFYTGEQAKPFMCTVSTGYNFKEDVI
                     KCTDQVKEVQKELYSIIDDIQPKTAENLENREIYERVLSSCLCGMTKQCLVFFYGETA
                     TGKSTTKKLLKSVVGSMFVETGQTILTDVMDKGPNPFVASMHLKRAVFCSELPDFACN
                     GAKRIRADNIKKLTEPCIVGRLCFSNKINNKNHATIIIDTNYKPVFDRVDNALMRRII
                     LVKFRTHFSTVAGRKAAENNSSYDKVKLLDEELETKIHQNYFRTAFLNILIGWYQKYH
                     CPILKLEPTPHAVPDFAFHIKVNSLIIASAMSHMVHIEHFAKLGYSILDGEIGLTASL
                     FQQRLGKHFNSKISIHDIESFVNRNKKFNSIGEEYVAFIFIEDLPNK"
     gene            81739..83631
                     /gene="PTPV-Aus-087"
                     /locus_tag="BC341_gp087"
                     /db_xref="GeneID:28340414"
     CDS             81739..83631
                     /gene="PTPV-Aus-087"
                     /locus_tag="BC341_gp087"
                     /note="vetf-small subunit"
                     /codon_start=1
                     /product="small subunit viral early transcription factor"
                     /protein_id="YP_009268802.1"
                     /db_xref="GeneID:28340414"
                     /translation="MNANIVKLFKNHVDNIPSILPHQLGTLDFLVRTVLENNNSVLLF
                     HIMGSGKTIIALLFALVASRTKKVYILVPNINIMKIFTYSLDIAINLFSDEFILENIF
                     IYSTTNFYSLNCTDNVINYNGLTRYENSIFIIDEAHNIFGNNTGDLMTVIKNKSQVPF
                     LLLTASPITNTPITLSNIISLMSNEEIDFGDIVIQGRKVFQILLNERGVEILRKVLKG
                     RISYYEMPDTDMPEVIYHGKKFLDTRVVYCHMSSLQEKDYINVRKLCNNEMFEKNMNN
                     VSLAVLGPLNFINNLDVLFQVQDKDLYPNLKINNGVLYGDELINLNISSKFKYFISKV
                     PSLSGKHFIYFSNSTYGGVVIKYIMLSNGYVEYTGLEPSSRSGNKKTFAIVTSKMKSS
                     LEQLLELFNSPSNNDGSQIMFLFSSNIMAESYTLKEVRNIWFMTIPDTFSQYNQILGR
                     ALRKFSYNDVSKPVNVFLLAAVYSDFNMNIDTLDDFNLDEINMLPFDIKKLLYLKFKT
                     KETNRIYSILKDISKSYSAPPHESITNIVLGEIVRQFFYHKTRVSYSDSKLRSIIKEV
                     VDDGNSVSNYIDDISTKHFFVTNKVFNKALLYKYKKDIITVPFKISHEPFTWALNFRK
                     EQSIIE"
     gene            83667..84188
                     /locus_tag="BC341_gp088"
                     /old_locus_tag="PTPV-Aus-088"
                     /db_xref="GeneID:28340415"
     CDS             83667..84188
                     /gene="PTPV-Aus-088"
                     /note="rpo18"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268803.1"
                     /translation="MSTFVRQMYLPIMMDPHELTFEVWENIKRIVMDTYLHKETSGIM
                     AINITVYKDKELPLGELINNQIMVQVPCNVVFKYYKMGDIVSGTLSITDENDVQVLCS
                     DLTCVLARGAGTVSFSDSKYCFVKNGVVYPNGSTVTAVLKEARSSKNSNFEFLAALVD
                     PPKEEDDELASSK"
     gene            84217..84837
                     /locus_tag="BC341_gp089"
                     /old_locus_tag="PTPV-Aus-089"
                     /db_xref="GeneID:28340416"
     CDS             84217..84837
                     /gene="PTPV-Aus-089"
                     /codon_start=1
                     /product="mRNA decapping enzyme"
                     /protein_id="YP_009268804.1"
                     /translation="MEECSITFETEREKVILTPTPKPTSISGVRVFAICVTTDNVPIV
                     AQRRTSFVFQHIVSTSSKKNTTKVSKHLLQYMYENEVRELACRSSVRKIEWDNNFCEL
                     IMIGGKANKSESVNSCLRREIREESDSTVSVKSISDKFFHVSIYDKLIQKCFECYCTL
                     CYINQSLEDITSTRIFNIEVRSLCPLYSYKNNDKFEYLNFIYKSLS"
     gene            84848..85579
                     /locus_tag="BC341_gp090"
                     /old_locus_tag="PTPV-Aus-090"
                     /db_xref="GeneID:28340417"
     CDS             84848..85579
                     /gene="PTPV-Aus-090"
                     /codon_start=1
                     /product="mRNA decapping enzyme"
                     /protein_id="YP_009268805.1"
                     /translation="MSSVKPRSVLSTISKTNRRLARTYNFSDDEQRLRVTGFVNNKMY
                     NSKLVSVCAILSTLDGKYLACLRRNSFLYSEIRKSKSRKRNINLLTKYSKFLRPGELK
                     ELKTLHSINKTFVDGNNKGNVIFPGGSPKRGENAVKCISRELKEETNIDSKHVSLDTR
                     FFVYVNIDDLLTGKEYDAIFFLGTVNLTSDEIVDNFFSNDEVVTLLFLSPYGQGIACD
                     IIRYALSIQQLDCWGTRGYKNSYLS"
     gene            complement(85571..87475)
                     /locus_tag="BC341_gp091"
                     /old_locus_tag="PTPV-Aus-091"
                     /db_xref="GeneID:28340418"
     CDS             complement(85571..87475)
                     /gene="PTPV-Aus-091"
                     /note="nph1"
                     /codon_start=1
                     /product="ATPase"
                     /protein_id="YP_009268806.1"
                     /translation="MSAYASYIDYALRRTKDMPSEMASVDSTVKLKDYQMFVARVFLG
                     LDKMHSLLLFHETGVGKTITSVYILKHLKDIYTTWTIIVLVKKALIDEPWRTTILKFA
                     PEIVNDCIFINYDDHNFHNKFFTVIKTISSRTRVCVVIDECHNFISMSLSKENGKIRP
                     TKRVYNFLLKNIPQHNHKLLCLSATPIVNSSREFTMLVNLLRPNVLQPVPLFEQGYLV
                     GKDELINKLGCMCSYLVYNEASIFENVEGSSTFAKKTVKMLYVNMSPKQEAVYQRAKI
                     AEIKSKTAVFKIHRRMAAMFAFDEFPDKKDKTIDEYESIVSALVKDFEKSIQGKRFSE
                     AAINAFKNGNYLDNTASASDVSLYTELRERSCKYTEVCVRILASKGKCLVFEPFVNLS
                     GIKILLKYFSIFNITSIEFSSRTKDVRNQLVNDFNSEDNTNGNIIKVCVFSLSGGEGL
                     SFYSINDIFILDITWNEASLRQIVGRAIRLNSHALNAPDRRYVNVYFVIARLSSGAPT
                     VDEDLLEVIQNKTREFSQLFSVYKQTSIEWIYEHYTAFSPINDESAWQSLISRPMLVT
                     TTENVNKTVNGENIWYARSTAMITIYNGFKTSDGKVYDKDGIFLLNMPADPIIKINNN
                     KLVYIFPNLR"
     gene            complement(87532..88404)
                     /locus_tag="BC341_gp092"
                     /old_locus_tag="PTPV-Aus-092"
                     /db_xref="GeneID:28340419"
     CDS             complement(87532..88404)
                     /gene="PTPV-Aus-092"
                     /note="small subunit"
                     /codon_start=1
                     /product="small subunit mRNA capping enzyme"
                     /protein_id="YP_009268807.1"
                     /translation="MDTIESVKAQIRDGVSARMPFYENLPNIHLTLGVMQLPSLQYGT
                     NYFLQLSKVNDLNRLPTELLSLFTHDVMIPETDIDQICKTLKIKSVKTHSKGIKAEAI
                     VVDMSAKNKLYKRDRGLIKSNNFLTENNLYISDYKLITFELFRPLFDYTSEKYVIIKL
                     PTMFGRTIVDAMRVYCSLFKTVRLFKCANDSWLKDSFVIVCEDPHVKNIHTVLTHFKN
                     VTKSSTWKESNNVPFMILKDPVDGEFIDIFLNFSTKVYKALYVAHSLLFESMTSDSKS
                     LENDSQRKLVKLLM"
     gene            complement(88428..90077)
                     /locus_tag="BC341_gp093"
                     /old_locus_tag="PTPV-Aus-093"
                     /db_xref="GeneID:28340420"
     CDS             complement(88428..90077)
                     /gene="PTPV-Aus-093"
                     /note="rifampicin resistance"
                     /codon_start=1
                     /product="trimeric virion coat protein"
                     /protein_id="YP_009268808.1"
                     /translation="MNNTVISLLSADDGVKRANVFGVDEHQPTLYMPQYITMQGISFK
                     DCTNSQTNTFEIRDQYITAINNLVLSIELPDVKGLGRFGFVPYVGYKLIKHVSISSDH
                     GTIWEKSGEEIFDSCSSNESAMQLSGFTRELNDISTGLTQNDTIKEATTVYVYLKTAF
                     DVENTFSSLKLANSKITVTVTFHSISEVIVYDSTFDVEAFVKSFVYVTELSFIGYMVR
                     NVQLKPTFIEMTRKQISQINQSTAAITDVHATTFVSVYVKPCYSTADNRFISYPGYAQ
                     TEKDYVCAFVERLLEDMVIVSDQVPCGKFPPSADIVEVPDNGIVYLQDVEVLVKIDNV
                     PDDMNVYFHSNLLVFGTRKNSIVYNLSKKFSVIAGYYSVATNRIIFTSVSHSINISDA
                     SIPVSLWSCQRNVYNGDNRSESSKSKDLFVNDPFIKGIDFKNKIDVISRLDVRFGNDV
                     LYSETSPISKVYGELFGRPKSVRTLIFNFTPHTFFKPTTLNSNTSRGKDKLMIRVIYA
                     NLDQNNPIYYVPKQLVVISSDLYKLTNDNGILAIKVTSDHQ"
     gene            complement(90103..90555)
                     /locus_tag="BC341_gp094"
                     /old_locus_tag="PTPV-Aus-094"
                     /db_xref="GeneID:28340421"
     CDS             complement(90103..90555)
                     /gene="PTPV-Aus-094"
                     /note="vltf-2"
                     /codon_start=1
                     /product="viral late transcription factor"
                     /protein_id="YP_009268809.1"
                     /translation="MAKRVSLPNVVINAPKAAIKSTYKESLGCVLPSYYKTLNDSILS
                     LNTKSDCCWFCNQQLDGKYLSIETLMNSFVGYFCSRICRDSFACMVKTHIALREEPKI
                     SLLPLTCYKDPEKVIKIINECKEEEGLYGNCFFNEKTNTIQMSLRSLY"
     gene            complement(90586..91260)
                     /locus_tag="BC341_gp095"
                     /old_locus_tag="PTPV-Aus-095"
                     /db_xref="GeneID:28340422"
     CDS             complement(90586..91260)
                     /gene="PTPV-Aus-095"
                     /note="vltf-3"
                     /codon_start=1
                     /product="viral late transcription factor"
                     /protein_id="YP_009268810.1"
                     /translation="MNLKMCKVCKHNGIVSEEGFDVCIFCDTVFTQNLKTFKKSNFHV
                     SNKLIHLRNVLRRLLSHQCSDEVINELKVVMSSCDIDAEDVDANFVSSFLKANSKINK
                     KDYKLVFEIINNVKNEKLNLTTDKINEVIEIFKYLVFFCQENTPSKTINYSFFLDKIF
                     DITNVTQNLKPQTVKNYAKNNSNQLVWENFLVYMRDKKKSGIVVDFGHEYVFKPDMFV
                     ECSLDL"
     gene            complement(91260..91487)
                     /gene="PTPV-Aus-096"
                     /locus_tag="BC341_gp096"
                     /db_xref="GeneID:28340423"
     CDS             complement(91260..91487)
                     /gene="PTPV-Aus-096"
                     /locus_tag="BC341_gp096"
                     /codon_start=1
                     /product="s-s bond formation pathway protein"
                     /protein_id="YP_009268811.1"
                     /db_xref="GeneID:28340423"
                     /translation="MEWYSSYTVDLDPPKRCSNCSVALTKFLKDDEENIKRLLYAQPN
                     RLKILRSFLEFCRNKTLNYKILDKEVYRVLT"
     gene            complement(91509..93518)
                     /locus_tag="BC341_gp097"
                     /old_locus_tag="PTPV-Aus-097"
                     /db_xref="GeneID:28340424"
     CDS             complement(91509..93518)
                     /gene="PTPV-Aus-097"
                     /codon_start=1
                     /product="p4b precursor"
                     /protein_id="YP_009268812.1"
                     /translation="MDHDTLKSSDINLFLNTKIQLSSNYNNQHLSLVNEEHIHKAVQT
                     DSCSVCNMLSSVTNYNIVSGGAPRQKPYKRQKQSQSQSDRELKRREDACKARNYQEEN
                     LETVPLDELTSTQEWVLKLRKDGDRIAAYIRNNKCNIESFTIQDMLMVMEKLNIARRD
                     RSELFEIMAHVKSSLTNSNLSVKAGHPLMLIYSRSNAKLAQQIKEMEMVYEPSNYPTL
                     IATSRFQSSHFIDMSSSSDLSFCYKSHDSTCFVSPILMALFGVKIAALENTFISGDTF
                     MLIHQLYEYRKVQPENYMLLVSRLTEEHPIIISGIGDIISTEVQRANLHAMIRKIVMN
                     MRMGVFHCKEDETIDNQLMKIIHTGCSTVMSDEEQTLASILSIVGFKPALVSVSRGMS
                     SDLTLQSAPYVVVDPMRMITTSTSPISINTKNVCSLAYDGSSSRVMFVPPNVSYRSTG
                     CSIETFPTLCGNNQGFMDRTPQSPIIVNGTLMFLVERRNAKSVIGECFTGFRSVINDA
                     PIDVAQELHLNGIMYKLKSAVCYRTGDNFLDSCGSSNSEVFLTGHYTILFTELGPWMY
                     DPMSILSKPSREARLMRAIKQLYKQEVNADDDSSIYDWMRNEGANIVARKKEQLMKNI
                     SVFEDDLLTIDEAMVMISRQCCLLVYAQDYAPYISSRTVGEGLWF"
     gene            complement(93564..94352)
                     /locus_tag="BC341_gp098"
                     /old_locus_tag="PTPV-Aus-098"
                     /db_xref="GeneID:28340425"
     CDS             complement(93564..94352)
                     /gene="PTPV-Aus-098"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268813.1"
                     /translation="MDLRSKFAETLKKAQMVTFPQSSVLYTLNQPPPVPPKTCPSMNI
                     DAPHNATEQYYQSLLRSNQQPSCPAPSTSQRGVRVLPPLPPTYDDAKCMPTPNTQPTC
                     PMQPPTCPINPSLPPAPPLPSPRQFPQNPLPLLPQPFSQDNIYDIPVCRTTVEKDVTV
                     SEQAKNTVDNIKTSIKQSSAEAKDNPIVYPSSVESPGAIAAKPLTPVDPPQSVKDLTS
                     AMRTIESSNKVKQVDISGLHAALMNRMRSLNPDLKPDDDNDDFN"
     gene            94391..94921
                     /locus_tag="BC341_gp099"
                     /old_locus_tag="PTPV-Aus-099"
                     /db_xref="GeneID:28340426"
     CDS             94391..94921
                     /gene="PTPV-Aus-099"
                     /note="rpo19"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268814.1"
                     /translation="MATSLDDDVDIESDYESSEYEKEDDEKEDEDDEFSDSDVEKSLD
                     MTSELADKSSLKFKSPETVPSINVQDTVQQSNKISLIKKRYTRRMSLFELTGILAESI
                     NLLQRGRLPLVEGLSGSTLQKNLLQVAIQEIRDKTCPVIIKKNGEYLSVNDFDESALE
                     HHLTFITKIWKQQNRY"
     gene            complement(94922..96046)
                     /locus_tag="BC341_gp100"
                     /old_locus_tag="PTPV-Aus-100"
                     /db_xref="GeneID:28340427"
     CDS             complement(94922..96046)
                     /gene="PTPV-Aus-100"
                     /codon_start=1
                     /product="virion morphogenesis core protein"
                     /protein_id="YP_009268815.1"
                     /translation="MDKLKTLYEKFYCISKTYLESETGQQTDDPEFDVDVSTLMSIVP
                     VLEQKVCEISPSLTDAEVIKLMKYCNYQLFTFWFMRSNAVVKSVYNKLSECEKKDFIC
                     TFKEMLTVTQTLIMLNNMYNNIKHDTEDIVADSKKILEIITQIKSLSGEGRIYHLLNS
                     HYSFIVRTVNKIFSDENYLLKLVAVFDSEMVNNKQKLEEYRQLLTISTESLKHGIKCI
                     SELTFSISVEPNKYTTFFRKVLSNIIIFQNNSDLNATKFITSVSKMYILVYSQLKGND
                     DVRILLSNVLESLKTKVSPEDIKSRGVRNIQSLIGYISDHKSVYKSILEQEYTTREDN
                     IVNLLQQIVNNNNICYNSEVLNVCDLIKTAKESFFDKLSK"
     gene            complement(96098..98224)
                     /locus_tag="BC341_gp101"
                     /old_locus_tag="PTPV-Aus-101"
                     /db_xref="GeneID:28340428"
     CDS             complement(96098..98224)
                     /gene="PTPV-Aus-101"
                     /note="vetf-large subunit"
                     /codon_start=1
                     /product="large subunit viral early transcription factor"
                     /protein_id="YP_009268816.1"
                     /translation="MIYTVSPQLVLLVDASQNIERALYLTPYNEIDETSTIYYFLSKH
                     LDIKTPTLLKRHILLTMKIRQLKGYLQDLLNIDENIIIYSHKNNLEYSYVDNTIFNPF
                     SPTQKKTLIKIDGILYNTYIDACNFLVIWVARANDTPVPEFGSSEEVNSNILKFESKM
                     LEIFNTLDLNMTVESKFNNIFRTNLRTTGLRKIVKKLQEQNLKNKVLLYKSDEHFINL
                     TGNNFILTDEDINLTVWNTDGTVALSSDGSTITVNNISLFSSLVADLDPQMERIKGDI
                     TYKVNLFTPITSKIKLAIETSFIFVETATNNILLSVDKRISIILAKNHISIKVKNHIP
                     NIEKYFAFLVIAINSMFNNVQQSSDFTKIETVYWSRICQNSKNKNRKPVIIQSLDADM
                     TKVSENFYKSETKDVFVNANGVMFSCLDPLGKYNNIGFLSIFHRLQKICIPCCFLKPQ
                     SHTETFSSCVHNKEVDRTVINPYVLNFGKVVTESKISFLPILFDDYFNVDNNADFEPD
                     NKRLQSTSGYYIVHCCAKETITRLRTQEDIIKYVNEDKNILIVGDMVYFPTNYTDIGN
                     KIRIVVQEIVHDVLLVQKDADSDVINFIQPKSNPLKKLFPYIDNKIEIASDSGLTLTT
                     DGFYVDGERFTETISSQYITFTDNVVSSGPIVKYFSNMFKYVVTKSIDRFIKTWIVNI
                     MVQFNITPTTDPATVKQLLEKYYPHK"
     gene            98275..99159
                     /locus_tag="BC341_gp102"
                     /old_locus_tag="PTPV-Aus-102"
                     /db_xref="GeneID:28340429"
     CDS             98275..99159
                     /gene="PTPV-Aus-102"
                     /note="vitf-3, small subunit"
                     /codon_start=1
                     /product="small subunit viral intermediate transcription
                     factor"
                     /protein_id="YP_009268817.1"
                     /translation="MYFSTMFKEVPAYQLEADVKIGDINVNVTKSRARENSSYVSKTR
                     RLFPQRSKNDEHKLSLGFFLQRLSFLGYKETAYLFRCVDAVKNVSITKKNNVIIAPYI
                     ALITMASKGYKLTETMLQLYFPELYSERSKRFKFSTQIMYIQDKLGYPQSEYFVYSFE
                     EYFSTVALIIRDETDTVFDSRKESSLISSLSEITYRFYLKQLKEDAIQWSVSTGTLIT
                     QMINTVLIATYEMLKQAIELNASISCKLAKETPVPFNLLIENKNKFINFINDIKKLES
                     FKVNKKEKDFLMTFFELN"
     gene            complement(99156..99443)
                     /locus_tag="BC341_gp103"
                     /old_locus_tag="PTPV-Aus-103"
                     /db_xref="GeneID:28340430"
     CDS             complement(99156..99443)
                     /gene="PTPV-Aus-103"
                     /codon_start=1
                     /product="viral membrane associated, early morphogenesis
                     protein"
                     /protein_id="YP_009268818.1"
                     /translation="MSCYIAVIKSIGGLALFQVANGAIELIRHVFMYFCEHKLRSNSF
                     SYVVIRIVINMLMYLILGIVLLYAFQDDKTDKSNDTDNKKCVSDKTSAGKN"
     gene            complement(99444..102203)
                     /locus_tag="BC341_gp104"
                     /old_locus_tag="PTPV-Aus-104"
                     /db_xref="GeneID:28340431"
     CDS             complement(99444..102203)
                     /gene="PTPV-Aus-104"
                     /codon_start=1
                     /product="p4a precursor"
                     /protein_id="YP_009268819.1"
                     /translation="MTALNNIITLDQLEGVEYMYKIFSTVLPSLCLDFTIESKYKTTY
                     VHPFDALFSADLEALVDPLEYDLSVQKLGINYLLDKTSSQSLFNAVVKPGTIVKNCQE
                     PSISDRSNPIQDTHSYNELPLFTKDLVKTRVTGCEGHARIIGGYVEALASPSILNPIP
                     MPNLSFSNTYLLNLLYSDVIGTDTGFRARLVNGIMMAKDLINLLNVRALLTTPSREIF
                     DKDYNVESAAASHNIVIAQNPTIDTDLTTMPYKHLVMYFQHFNSRYDLRDLTYNGDEV
                     LLSDYELLNFIASLHFQRQFPTFKQMAPGVPVKSYFEMKVRNASTRIITSANITIPGV
                     EFVDISSLPVYYITLFSMISRSEKTAVHKLMATDTSLFWDGIPYSEYKSMPLTKTMFL
                     NSTCYVFGLYDHNGITYCSRLANVISSGKTPSRVCFLVRSIAGKTVPQLLAETLNSIN
                     SITHKDFPRKSSHVVNHIGLSEVGFMKFFQYLRLMANKTPETALKEVLMMYAGLKLED
                     VGPPHVIKKDCYKEFLALLFSAMGYKVSFKQNMVSSHNHVAVTVSPKVSKSSIQSVLE
                     KNSCSKDEASKIMSSAHDLLQFMVSIGDIRDIFSYNINRLSYQSCPSRKSCPKFFSIF
                     SAGNANTTTEAAPSVDVQNEVTTIDMFEPLSILERINVRGIMAATTTDEIIDTEFFMP
                     ENVAFKNNLANLINDGQLTGDAVVRTMPISMVDRYIQVGGGNGRAVSLSEIIDSVNEN
                     EDEGTPSNEIVRIINAVLKDNYMRDNSAAATQALMSVTALATRQFDVLRQNTCNIAAV
                     FKQLAKSIYNTESLFKTPISDDVKEGILQKFKLYTELSKELYLELIALETIRGIMYLL
                     RRNGKSITDSEISADDLRKAYELVKPKVAKLANYYSDISKMYYMQMKKNLNMANPESA
                     CFDTE"
     gene            102218..103249
                     /locus_tag="BC341_gp105"
                     /old_locus_tag="PTPV-Aus-105"
                     /db_xref="GeneID:28340432"
     CDS             102218..103249
                     /gene="PTPV-Aus-105"
                     /codon_start=1
                     /product="viral membrane formation"
                     /protein_id="YP_009268820.1"
                     /translation="MTAVPVTDMPSEYIVTAFSEDNYPSNKHYEITSGQMSIMRTMHN
                     ALLANKNEYDEQSSDDEETSPTPCSDMEEEVDEVEDKVSESAITIPTAAAAIARTRVT
                     PTHQDISFKKSINIMGPNGTNNEVIFTAEQKRVNITMSDLDTVLENNGHMDKFSKITS
                     MPMHTTPSLGAVFDDSKRVKLLEQEVQQLRKQKAAAPSNLDNFTKILFGKVPIKTADV
                     NKRMVIVNYANLNNVSLSIEDLNDCSDEEIERMFKTIKQYNEMRKKKIIITNMIIIGI
                     TILEQVLYKIGFEEVKGLSADVTSEIIDVEIGDDCEAVANKIGFSNSPVFNIVLFIVK
                     LFVKKMKII"
     gene            complement(103246..103794)
                     /locus_tag="BC341_gp106"
                     /old_locus_tag="PTPV-Aus-106"
                     /db_xref="GeneID:28340433"
     CDS             complement(103246..103794)
                     /gene="PTPV-Aus-106"
                     /codon_start=1
                     /product="virion core and cleavage processing protein"
                     /protein_id="YP_009268821.1"
                     /translation="MADKITPRSSYDDYMTTLKKLAPQLKTLLSHISSEQTGMQPPLL
                     AAPDTSAVDTTIESVCAAGSPFEATARKKTSRTKSTPSKRSVKMGAPRSRRPMEDDNM
                     MQAVTNCGKIVFGTVRDGKLEVKGTVGEVNADLLGVDLVNAGRKPRTTKSSGDTKPTR
                     RRRQTTVMYNKDSIECPDSGMC"
     gene            complement(103809..104039)
                     /locus_tag="BC341_gp107"
                     /old_locus_tag="PTPV-Aus-107"
                     /db_xref="GeneID:28340434"
     CDS             complement(103809..104039)
                     /gene="PTPV-Aus-107"
                     /codon_start=1
                     /product="imv membrane protein, virion maturation"
                     /protein_id="YP_009268822.1"
                     /translation="MALADLIITFVCIIIIIYLVYNIYTKTTIEKKNPIVPEINKGSF
                     NDKLTNDQIKAIAKLVSKNSQSSDDNSADLES"
     gene            complement(104040..104321)
                     /locus_tag="BC341_gp108"
                     /old_locus_tag="PTPV-Aus-108"
                     /db_xref="GeneID:28340435"
     CDS             complement(104040..104321)
                     /gene="PTPV-Aus-108"
                     /codon_start=1
                     /product="essential imv membrane protein"
                     /protein_id="YP_009268823.1"
                     /translation="MDLIQTIRTYYSGALFGGIALLVLTAIFAFLDFSKTTPSNYTWR
                     ALSITCFVVACIILVGLFLFVGYGRYCTGPVLINAGNMRNVSDIELNCN"
     gene            complement(104340..104501)
                     /locus_tag="BC341_gp109"
                     /old_locus_tag="PTPV-Aus-109"
                     /db_xref="GeneID:28340436"
     CDS             complement(104340..104501)
                     /gene="PTPV-Aus-109"
                     /codon_start=1
                     /product="non-essential imv membrane protein"
                     /protein_id="YP_009268824.1"
                     /translation="MISNYEPVIISSIFLLTLLCNILLNSQTKLDIVFTIQTVVFIWF
                     MFHFIHSVI"
     gene            complement(104491..104778)
                     /locus_tag="BC341_gp110"
                     /old_locus_tag="PTPV-Aus-110"
                     /db_xref="GeneID:28340437"
     CDS             complement(104491..104778)
                     /gene="PTPV-Aus-110"
                     /codon_start=1
                     /product="core protein"
                     /protein_id="YP_009268825.1"
                     /translation="MLLDKNFVILRRKNSLYPLNIFTTDGRMITEYDKNNYFYDDNFL
                     IEENGPVVLINPTASQLLKTCVYLKSKVWIGKVYLLFDKQLLHPFYNVNDI"
     gene            complement(104765..105874)
                     /gene="PTPV-Aus-111"
                     /locus_tag="BC341_gp111"
                     /db_xref="GeneID:28340438"
     CDS             complement(104765..105874)
                     /gene="PTPV-Aus-111"
                     /locus_tag="BC341_gp111"
                     /codon_start=1
                     /product="myristylated protein, essential for
                     entry/fusion"
                     /protein_id="YP_009268826.1"
                     /db_xref="GeneID:28340438"
                     /translation="MGAGSSITSVFVQKTDVRGELEMVIDEDSAGVRYIIPFSEESEV
                     ISDNSKDVINPRFCLQDNMDPNYCGTYLSPSISKEYIQVKGDPCKSFSFRPGSVIKYN
                     EPVSDSVKAYVKTGYLCKFVKSPLSADDKYKSCCTNPTPLCPNRLNNNFETDDCDLVM
                     SSACKDDPNNILCLDWLRKKRKIALSTYSDICAKNMDSRYCSEFIRIVRPENYAFGDS
                     SLINYCNDHSSNKNCWCVNPPKVFADDKKNRFLGPRVCWKHECTDNTRDRKWLLYNQD
                     VQRTRCRYVGCSINIDSLTMEKSNVSLISNCHAGIPILGDVDPGNYTDKNKSKEANYA
                     LISIPVVFVVIMVIVYFICVYSRSRLKTNIINVTR"
     gene            complement(105889..106455)
                     /locus_tag="BC341_gp112"
                     /old_locus_tag="PTPV-Aus-112"
                     /db_xref="GeneID:28340439"
     CDS             complement(105889..106455)
                     /gene="PTPV-Aus-112"
                     /codon_start=1
                     /product="imv membrane protein"
                     /protein_id="YP_009268827.1"
                     /translation="MSYFSYYNPFSEFEGGAGVLDDELFTEDEQQSFLPRDDISSIID
                     GKPISPLAPYNILQFEDIRVLLGLILFVLAITSAPLVGLCLIGLAAIVLPLPCLVLAY
                     CLSMQAIYSSYNKTLGMAIICSLMAILAITLTHITCSYHVTVISYIILGVLFCMYVFR
                     LSYFSTPQACPLMRAGRKTSFSASFSDT"
     gene            106470..107891
                     /locus_tag="BC341_gp113"
                     /old_locus_tag="PTPV-Aus-113"
                     /db_xref="GeneID:28340440"
     CDS             106470..107891
                     /gene="PTPV-Aus-113"
                     /codon_start=1
                     /product="DNA helicase transcript release factor"
                     /protein_id="YP_009268828.1"
                     /translation="MFGYINITNKLYTYIKKISGSQPLFLFNSDNNHVEVFPNSSFKF
                     LVPAGLFSSYRVMLRDELKYPIANNPMTNEKDLSLPNLYPLQQLVVDKVVAAMKRKEE
                     EHRPKYITLHLKCGFGKTVTACYLMAKERKRTVICVPNKMLIPQWKTAVELTKANYMI
                     SVHGVSKLLLEKSTPDVLIVVSRHFANEEFCNLVYSNYDVVIVDESHTYNLMNNSAMT
                     RYLAFYPPPICYFLTATPRQSNRIYCNDIINVEKESSLNKTIKIIDCYFKPFSNEKIR
                     NLSTKLNSTYNKYHVFTEKILTEDVHRNKLIIKTLVEEYTSRKINRIMIITKLRAHML
                     MFYNELVKKFRNDVVLGDAQNRKTPEIVNGLRSKDRFIFISTLYYAGTGLDLPSLDSL
                     FVGVAVMNNMHMEQLLGRVCRETTLTDRTVYVFPTTSIREIKSVVDNYVQRLISLALD
                     LGFVQLNTDKPCKEETALKLAFS"
     gene            complement(107892..108149)
                     /locus_tag="BC341_gp114"
                     /old_locus_tag="PTPV-Aus-114"
                     /db_xref="GeneID:28340441"
     CDS             complement(107892..108149)
                     /gene="PTPV-Aus-114"
                     /codon_start=1
                     /product="Zn finger-like protein"
                     /protein_id="YP_009268829.1"
                     /translation="MSSEQVGIIDESAGYKKKRKRRPPRTTVVEDEDSCTTCSSCHSL
                     LVKVADITKVSLNGLKLAGSGSVLECAACGSALRPLNEFYS"
     gene            complement(108150..108500)
                     /locus_tag="BC341_gp115"
                     /old_locus_tag="PTPV-Aus-115"
                     /db_xref="GeneID:28340442"
     CDS             complement(108150..108500)
                     /gene="PTPV-Aus-115"
                     /codon_start=1
                     /product="imv membrane protein, entry/fusion complex
                     component"
                     /protein_id="YP_009268830.1"
                     /translation="MFVVFLILCYFIIIFNVIVPKISSKLEVERKAYLEFANIKGDGM
                     LCINNYLFTYSFAPIGGVTALIAINKKDNKPFMCSDRSNVTVSDFVSCGSDDIKNIYG
                     KECLEAYSKLFFTS"
     gene            108499..109806
                     /locus_tag="BC341_gp116"
                     /old_locus_tag="PTPV-Aus-116"
                     /db_xref="GeneID:28340443"
     CDS             108499..109806
                     /gene="PTPV-Aus-116"
                     /codon_start=1
                     /product="DNA polymerase processivity factor"
                     /protein_id="YP_009268831.1"
                     /translation="MTALSDLTSLKELLRLRNCLHLADAETIDRYNTIVDWAMQTYWF
                     VDVTKLSTPCTSLDSYYTKAVSPIYLNEGTYTFSRVHFGNTFIFSKSSMLELETGIAP
                     NIDDDFKEKCLNVLKLDPCCVLKFSMLCESWILEDAISTIHEPELIFNAAKENNLLVT
                     PILRVKVLKKTLFEELDFKAVYLALSNIAKKDNDLSIHKAESICCSNDNDKSWRKIID
                     FNKTQYIKVTAFSKIKIGDNLYMPILKTNSGNRIMPKDVNHLVASRVKVGSFVSIKKT
                     PEGLMLSNTVYDQSETRGNALRRILQTFGSNIFVNGKYLSRASTVDTKLLCEKLKLPI
                     CHTKEDLINSIKNNKKVSKQLFDKSPMEMTRLCLSYPEKELIELVNNINFETSDGIIT
                     RYSLEDTTCLENPTIETLYCNFAQFVTVFNIFATVYNLNSDAD"
     gene            109796..110272
                     /gene="PTPV-Aus-117"
                     /locus_tag="BC341_gp117"
                     /db_xref="GeneID:28340444"
     CDS             109796..110272
                     /gene="PTPV-Aus-117"
                     /locus_tag="BC341_gp117"
                     /codon_start=1
                     /product="holliday junction resolvase"
                     /protein_id="YP_009268832.1"
                     /db_xref="GeneID:28340444"
                     /translation="MQTKDIKKIVISAYDIGVKNPARTVLEIFNDSIRVVDITKLDWS
                     NNWESKISADVRKFESNIVLLERQSKKSPYSKFVYFIKGLLYNTNTKVYCVPPVMKGS
                     TYKSRKRRSIKIFLKWLTFFDLGDYVPVRRKMDDVADSFNIAMRYVIEKYIKMKFN"
     gene            110292..111440
                     /locus_tag="BC341_gp118"
                     /old_locus_tag="PTPV-Aus-118"
                     /db_xref="GeneID:28340445"
     CDS             110292..111440
                     /gene="PTPV-Aus-118"
                     /note="vitf-3, large subunit"
                     /codon_start=1
                     /product="large subunit viral intermediate transcription
                     factor"
                     /protein_id="YP_009268833.1"
                     /translation="MDDLLCFLHSIENIFARTIFNFHLTNTQLLNDIYGYMQRRITST
                     NSFSSVVADMPEKNLIKKIVYCDIQLTKHLLNHEAYPNYEQQPVSKRTGKYFDVSSEQ
                     DDHSLITASIFERDRSSLVSYIKTTNKKQKINYGEIKKTITNSSGNSLGYFSGRKGDD
                     YLSTEIKANAEKPWIKSILKHMKIEINYDSIITKGKSSILQTIEIIFTHRTCVKIFKD
                     STIHIILSKDKNECGCVGMIDKLFSTYKILFMLFNAASDNPMFMNWVKVANDIVTATN
                     FNDKIKIITENKDMYGIGNFRIGMFNLTYKPKITHTVFPSMLSSNNKIKFFKGKKLNL
                     VALRSLEDCMENVSHAQLVLSEMKSKAERLSSINVDTELVEILKDLLI"
     gene            111442..114954
                     /locus_tag="BC341_gp119"
                     /old_locus_tag="PTPV-Aus-119"
                     /db_xref="GeneID:28340446"
     CDS             111442..114954
                     /gene="PTPV-Aus-119"
                     /note="rpo132"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268834.1"
                     /translation="MKNDTSVKMDQRLGYKFLLPDPKADVFYRPLHFQYESYANFILY
                     RLKEILTVKRKLLSFKNGTENIILEINNVCVKPPPYSPIIASIKGKSYDALVTFTVNI
                     LKEVMTKDTVTTVKISSYEGTDSHLIKIPLLIGYGNKNVLDPAKFVVPNVIGGVFINK
                     QSIEKVGINLIEKITTWPKFRSIKANTFSFSFSSVSAPNILPTKYRHYKIILDVSQLE
                     NCNISSAKTMITVNVILLVQYLANVSLEFIINNLTFDMPTEAGYLAHSLVESTKYITS
                     KEDFNLTNYIYDLIEAERLKQKSQLKPEEFRYDMISNFLPHMVNSSNQLKGLYLLSLL
                     RRFIYCIFFPSRYVDRDSMACHRVLTYGKYFETLANDELENYISNIKNDIMNNHKNRG
                     TCSVNIHVLTTPGFNQAFASLLSGKFKKTDGSYRTHQHYSWMQNVSIPRSVGYYPDQV
                     KISKMFSVRKYHPSQNAFFCPSDVPERGTHVGLVSQLSVLSSISNIKTTDYVSLEKKI
                     CEYIRSYPTEEISYFETGIPITLENSLIASINIDLAEQFVIDFRRRKRIGYFNNLEIG
                     ITLVQDHMNEIRINIGGGRIIRPFLVVDDGKLIMDTVADELDSKINSMTFSDIQKEFP
                     HVLEIIDIEQFIFSNVCESVEYFRKLSPEEKQKYHFCEFPAEFRDGYVAASLVGINHN
                     SGPRAILGCAQTKQAISILSSDLRNKIDNGIHLIFPERPIVISKALETSKIAANCFGQ
                     HVVLALMSYKGINQEDGIIIKKQFIERGGLDIVTAKKHQVEIPLENFNNRERVRSTAY
                     SKLDSNGLVKLNAFLEMGDAIARNISSRTLEDEFVTDNQISFDIADKYTDIYNSRVER
                     VQVDLTDKVKVRVLTIKERRPVLGDKFTSRTSQKGTVAYIADESELPYTEDGIRPDII
                     VNSTAIFSRKTVSMLIEIILTAAYASKPYNNDGKNRPICFPSSNETDIDTYLEFAKNC
                     HTRAAEDLGLKFDIDEKVFCESTLYDPETDTPYKSKVFMGPIYYLRLRHLTKDKATVR
                     CRGKKTKLIRQANEGRKRGGGIKFGEMERDCIIAHGAANTINEILKDSEEDSQDVYVC
                     DNCGDIAAHIGTSYSCIRCSKLNLSTVLVKVDTTHVSKVFLTQMNARGIKIKMEFEKK
                     EPVFYKPLDSVSLSPKTSLWGDSK"
     gene            complement(114947..118099)
                     /locus_tag="BC341_gp120"
                     /old_locus_tag="PTPV-Aus-120"
                     /db_xref="GeneID:28340447"
     CDS             complement(114947..118099)
                     /gene="PTPV-Aus-120"
                     /codon_start=1
                     /product="a-type inclusion protein"
                     /protein_id="YP_009268835.1"
                     /translation="MVDNNQNEFKFSSISNLVKKIRDLNKVNLTADSFLDRETRKLVK
                     FLFRNVEDPVYVRELYNELNSNTETSDMLDLLIETDVKGEYSENINTVGLYTLFCILN
                     MVDLLNSPNKFKYLTDYYNKLFSVHEKYKCVNLFVGVPGSAATKLTAQDVCSLTTFSN
                     RQFVDMYKDFYMLLSKVILTKPNDRSVVTISYDSVHVSSSVSLPEMFMDAMGFTTYDS
                     IFVGSDVEAFLFTHVVDSEKNIYEYTQLESRNYPTGVRHVTSTDTMNDNEAFALLVLN
                     GSSAYDEFRNKAVLLMSDDVSNRVTLRNAVPDYSYVKDINVPILVEDPKDDGEDLDLG
                     SEIDIDKIVKDPIWTKNTGYSIYGCPALTEVRYVATELAKLASNKGCPNNKVVDYFAK
                     QIAKSERDIAILQAKLRHEKIDDSIPGDCSSVTKKLEEANDKIKNLEIELAKHKDNDT
                     TDCSNKLKKANEELEKAKKEVTEYKDKLEKTKEELDKIKNGDTTENNKKIDELEKDVK
                     EKENKVSELKDELKKEKEKSSTCDKRVSELTEENKKLKRQIEENDNGNGGGSNSSTKR
                     ELEEAKDKIEKLEKQLQECRRNGGSRNVDLENCSEELSRTKRKVKELQEEVDRLVKAD
                     TTEGGYYKQELGRQREKVKMLENELDKLYEELYEARKCCGKLDEASRKIKDLETETTT
                     QRKRIRELESEHSKHESTIKELNKTIKEKEEKISELEKHRNEESSKDCKEIQKDLERT
                     KEMLHKTEKDKKDLMDRVRRLEKELEDKDKDKDEDGDGGDNNSSGSCSRVKRELEEMK
                     KLLNKLEEEKFECKERIKQLERELEDARRGRDDNGHNNNNGKYPNTSKIIKELKEDLE
                     RARAKIKELEEDLDREHSRKIGGSDCELELVRVRNRIKILEKEVEAHKEFARIYKHEL
                     EYERNRFICCITAPTCNIKTNPHVITDIENERKPLPPTEDMMKPEEKPNQPPTEDKKP
                     EKPERPSLPELPKPEKPSFPNLPNFEPPKPDVSKPELPKPEPDSDALESEKPKLPFPK
                     VPNSVFSIKKGPVKEIKKFT"
     gene            complement(118133..120067)
                     /locus_tag="BC341_gp121"
                     /old_locus_tag="PTPV-Aus-121"
                     /db_xref="GeneID:28340448"
     CDS             complement(118133..120067)
                     /gene="PTPV-Aus-121"
                     /codon_start=1
                     /product="p4c precursor"
                     /protein_id="YP_009268836.1"
                     /translation="MDKLEYYIDPLSLWSYDDPKMTSILAFYKIVEGTWGTTITSTTP
                     IPRTAKKAFRNVLRDYIKHAPVCDNSNYDDYRDIDNFPNTLDPHAPFCLVLPTNIVRN
                     VYYVNFMYFKNGFFERHYNNLNTFRDIETLGQLLLFFVVAIMRVEIEQTNENNIVTKF
                     VPLYEFNEVLSTKKDYSSKMTYACSSMLWQLCSIGYYKENPNIVLGLPMYYWYGVNVK
                     TVYDEITKPFTGNGNKLPNTWSKGPLYFTKYILDNHILNHYQTNCITINYNGYKATFV
                     SSVPEFVLDGLCYTVNDKITKYGNDHVQIYMMPNGCKDGHTYTYLCSNDQGTIVSLPC
                     TGKLFDEYHDQGAIRYQDNDINAKCNGYCFKSLLIMPEDTKVYQFEDSHVKYNNFQND
                     YYAGPPVFLTKNGVNRTASRGCNWCGNINTRYNSNAIVSPYHICGPQVPPCHTVPPTC
                     PVPPHCPPVNPNCPVVPVPPVPPYYPPHLPYPPYPPHNDRSDCHDGQCTGLIPPPPHC
                     RCILDSENNCIYYCDYHNNIYPYTINPVDYRLNILKEKIAGYIPLIKHLKDTCKKEND
                     AAKKLEHHIETMRQYMVMASNKVDYHTCRKPTVSVPKHSIDKTYPSIKDSDAWKINRL
                     CYIQPHSMCFRTPPAWMIAH"
     gene            complement(120126..120422)
                     /locus_tag="BC341_gp122"
                     /old_locus_tag="PTPV-Aus-122"
                     /db_xref="GeneID:28340449"
     CDS             complement(120126..120422)
                     /gene="PTPV-Aus-122"
                     /codon_start=1
                     /product="imv surface protein, fusion protein"
                     /protein_id="YP_009268837.1"
                     /translation="MADEDIGIPEMYPTVKDDTFYGGSKSSDGLEFIGGAPDRLSLLE
                     KTVTDLLDTYKDLIKCTGAAEERMRRLEGHAASLRASILHLTHKIDVQTGFKSK"
     gene            complement(120433..120861)
                     /locus_tag="BC341_gp123"
                     /old_locus_tag="PTPV-Aus-123"
                     /db_xref="GeneID:28340450"
     CDS             complement(120433..120861)
                     /gene="PTPV-Aus-123"
                     /codon_start=1
                     /product="imv mp/virus entry"
                     /protein_id="YP_009268838.1"
                     /translation="MDAITIMCIVIVTVAACVMMLQAYSIYENYENIKEFNSENASLE
                     YAKSTGGMRVDYRVKDPNDTTHDVKQKWRCVIKQNVYVSASIFGFLSDNSKTIKQFYT
                     LDECILYTFMPKIDNNIYNPCVPPNERSEDCIFLKSILSK"
     gene            complement(120862..121773)
                     /locus_tag="BC341_gp124"
                     /old_locus_tag="PTPV-Aus-124"
                     /db_xref="GeneID:28340451"
     CDS             complement(120862..121773)
                     /gene="PTPV-Aus-124"
                     /note="rpo35"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="YP_009268839.1"
                     /translation="MHRKEIVLAIDLNKSLATFIKHEFGNKIRWPSLSIGVVLSNTTT
                     SINEEWLTSVEAMPTKKVFYEYTKDIITNKVNFCVHIKYVQQSKINIVTMYDFDYYII
                     KDNKITKINKPSELKNTLLHSFQDFRQNNLQTIELIAFSSSTVISENLVNGLTFVDVE
                     QFNKEYDNIKPSLPLERVWHLPFIVIAPNGKLKFYVETYSWIDTAKFFKEIIDILEDE
                     LIQSVRLHKLKTHSTDDQEVVKGVSMYNVTSGMLYVSDLVTMCVVNFFGGDVRLHSYH
                     KIDIGALNIDAFIDEITKAFERIRALV"
     gene            complement(121742..121948)
                     /gene="PTPV-Aus-125"
                     /locus_tag="BC341_gp125"
                     /db_xref="GeneID:28340452"
     CDS             complement(121742..121948)
                     /gene="PTPV-Aus-125"
                     /locus_tag="BC341_gp125"
                     /codon_start=1
                     /product="imv protein, entry/fusion complex component"
                     /protein_id="YP_009268840.1"
                     /db_xref="GeneID:28340452"
                     /translation="MDEDINEAALGQLLKRISQCSDTELGFTAVIIHELINTINLKLL
                     DINKKAKKTKSNKNNAQERNSFSN"
     gene            122100..122693
                     /locus_tag="BC341_gp126"
                     /old_locus_tag="PTPV-Aus-126"
                     /db_xref="GeneID:28340453"
     CDS             122100..122693
                     /gene="PTPV-Aus-126"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268841.1"
                     /translation="MAVFDFNEPLDGLVQRSDNEDVNVQAKELTSDFNMIPESTHLIK
                     YDVFNILLFLEQRQYDMHKKLLKTITDSSITLKNYTINVCKYSKSHIIKNMSSCGIRH
                     SDYVVIGNVTINDYKMILFYMDLLYWGVTEHGTVYKLGKDFRSLSLKKRVCFPNYDSP
                     DISYETEDSEEDVEYSFYTDESEDEYQSDDSTFQCFP"
     gene            complement(122671..123429)
                     /locus_tag="BC341_gp127"
                     /old_locus_tag="PTPV-Aus-127"
                     /db_xref="GeneID:28340454"
     CDS             complement(122671..123429)
                     /gene="PTPV-Aus-127"
                     /codon_start=1
                     /product="ATPase/DNA packaging protein"
                     /protein_id="YP_009268842.1"
                     /translation="MERVLEKTFNRASLLSAPFRMALVGGSGSGKTAYLLSLFSTLVK
                     GYKHVLLFLPVYNPAYNQYVWPDHIQKVTSAEELEYALSSTKMKIEKYATKGSHKNKF
                     LIILDDMGDMQTKSKTLLGLLNYGRHINTSIILLCQTYKHVPINGRASITHLCCCNVS
                     ESDVENMLRSMSIKGSKKELLRAMSIMRSAVTDRRVHIIEDSVFCNGEQRICYDRADA
                     DVLNKTLNPSILLSQFSHMKSKLSEIISKESTET"
     gene            123536..124072
                     /locus_tag="BC341_gp128"
                     /old_locus_tag="PTPV-Aus-128"
                     /db_xref="GeneID:28340455"
     CDS             123536..124072
                     /gene="PTPV-Aus-128"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268843.1"
                     /translation="MTVTVADELPFYSPNQHKPRPMSLFKSKKLASILSICLRAGLIL
                     CLIVLMALVVYLSYELNECRNRETKCNITAKLLQMNLTTEKSIMCMPVTPSISSASST
                     TEPSTLSASASLPPTTTTTPTTTTTTTPTTTTTTTPTTTTTPTTTPTTTPTTTKNKED
                     KEKQQQQLENLKEKIKSN"
     gene            124201..124728
                     /locus_tag="BC341_gp129"
                     /old_locus_tag="PTPV-Aus-129"
                     /db_xref="GeneID:28340456"
     CDS             124201..124728
                     /gene="PTPV-Aus-129"
                     /codon_start=1
                     /product="c-type lectin-like iev/eev glycoprotein"
                     /protein_id="YP_009268844.1"
                     /translation="MALFRKLNRQSKNKIKKCYNPTAVFITILSLLSSIGAILKYTNI
                     LITEACENNWIAVDGFCYYSANTSSNRTHASNLCKNYNADLLSFQSSHHVLVVYGLTN
                     SSTWIDVGNSLELLKKIDNDTMTPVVQNLTMFTTKLTDQCVAFNGTNVILSNCSTNAN
                     VMCSKKFFSHKWFIL"
     gene            124776..125309
                     /locus_tag="BC341_gp130"
                     /old_locus_tag="PTPV-Aus-130"
                     /db_xref="GeneID:28340457"
     CDS             124776..125309
                     /gene="PTPV-Aus-130"
                     /codon_start=1
                     /product="MHC class ii antigen presentation inhibitor"
                     /protein_id="YP_009268845.1"
                     /translation="MPGFNNVLTPLGLICCDRYDSFQQMLHDLGISSITSSIGDYWIA
                     PIHATPTHISAIPSLDISRCYVSIHGKLLHAYDVLRRGYSIDKLYLIYETTTRAHILC
                     CNNYDQIYINDRSFGLKLESFKDYVDSREIDVLELYDNGNYDIILSPSLSLLSSLKSK
                     CNICLASGSWIIASTNS"
     gene            125380..125970
                     /locus_tag="BC341_gp131"
                     /old_locus_tag="PTPV-Aus-131"
                     /db_xref="GeneID:28340458"
     CDS             125380..125970
                     /gene="PTPV-Aus-131"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268846.1"
                     /translation="MEVTVLAYTSVGVSACLLIVYIVLEIKNCCNKNKKKIRANLEVP
                     LDTYSIQISKTKNSYGYGSSSESSTEWETDSEEELSASRIYVNPNRGSGRRVTAGNKK
                     VTIPQQFSPVVDNNNFNSNNNYSASVSDDHVVNIQEEDNYLVPDNEGLNENTSEVQNN
                     QKAVDEAFSFVQCMYEEDNEGYFYENYCCTDATACK"
     gene            126039..126380
                     /locus_tag="BC341_gp132"
                     /old_locus_tag="PTPV-Aus-132"
                     /db_xref="GeneID:28340459"
     CDS             126039..126380
                     /gene="PTPV-Aus-132"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268847.1"
                     /translation="MALFGALKKLLCIKVSDDRDQLNINGEDHNCEYRLVNNNNKSEK
                     ENKNMKVTFVNYSMASSTSSCSSVTTSTFSLSSFDEDVDETTPFNNASLKFSSNGSSG
                     SMSNMLNNDSD"
     gene            126452..126709
                     /locus_tag="BC341_gp133"
                     /old_locus_tag="PTPV-Aus-133"
                     /db_xref="GeneID:28340460"
     CDS             126452..126709
                     /gene="PTPV-Aus-133"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268848.1"
                     /translation="MSFISCLRSCSDDYEENQVVVTNSIIYTDKMPKNFVEPIDCKKY
                     NYVLCTTVDGKSNSSRNRRRRVINNANVTNSIILAKLRLVK"
     gene            126820..127542
                     /locus_tag="BC341_gp134"
                     /old_locus_tag="PTPV-Aus-134"
                     /db_xref="GeneID:28340461"
     CDS             126820..127542
                     /gene="PTPV-Aus-134"
                     /codon_start=1
                     /product="chemokine binding protein"
                     /protein_id="YP_009268849.1"
                     /translation="MGIKQVILLLSLFSIGYSQFLSSDFIKSPLCTKAVRRRNFAVHV
                     FVVKNKTEEYSPGCNVTLNKHRASVHGGGLKIKVTSNDCFKDFKNVSENIVNNTVSAL
                     FTTNRYPSLVYLHNSVSKFTSPSKLCNVRVTIICDSFVRPTIPPTNETEDDFNFTNTA
                     PTNVKLSDMNWRTSTESNIKTRLKVNTYGNCIESFYVSFSVFEFCKADEKTNGHMDVF
                     GTRPTVTEYNMPQPNDKCSVVE"
     gene            127602..127850
                     /locus_tag="BC341_gp135"
                     /old_locus_tag="PTPV-Aus-135"
                     /db_xref="GeneID:28340462"
     CDS             127602..127850
                     /gene="PTPV-Aus-135"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268850.1"
                     /translation="MTTESLEGCSPMEWIDYGEIFPELKNESTTITEHNQEVNLDLDT
                     INIVDQSKSRVVVLNKNINEQKSLRITIDIEEINRVNN"
     gene            127855..128337
                     /locus_tag="BC341_gp136"
                     /old_locus_tag="PTPV-Aus-136"
                     /db_xref="GeneID:28340463"
     CDS             127855..128337
                     /gene="PTPV-Aus-136"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268851.1"
                     /translation="MYFPEKENDIIEFPLIPPQIPPQVAPRTSVRNSVRDRACARPFN
                     QCTSINPCNSTGITVTYCDGSPRTIEEVYVVTNDVTLRVLLNNENIEVLKCVCKLACV
                     SMGLQPKFKTYEHNKNLLEMTVTGNGISWPTKLLAKISKDIVSVDETKQLREPVIKIN
                     "
     gene            128401..129111
                     /locus_tag="BC341_gp137"
                     /old_locus_tag="PTPV-Aus-137"
                     /db_xref="GeneID:28340464"
     CDS             128401..129111
                     /gene="PTPV-Aus-137"
                     /codon_start=1
                     /product="Zn finger-like protein"
                     /protein_id="YP_009268852.1"
                     /translation="MESVIRNDYFYKETKYVFLNYLNTNLIILEVTGYVNISRLCSEY
                     NKCFSVWKKINGKKTISKTAASLCLPKSALMFKVYKTSKTELIHGVYMHKDLVGPFAE
                     WISPTASKIVNHMLIEYYNSYALFWSLNTDEDYIYTAIKFKNKDSIKYEKYSEMLGDV
                     FTEYEEKFNSCREITCGICLESPYDHEKLSNQYFGVLSCCNHPFCRECITEWYKKGNK
                     TCPMCRREFFKIFIKRFL"
     gene            129158..129694
                     /locus_tag="BC341_gp138"
                     /old_locus_tag="PTPV-Aus-138"
                     /db_xref="GeneID:28340465"
     CDS             129158..129694
                     /gene="PTPV-Aus-138"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268853.1"
                     /translation="MHSKLSVAVVSVFLIYTYTYATTFLVGPNEQIKNQTIGKRVYHN
                     ICVPPNNTFPINVTCYSKVESTSNFDSIFWLNCDDTNLTTRGCTFPNKECCTSNYKRI
                     NHTMYLNSTWDHEIRNTLIVRNDTNLKSILKCVYQGVNVFVSMFNITKFINEGDRQGH
                     KVCNRYNKTQYNYIYNFF"
     gene            129773..130303
                     /locus_tag="BC341_gp139"
                     /old_locus_tag="PTPV-Aus-139"
                     /db_xref="GeneID:28340466"
     CDS             129773..130303
                     /gene="PTPV-Aus-139"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268854.1"
                     /translation="MYSKALIAAVSVLVYAYAYSNTHATLQKNTYKNKDYVIRMCVPP
                     NASLPIKITCSAKVKSPNVFDNLYWLECNHTEYHLGDCSFLRPACCDEHYRRINRTRL
                     VLKQPWDHELRSTLIINNDTNIIDPIFKCVYRTEGLPNIMINITKFINESDHQGYKVC
                     KRYNNTDYNIIRTDEE"
     gene            130360..130962
                     /locus_tag="BC341_gp140"
                     /old_locus_tag="PTPV-Aus-140"
                     /db_xref="GeneID:28340467"
     CDS             130360..130962
                     /gene="PTPV-Aus-140"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268855.1"
                     /translation="MVAMNTKLVIATLSVILVYEYVSTQTPPVKNKDVKLDICVPPNA
                     SLPIKITCSAKVKSKSSFDNLYWLECDNNISKYDYGSDDGLDYDYGSGSGGDLEEDDE
                     PDNCIFPKSSCCNENYKRIKPTKSRRWNHELKNTLVIRNITEIKPIFKCVYTSSNPSL
                     IKSINVTKFINEGDPQGYRVCKRYDDDHADFVSKLKQLFE"
     gene            131034..131531
                     /locus_tag="BC341_gp141"
                     /old_locus_tag="PTPV-Aus-141"
                     /db_xref="GeneID:28340468"
     CDS             131034..131531
                     /gene="PTPV-Aus-141"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268856.1"
                     /translation="MDTKLFAVSVLVLWSFAFSEDYTIDSVKQSTCFSIGASDVTLRC
                     LAKVKEHTSFDQMYWTACPTGNPKQCFFPEDECCSKVTKRIKNKKRTTTSYHHVLFSE
                     LTISNLAKSSEVYRCVYESNGGTWSRLINVTAVLSGMSPIMECESTREKVDEFWTHST
                     PYHVL"
     gene            131631..132164
                     /locus_tag="BC341_gp142"
                     /old_locus_tag="PTPV-Aus-142"
                     /db_xref="GeneID:28340469"
     CDS             131631..132164
                     /gene="PTPV-Aus-142"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268857.1"
                     /translation="MAGHLSLTLISCVLFHCVTYVSLVKTEDRMHSSVCVVSYPSDIS
                     NSLTVRVQAKLLAVNSFDFIYWKECGSLTNPKECTFPNDNKCAGKIFRENNRGYYTTA
                     FTYHHSLTSDLTIFDVDNAAPVYVARYIGFDGIVEHVIDVLQILNERGSVVDCVEETS
                     ETFWLYEHLKREKRTEL"
     gene            132300..133046
                     /locus_tag="BC341_gp143"
                     /old_locus_tag="PTPV-Aus-143"
                     /db_xref="GeneID:28340470"
     CDS             132300..133046
                     /gene="PTPV-Aus-143"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="YP_009268858.1"
                     /translation="MACENSGAKWSEIVEAADSSIGNEEQQPGASAPATPPVSERAAV
                     PPVNADERKRRRSRSRCGGRSDEGCTPCSKHPDYSKLRVSVRNYGSCKQLTSVFSAEA
                     HPNELTSLNFYNEPAMFAPDSYDKTTLPKLTCVREGNLFAGSVRLTPCRFLLRGSFVC
                     WIEMGYNCVRMAAANVGLTDVTISHSQTPEQIRHGSQTCRISFAVRASGTSWVLPFLQ
                     TLETVVSESDPHPRIPGKFKVTFIDPVESE"
ORIGIN      
        1 ctgcagacgc tcgagaccgt cgtttccgaa agcgatcctc acccgcgcat ccccggaaag
       61 tttaaggtca ctttcatcga ccctgtcgaa tccgagtaac ggagcagtcg acgagcagtc
      121 gtacgcgatt gctgttttta gcagtttagt ttttctatct cgtaaaaaac acgtaaaata
      181 aagtaagtgt tttttaaaaa tctttttttt atcctctata aatatttaaa attatacatt
      241 aagaaacaaa gttgttaatt tattgacata gtacaaataa atataatcaa ctatttgatt
      301 tctatatagt ataattttaa atatttatag aggataaaaa aaagattttt aaaaaacact
      361 tactttattt tacgtgtttt ttacgagata gaaaaactaa actgctaaaa acagcaatcg
      421 cgtacgactg ctcgtcgact gctccgttac tcggattcga cagggtcgat gaaagtgacc
      481 ttaaactttc cggggatgcg cgggtgagga tcgctttcgg aaacgacggt ctcgagcgtc
      541 tgcagaaacg gaagaaccca agaagtcccg ctggcccgaa cggcgaagct gatcctgcag
      601 gtctgcgacc cgtgccggat ctgttctggc gtctgggagt gagagatggt gacgtcggtc
      661 agtccgacgt tagcggccgc catgcgtacg cagttgtacc ccatttcgat ccagcacacg
      721 aacgacccgc gcaagaggaa cctgcacgga gtcagtctca cgcttcccgc gaacaggttt
      781 ccttcgcgga cgcaggtcag cttcggcagc gtcgtcttgt cgtacgagtc gggcgcgaac
      841 atcgcaggct cgttgtagaa gttgaggctc gtcagctcgt tggggtgcgc ctccgcgctg
      901 aagacgctcg tcagctgctt gcagctcccg tagttgcgga ccgagacgcg gagcttggag
      961 tagtccgggt gcttgctgca cggcgtgcat ccttcatctg accggccgcc gcacctgctc
     1021 cggctcctgc gcctcttcct ctcgtcggcg ttcaccgggg ggacggccgc gcgctcgctg
     1081 gcgagcggag tggcgggcgc gctggctccg ggctgctgct cctcgttgcc gatgctgctg
     1141 tcggccgcct cgacgatctc gctccatttt gctccggagt tttcgcaggc catcgctggt
     1201 cggttagctg gagtgcgcgg aagaaggtca ggatctctgg ctcgagagat ataataaatg
     1261 ttacaaaaat gctaatataa cgtttcaatt ttacgcgcga gctcgcgctc cagctcgccg
     1321 agaagcgctt ccgcccagcc gccaccgagt gagcacaggt cggcgattac cgtgccccgt
     1381 ttcccatgag tcccaggaac gaagtttgca gcactgttct caacaccgca ctttttcacc
     1441 aaattctcta cggcacagat ggattgttcc tcaacgtcag tgagttctag tctcaagtag
     1501 agctcctcgc atttagtgct ggaaaacctt actctgtcaa taacagatac gttagaacgt
     1561 actgacggtg cgtggacagt tacggttgct ctgttacctt caagtatcat aggtttcaaa
     1621 aaagaactgc gtgtcttacg agattctttt attgcgttaa agcgagagta agcttctaga
     1681 gcagctgcgt taccttccat atttgcagtg gctaaaatgc ggcttttgtt tcattaataa
     1741 aaactaagaa aagatacctc catgctttat cctgactcgg gaaacttctt tcccgttggc
     1801 acatgttcca actatgtgtg tgatgttatc gcctatccag acgtagtagt cagtaacaga
     1861 gccgctagac cgagcagcct tttctaaagc gtactgtttt attacgcagt aaggcccctg
     1921 ttgaccaccg tatacagagt gtttgtccac aatagtgcgg tggtgtactc gcacattaga
     1981 ctgtaaatct agcgtttcat acccaattcc gcttacgcaa aatgcgtcac ccttagagcg
     2041 agttatacaa gagataggct caccgtcttc ggagtaaata agatctccta cttcaggttt
     2101 gttggcacct tctataagaa tgtaaggtag aaaccctcca atgtatcgct cccctattgt
     2161 gctagaaacc cacatgtacc tatgggtttc gtagcggcag ccgttaacaa ccacatgact
     2221 gaattgtgtt acgtctacgg ctttgttgct agatagaccg ggaaagcaat ggagcttgtt
     2281 tactgcagcg tccgcgtcaa gatgcgggag aaacttagcg gccgccattt gcgactgttg
     2341 caaatttaca gggatatatt ttccacttta gacagtgaaa aatataataa aaactaattg
     2401 ataattattt tgattagagt tctgaatgtt caattctctt cttaattctc tcatgtctcc
     2461 aaaataactc actggattct tctacacaga cttttacgtt gcgctcgtgc acaacttgcc
     2521 aaacatctac aacatgttct ttgacttcca accctaagta cttagctgta taaacaggag
     2581 ctgttttttc tacatcaaat actgttagtt cacttgttag agagtggtgg taagtgaatg
     2641 aatcttcctc tatatactcg ctgtttacat ctattttaac gttataatta ctttggttgt
     2701 catttgtaaa agtgcacttt ctaggcattc gtcgagaacc acatgcgctc cagtaaacac
     2761 catcgcttac tctaacagtt aaaacctttg cctgaaatct aacagtaaga gatttgctag
     2821 attctgaagg atacttaact acacaaatgc tgctatgcat cgttgttctt gcagatatag
     2881 catggtcaaa aaaggcaaaa accaacacca aagaaagcgt aaaagtgatg tagcctgcca
     2941 tggtagctag ctgtactaat tacgacgtac aaattcagtt ttttatttgt acagtaccta
     3001 aagtttacga aataaatgat ttataaaaat gttactattt tattttttac gcactaaaat
     3061 aaaatctgct tactgtaaag ctaacgtact taacttctga attgcacttt cctgacattg
     3121 tatagtaaaa gatttcactg tttatctttt tactgtttct aactattttc tttataaatt
     3181 tgtagtcact tcgcttacgc ggaatcaaaa tttttttatt tttaggagat atgtttttcc
     3241 aagcaatatt tttgtcgtca tcgttgtcaa agtattcatt aaagtactca aacaccgtat
     3301 atgtatcaaa aaacttatct aaacacaaat cattaaattt tttataaacg gattgattgc
     3361 gaactaccct atggtttaca gctgttaaaa tacagtgtcc tgccctgtta atgataatat
     3421 caaagctatt tgcttttgcc aatgggtcgt taataattat cgagcagtag caataatctc
     3481 gcgttccctc ggtgtcgtaa aacgacaatg atttgtagtt taacggcaca tcaaataatt
     3541 ttataccacc agagctgtat tttattaaca cgtttattag agcaactttt tttactcctt
     3601 cagttacggt atttgaccaa tgtggcagtc tcttgtcaaa taatatatcc gatttactca
     3661 ttgtaacggt gttttctatt tctacacaag tttctcctcc ctttaacgga gtgtctaaat
     3721 ataaaaccag gtggtgttcc gcgcagttgt tgctaactat attttcgtag tctgtgtgtc
     3781 tattaaagta gtctccttct aaatattcaa ctactgtaac gtatttgtca attaatacgt
     3841 tatccgcata atgattagta gactctgtta ataaagctcg taagcatgat aagtagtatt
     3901 ttgatacatc agaagcgagt attgtaactt gttttgactt tctatcttcg cttatttctt
     3961 ctttcttgct atttgtgtta tacactttag agtctctcca ttcgacgttt ctgcttatag
     4021 cgcaccgtat catcgcttta atgccgttta agtactctgg taaaaaagtt tttaccttta
     4081 ccaaaccgtt gctgcgaatt tcaaaagtgt tttgtggagt catgtccata gcaaaattgt
     4141 tacggaaaac aaaagaaaaa caaatactat ttcattaata aaaattaact tcgtacgtca
     4201 gttaaaagtc cacgtctaga gtaaacgtca tatcggactt tgaacaaaca ccaaattttt
     4261 ggtattcgga tactcgcttt tcgaagaaat tagttttgcc ttctaacgaa atattttcca
     4321 taaaatcaaa cggattagtt gcgttgtaat gtttttcaca ctttagagct acaagcaatc
     4381 ggtcagctac aaattctata tactggctca tgagttcgca gttaattcca attaatctca
     4441 caggtagcgc gtatgtcaaa aactcttgtt ctatagttac ggcttctgtg attatatctt
     4501 ttattttatc tttagatggt ttatttacta agtatccaaa caataaacac gcaaaatcac
     4561 aatgcaaacc ttcgtctctg ctaatcagtt cgttagaaaa cgttaatccg ggcattaaac
     4621 ctctcttttt aagccaaaat atagcggcaa atgacccaga aaagaatatg ccttctacgg
     4681 cggcaaacgc tactaatcgg gacccgaacg agctggcttt gtctttaatc cattttaatg
     4741 cccagttagc ttttttctta acgcacggaa ttgtgtatat agcgttaaat aatttacttt
     4801 tttcaaatgg gtcttgaata taagtgtcta ttagtaggct atacatttca gaatgtatat
     4861 tttctatagc aatctgaaat ccgtaaaagc atctagcttc tgttacttga acttcgttac
     4921 aaaatctttc tactaagttt tcgtttacta taccgtcact ggctgcaaaa aacgccaaaa
     4981 catgagatat aaagtactgt tcgtcaggct taagtttttt ccagtggggc aaatctttag
     5041 ttaaatcaac ttcttcaaca gtccaaaacg acgcttccgc ttttttgtac atagaccaaa
     5101 tatcaggata ctgaatcgga agtatgacaa atctgttgtc gttaggtgta agaagcggtt
     5161 cttgaacaat atcacacgtt gttttagcgt cattagactc cattattata gtttagtcta
     5221 tatactcgta ttccggcaaa cctctatcat caattgagat atttatttta gattttataa
     5281 acttacattc accggcggga tgttttaaca gtctgcacct acaatcgtct acagtatccg
     5341 tcagataaaa gctatattta gagttccaat ctctttggaa cacgtcttct agctgctttc
     5401 tgatgtttat gttatcgcta ggaacaatat taacggatac tccacatgtt tctgtaaagt
     5461 aattaccggt ccagttagac gttcctatgt aagcggtatt gtcggttacc atatacttcg
     5521 tgtggttaac tctggtataa ggtattggtg gatctatatt aggtacaata aatagtttta
     5581 cttgaatgtt tttcttgtta tctcgtaaac tgtttagaga taacaagaaa gatctcatag
     5641 aaaaagaaga ccgttcccag caacttataa gcaatttaat ttctaatttt ttttctatag
     5701 cgtattttat aatttcgtca ttaatgttag gccaataaat ttgaccatta tcagtgtata
     5761 gtacaggttc gtaattcatt acagaaacgt gtacaaattt attagctgtt tgaatgcagt
     5821 gcgtaagaga atctatgtcg tttgttctgc taagaggtga aaactccatt ggtgaactag
     5881 ctataaaaat actagtaagt actccgttaa tataggtatt aagaggagtt atcatgttaa
     5941 ttttagtttc gtaacatgaa ctccaagacg acggtataaa gtcagtaaga aaccaatatg
     6001 tgtaaaatat ttttgttaag tccttagcca aacaagagtt gttaaacaat acaattccta
     6061 tttcttttac ttctgtaagg gatcgccaat cttggttagc gcttccgatg taaatgtgtc
     6121 ttccgtcaac aatccaaaat ttagtgtgaa gaattccacc cgttagtttt gttacgtcta
     6181 caaacttgac tccacatccc tgattcatta gcttaaccaa gtcgggagaa acctgagaag
     6241 ttttaggttt atttacggct atcttaacat caactccttt tgatggtagt tttaaaatag
     6301 tttctagtat agttcttcct tgtatcgcca tgacattagg acttccgtcg tctaaagacc
     6361 aataaaaaga cgctattaac aaactttttt cagtcattga aagtaacttt aaccatgtgt
     6421 caaaagtaga tgctgatact gttcctgata aaaactccat tccttctggt atactttcta
     6481 ccaagtaggc agatgtttgt tctttacaat tcatagttat tgagtgaatc gtctagtttt
     6541 atgatattta caaatgacaa atttaatata attttttctt taatatcata cggtaatgcg
     6601 ttccaaccac tttctgtaga atttaaaaac tgtataattt tattaacagc atcgttaata
     6661 aaagaagccc tactaatcat gcggcaaatt tttaaaccat atatttcttt tttggaaaat
     6721 gaaattaagc taggatgttt gtaaaatctg tacagcaacg aatcagaatt ttttttaaat
     6781 acaagatcat aaactgataa atttttgctt agaacaaagt gtttcatgtt atatatttca
     6841 tccattgctg cataagcaca tattttacat ggaagtgcaa gggtgttagt ctgattttca
     6901 aatgcagaag ctatgttaac tgtagaaaca gaagctacat acttgataca ctttttaaag
     6961 catttaaacc cttctttata aacgttttcg ttttcgaaaa gaggaatagt ttttttaatg
     7021 ctgtatataa cattagacac tttaggttga agattaataa ttagagatac caaattatag
     7081 tttaaagaag atatagctat agctaaacaa gtgtttccat tagttgttat ttcatcaacg
     7141 aagaaactgt cttttcctaa aagatagtaa attatttttt cgttgttgca cataatagcc
     7201 aaataagcta acgtttcgtt aaacacgtta actggtttaa aatgaactcc agattcgtgc
     7261 aaaattcgaa atatttttaa ttttggattt gcgttatatg acaaataata atgcaacatg
     7321 ttgttggaaa gtacatcttc gtgttgcata tcgcagtttt ttagcaacaa aggaagcatg
     7381 ttacaatcta ttgtttccct aataagatag taatgaatag gctttcttcc gtacatgtca
     7441 aaggattggt caaatctaac gctgtgcatt attaaaattt ttaacactgc ctttgttaaa
     7501 ataccatttt gtaggtagta atgaactggc gttttcccta aatttgtttc ttcatacaag
     7561 ctagcttctt tgaataaaag atattttaaa acatttacag gaacatgttt ttgcttcatt
     7621 aataagtgta gaggtgtttc tccaaagtca tttttagcat taactatggc tccgtttgaa
     7681 acaagtaact caactatttc tatatctatt acatcagtaa ctgcgtgatg caaagctgtc
     7741 atgttaaagt cggaaagctg ataaacacag ttaggatttt cttgtatcat acgactaacc
     7801 aagtcatagc tacaaagttt tacaaactgc gtaaagcaat tgcaataatg aaaatccgcc
     7861 attgtgtagt atggtaaaaa ccactaacaa caatacaatt attttttatg tttttaatat
     7921 aaaaattgta cagaaatctc caattttatt gattcactta aaaaaacatt taattcccaa
     7981 aaacacaaca gtgccagcag caattgtagc agccaaaaat ccataattaa atttgttgtt
     8041 tattttgctg tagtcttgga taaatctttg aaggttactg ggagatgcgt ttaatagctt
     8101 tatgataagt ggctgagaaa tagctgcaga tctcaccaca tatccatgtt cgcaccattt
     8161 tgagaacatt cttccccata gagttacagt agcaatagct ttgccaggag ttagtgtttg
     8221 agtagtcaag tcttcaacaa atgagttgta ggtgtcgcta gtgttcatga tgttttcttc
     8281 atccaccata ttttcaataa acctaaaagc tgcattaaat tgaacatctg ttttgtcaca
     8341 agtgtttttt atagctttat aaagtgcttc agcgtttggt gacagtgcgc cacgtagtcc
     8401 ttgcagttct ttttctttta tgtacagtga aagtgccaaa tacaagtcac atttatcaga
     8461 ttgaataaag taagactcgt caagttcatt ttgcaataga ctatacggcg cgttaaggtt
     8521 ttgttcacgc tgttcatttt cttcgttttc ttcattttct tcacggcgaa atacatcgcc
     8581 tctagcaaca acaggattga agttaagcat tctgagttac ctctaatttg tagtgtgtac
     8641 taaagttacc tattttttaa gtttttatat gttagccaaa gagttgaaag atctagttct
     8701 ctttagtaca tttggttctg ttattggttt aatgttgtga ttataatttc tccgactaga
     8761 tcttagtttt ttagcggacg tttcaagaat cttaatgtcc tctctaagat aatgttctaa
     8821 cgtagacaga agctcaaatc gttgcttagt taaagtattg ataagttcga gaattgcatc
     8881 agaccatact tcgtcctctg aatcttgctc gtcatcatcg tcttctgtca ctttgtcata
     8941 aataggttca tcgcattttt gcgcacaact aaactctgcg aaggacgatg aagtattttt
     9001 tggaagagta ctgctcttac agcgaacatc tgtagataaa ctatttactt tttgtttgga
     9061 tctaactatt tctttaggag gcaaagaagc agttctgtga aaagaagatg attgtgtaga
     9121 atgagacatt ctattaaaaa atgtagtagc gttctttttt gctttattta acaagtccat
     9181 tttaaaactt tgttaagttg tataaaaaaa tacactttat ttttatatat tattaggatt
     9241 atatacgtct atcaaattaa catatgtttt tcttctttta taatagttgt attgtaaaat
     9301 agctttataa gataacacac acgctattac cgttaaaatc aaaaaggcag atattagtat
     9361 tactgtacaa ggtctagtat ctaaaacgaa ccgtacagtt gagcatgcgt tattgtctga
     9421 aacttttttt tggtttacgt aacattggta gtctattgat acggtaaatg attctgaaac
     9481 gctaaactta tttatagaga cgcatgatac ggtaagtttt ttgttaacaa taaatttacc
     9541 tattagtgtt tttgtattga accatgttat gttacgttga gtgtctaaaa atccgtttcc
     9601 cataaacgat aataaagtgt tatgttgttc agcgtcacaa cgaatcgtcg ctaaacactt
     9661 tgtgccgtca gtttctaatc ttgtaatttt taacgtaggt tcatctattg taggttctac
     9721 aactaattta gtacaaagtg taatgactgt atttgtacta tcaacgatgg aaattaacat
     9781 tactccagca tccgaatgtt ttagtttctt aattattaat cctttttcta ccacgtaaga
     9841 tctatacaca acagatgatt ttgtattact aatagggtag taaccgttgc tgctattact
     9901 caacggagaa aagactgtaa aggttttgtt tgtttttgtg tatctaactg tcactgattt
     9961 tggtattcct gtaacgctcc aagctttaaa caacacagag tctccttcaa ttctttttgt
    10021 tactgtacaa tttggttcgc gtattttttt ctcatatgga gaaaaaaaca actttggtgt
    10081 ataaggaaca tttataaaat gcggaacctt aacttctttc tcaaagaagt taatcggtga
    10141 tattatttgc tgaattatag ctccgagtaa aaagaacacc atgtatatta ttgtattttt
    10201 catgaccatt tttgagatta gcccactgta aatgtgctat caattggtac ttcatatttt
    10261 tgttttagca gcgaataatt atttttcttt ttgcaaatgc tagatactaa tgttctacag
    10321 caacaagtta cttgatatat catttgatga attattccac acgcagagca cgctataaac
    10381 gccaataaac cgcatactat tataaaaact ataaataaaa tagacttgag tctttcagta
    10441 ggagattcat cttctgcagc tgtagatgtg gatacaggag cagcataaac aaagcatttt
    10501 agagatataa gaaacaccag tgtatttgcg ccaataatga tttttgacat aaacatttat
    10561 aactgatgtt attttttaca ataaaaatta atttggagcc tcgacatcga attcaccatc
    10621 cttcagttca cctcttggtt tttgaccaat tagccagaga tgttttttct caccagattg
    10681 atttgtaact tcgcactcgt tctcgaagtg aacagtgcat tgttctccaa ctgtagtaac
    10741 tgtaccgtca acttcgtttt caaatctaac ggtacatctt tctcccacat gagtaactgt
    10801 accgtcaact tcgttttcaa agcaaacgct acaacaactg tttgggaatt taaggcaagc
    10861 ctcaacatcc tgagagattc tggagttgct cattttgaag attgtttcta tgtactagac
    10921 agtagaaact gagtactaaa ttgatgctta aaaatcaatt ttttatatta gcttctgtgt
    10981 acgagacagt agaaaccgag tgctaatttg atgcttaaaa atcaattttt ttataatatt
    11041 tgttaaaatg atttttgtaa tacccaatta aaatttataa aaatatagtc aattataact
    11101 caaattacat atcatccaaa ttttcataac agctaatgtc catgttagga tcaaattctg
    11161 aaattggaaa aattgtttcc ggattattca aaacctgttg tatgaattca tcattccact
    11221 caatgtcatc aaacagatta agcatgtctg atgacaaaac atcctcttgc gtgttcatat
    11281 gattagaaga ttgtgccaac attggagaat cagcttgatc ctgtacatca tcaactagct
    11341 gatttggtgg tggaagaaga acaggttgaa caggttgctg attttgttgt acaagaggta
    11401 tttctacgtt cccgtccaaa ttatcaaatt gattatctgg ttgcaaaatc tgttgattgt
    11461 tttcttcacg gtctccgttt tgtcgcctag ctgtttcaat cacaaaatac tcatctccat
    11521 gaatggttct aacagcgcct tcttgacgag gcaggttagc cactgcttct atgctcctgg
    11581 ccaaatccaa aataccttct tgtatttcta gctcaaagtt tccacgatcg tagtaaaaac
    11641 gattagacac aaagttaagg atttgtgcca tcatagttaa taactattaa aaatcagaga
    11701 tgatttttaa cgttattgtc tatcgctata aaaacgttaa gaattcattt ttaagagtat
    11761 actttgacaa tctagaggag aagggttcat tcgaatagta acaggattaa ctagcgtatt
    11821 ttttttattt agtggtataa acatatattt tgtagccaat tcctttaatg tttgtttgca
    11881 tgtgttttct acatatacat cataactaga tggaattata catatagcac ctttttttaa
    11941 cgttattacg aatccagaat ttacaggttt ttctttatcg ttagacatag ttattatttt
    12001 tgtctttcca ttattttgta aacagataat agctgttagt gaatgttgta aaaagtcagc
    12061 tgtggcattc gtataacaaa ttttactcgc gctagtagtt ccgtaacttt ctactagtgc
    12121 acaaacgtta ctagcttcgt aatccgaact aataacgttc atatacacta acaacgcctg
    12181 taaccggctg gttatagaaa ataactttgc ctctttgtta gttaacaaat cctctatttc
    12241 ttgaacgaag tcaggagcgg ctatcgcaaa cggactcatc ttgggttaat agatagtctg
    12301 ttaaaaaata ctattttatt tcagtaaata taattaaata gtactatatc cttcatgtac
    12361 cggttaaaaa aagtgctagt tgttttcttc atatgaaatg taatggttaa ttaatttgtc
    12421 tcgcgtagat gtagtctgga tatttagctc caattatggt aggagcgtta attatcagac
    12481 cgttgctgaa cgtgaggcca aatttattaa tttcatccat agatggaggt tcatgcttta
    12541 tgctaaacga ggatccgtat agctttgatt tttgatattg ctgcttaggg attttttgtc
    12601 tattcttcat gtcaccgttc attgtgattg aaatgttgtc gaaacttcga cgaccgtagg
    12661 tagctctact tttctatatt tatatttcaa cttattttga tcaaacgcgt aaagtagctc
    12721 cgtacttgta cgctaactta attctacgcc tcaaagaact tacggatatt attataataa
    12781 acgttattat aaccgataaa gctataatcc aaggattgtt aaacgatatt gttggtttta
    12841 ttataggtat ttcgtagtta tttaccagag cttgtaaaat tgtatttatc ccacagtttg
    12901 cggacgccga gccagtattt ataaactgta ttaaaatatg ctgcccagga ggagatacgc
    12961 acgtgccaat atttaaattt tgtacatcga tgatggacgt aacagatgct gttgcggaac
    13021 actgctgttc taactttgac gtttctccag gctttaagtt taaatcaatt cctactttat
    13081 cagcaatttt cttttgttca tttattggaa gttttgatat agtttctaaa aacgcttgag
    13141 ttaataacga gtaactaagt ttagtgttat tattgcacct attaattatt ttaagagcgc
    13201 atccgtttag tgtgccagat atattaccta tatgtatggc gcacgtaatg tttgtaggaa
    13261 ctgcgtatat cgctaacagt tccatgtatc tgtccgcaaa catatcgtac aaggttttta
    13321 caggtttagt cgctgccatt tatccactgt gagaaaatgt ctctagtaat tatttttttt
    13381 aaaaaagata taggatgtgt tatgggagtt ttgagtctaa atttttcaca cgttgttttt
    13441 gtgcaacaca taacaaactc ttccaacgtt gacaaaaaat ctttgtcttc tgtaacttcg
    13501 ggatatgctc taagtagagt atgaactaaa aaatgaaagt cgtaaaacca attttggggt
    13561 tctttgatgt ttcctttaat ttttgtgttt tttatttgac acacgcgtgc aaaatcaaaa
    13621 tcattaacag cgcatcttat gggttcttta aaagtgtatg tttttttacc cacgtgtatc
    13681 tttattactt ttttagaatc aaatattagt atattgtccg gctttaagtc tgcgtgcata
    13741 aaattatcac atccaggaag ttcataaatt ttaatgtata gcaacgaaac ttgtaaaaac
    13801 aaaaacttta tatattcaga cactgactta aaaccaaaca tagaaacgtt ttcttgagtt
    13861 atttgatcag ctgaacatct agctaaagga aaaataatta tattgcctcg atcatattcg
    13921 tatttagatc ttttttcgtg ttcgaaaaaa tgcactaagt gactaaaatg gttaataata
    13981 tttatgttac tttgtactac agatggataa aaataagata ttaattttac aaatgttgtg
    14041 tcgtttttcc tctcgttaaa tttttgcaaa aatatttttt gtgaaaagtc taaatttagt
    14101 tctttgttat ccattatttt aaatattagt actatcatac taagcactcg tttgtaaagc
    14161 aagtgtaaaa agttcatttt gtagtttata cccatagcaa gagcgcaaac tataaactgt
    14221 ttttcgtctc ctttgagatt attgtacaaa aatctaggaa ttgtgtattc tgatgcagtg
    14281 tctatatctg ttaaaaagct ttttgtttca aacacaaact tgactatgta ttcttctatt
    14341 ttaaaaacta ttccgtaacc tccggttgca acatgataca aatcgtcgtt taacggaatg
    14401 aattttttgt ttttcatctg aaaatacgaa gggtttacgt aatcgtcatt tataattttg
    14461 tttagagagt ctttggaaaa atttctaaag tatctaatta gtttaacagg aggtgcccaa
    14521 ctttggctag tatcaatttg cgaaattgca taatttaagt atatgtcgtc tcccaaaaca
    14581 gttatgtcct ttctaagaga atctctattc cacggaaata tttctaatga cgtagtttct
    14641 tcagtcatgt taatgtattt gattactatg ttttgcaaaa taaaaagtgt gtcaataata
    14701 tgtaactaaa ttagtacttc tgcttctgga aaacctattt tgtctaacac gtaatacttg
    14761 gaaagtagtt catttctacg ctttattatt tgagattcac gtactttctt tattacgtac
    14821 gcattcaaac aagacacatc agtgtttgca gctttactta aatttgtaac taattcattt
    14881 aattcattaa agaggttgtc taattcatcc aaaatgcggt ctatataaga ctgaatagcg
    14941 tacaagattg tcttattatc tttttcgtct gtagaaaaca ggttgctgat acaagctata
    15001 ttgttgttta ttttgtttct ctgttctaat ttattagtgc tatttccaat agaagaactc
    15061 ctagttctaa cataagactc aaagctttct tgaagctcca acaaactttt atctattagt
    15121 tttttcccaa acacacaacc tttaacttta aaagtacgaa acatatcttc agcctgacac
    15181 atgttaaagt aagcactctc aattgcaatt ctattgtcta taacattttc taatagtttt
    15241 atagcttttt ctctatcatc ttcaatcatc ttataaagct cagccatggt agttctacaa
    15301 tgcatcaaag gtctagttac cctaaacccg cgggtgtgaa gttttttcga aggcaccaat
    15361 gtcaccaaca ggtagctaga ctctcctcct atttgctgaa aaaatctaac accgtttaac
    15421 gctctactta ctgtaaagtc acccacagat gactgtttag ttacgtagtt ggtgttggga
    15481 atgcagtacc cagaaattcc agtatttttt aaacatatta cagccaaata attgttataa
    15541 tgtccaaact gcattacttt tttaactaaa gaactaccag cttctaaatt aactataaag
    15601 caagacccta cttcaaacat accatcgtcg tccaaaagaa aagacagaga cgagttattt
    15661 ataattaatt tactaaactc tgttgagtcg ggcctaggat taggtattaa ctctttagca
    15721 ctaagaggag actttccgca aaatacgtcg tctttgagag tcaagctgtt gttaatagat
    15781 tcaacgtagg tgattttttg ctggctatct gccgatttta cagatagcat tgagctagtt
    15841 gcagaactag aatcaacaac tgacgaaact atcagatctt gagattcggt tcgtgttccg
    15901 cgggatcgcg aaaaaatacg ctgaatgcgt tttaagaaag acatgtttaa ctgctgttgc
    15961 acttaaacgc gactggtaaa gaatgataat ttatcaattt ctttaacaaa aagcaatttt
    16021 aacaatttca gaagctgttt cggcaggctc tctaatccaa acactagcaa aatcatgctg
    16081 atctactaac ttagcgctaa agtgattgtc tattctttca atcgctgtgt gaactttagc
    16141 tctacagtag ctaactgcaa aggctaacat aactaacgat tctgggctgc tttctaacac
    16201 acagtcgttt aaaagcaagt ctacactagc tgacattttt ttgaacattt cagaagtttg
    16261 ttttgaatca aactgtttaa cagaagacgt tattttttct aatcctgaga aaattacttt
    16321 atcgctagac tcccactgga gagctcccaa aattctaatt ttatatccac ctactcttgt
    16381 tatggtagct atgtctacag aagttaaagg aacgcaaaat ggagcgtcaa agttaccatt
    16441 aggaggttct attatcggaa tcatcagttt tgaaagagtt tttacctcac atagagctat
    16501 gtacattttt tctttttcag gaactgtaac gtacgttggt tttccaagag gatactgata
    16561 ttcagatatg gcattaagca agttttttat agccactcta cgagtgtttt tgtgaacaac
    16621 aggagtttta gactttatta tgctagtgtg aattgtgtct gctataaact cttttgcagt
    16681 ttcgtgtacg ggatagtata gtccgttgtg ttcgctacat cctagcaccg cagcattagt
    16741 tatgaacatg ttttctatac tgttaaactg ttctacattt ccaatgggta aaattttaga
    16801 cagtaaaacc tgttgctgag tgacggtttc atacagagac attgacgcag agtttgcagt
    16861 gtcaattgtc gaatctacag acttttgaaa atctgaaaat gatagcaaat ccgccggcaa
    16921 cgacgaacta actcctcccc aaaacttgca gtaatctgaa aatgacaaac ctagagcaaa
    16981 ctgcgacacg tcaaaaaacg taactgtatt acctttatca gacataattg ttttgtctcc
    17041 tatcagagtc cagtcgctag atttttttac ttctttttgt attagaatgc tttctaaaaa
    17101 attactcata aaccctacaa tagtaatatt ggtacagcta gagttagcgt ctgttagcca
    17161 gtctaaaaaa tctattatta tgttatctgt tggagaagat gctgtaaatg taggacctgg
    17221 atacatagat atattaacag gaatgacaga ttttccgttt agcgcaatag tagtacacat
    17281 agcgtacatt tttgaagagt taaaggttct catatacttt gtccacatgt ttttgctagc
    17341 tattaagctt aaatcatact tcataacgtc tagttcaggt ctattgtatt tatttaagtt
    17401 cttaacccaa atagcatgat accccactaa cccaataacc atgtcatcta taatagtaag
    17461 atttgtagaa ctatttttgc gttttctaat atctctaaag tgtacaagcc tgtaatcgta
    17521 cattcctaca gtagacagcc aatagtttat gtctgaaaac gtgtgtatgc cttcggtagg
    17581 ccagtgtaag taaattgttc tcaataaatc catacatgtg tctgctcttt taaacaatat
    17641 atcggatagc ggcgactcgg agggtttagg tgagtaaaac gtttcagtgt ctacttcgtg
    17701 catggtatgt gcagcttctg gaggatcaat gatttcatcg tcgcaaaagt ccaaaaacac
    17761 agttaatact acatctatag aagtgtgacg aaatgtaatt tttgctaatt gtaagttttg
    17821 tctagtaatt aataaaccct ttccggatct agtccttgct actacagcag aattagcatg
    17881 cactaaaagt aaatgttcta ttgcttttat agaatcttga gtcgcaggag cgctattaca
    17941 catttttcca aaaatgttaa acattgtgac gatctcacag cgcgtgtact taagctgatt
    18001 taatttatgt tttttgcaac aggcacgctg tacttggatt cccaatctct gttaaatact
    18061 tcgcttagtt tttttaccag taccaaactc tcagcgtttg cgctaacaaa cgagtgatgt
    18121 ttgtaatgcg taccatcaaa atttgcgacg gttaagtgag caaatttact atcaacaact
    18181 aaaagttttg tattattaac agtatctgaa tctttgttag aaaaatatct tactgatata
    18241 tctgcgtttt ctgtactaaa cgcgtttaaa gtgcttatag cggctaacga aaacggattg
    18301 ttgtttttta agtgacttac caatactctt attttaacgg atctgtttat agctgcttct
    18361 agcaacgcgt ttagtagatt gggccaaaac acaattactt catcggactt aactattggt
    18421 acaaacgaca ttagagacaa gtctatcgag tcctgcgctt ttgaaattcg ttctataaca
    18481 acgtcatagt ctagtgttct aaagcacccc aataaagtat ctggagaatc agaaaaaaat
    18541 actccgcctg cgctgtagtc taagtgaaaa tctgtagcta gaggaacgcc acaaaccgtg
    18601 tttgccatac aaggcgtgca acaaattttt ctaaatatac ttgatttttt atctattagt
    18661 tttttaaacg tgtcaaatct attttctaaa tctttagcta aaacgctgca tgtagaataa
    18721 agtcctaaat ttttaatcgt tgtcagcgat ccacctgtga gactagcgct tcctacgtac
    18781 agtctttctt tatcagaagt ccaaaaattt cctaacatgt tgctcatccc tgtgttgtta
    18841 atttttactt taaagtattc tactccagaa ttttctaaaa tctctttatc cgtatctcgg
    18901 ctttgataat caacaaggat tactacttta actcctcttc gtgcagcgtc acatagcttt
    18961 gatagaatgt tttctccatc ttttgtcgaa cgcaaattac aacaaaacgt aacaatgtgt
    19021 atagttttgg tagcttttgc aataagttct tcaaagcact cgagagtagt aatgtttgta
    19081 gattgcaagt caagagtttt aggaattgtt tcaaccacta tacagtttgc tccatccggt
    19141 acagaagaaa aaggccacat ttagttaata gaatttagag ttggtttttt ataaaaaaca
    19201 cgccatctca gacagctgtt taatgtgtta tgtcttcaat aagatagtaa ttaaaatctt
    19261 ctagttcatc aattaaactt tctaagtcac tgtctgacac aatgctagat aggtctgaat
    19321 tttcttctaa gctatcgaga agttcctcta gctcttcaga caattccata ccttcgtcga
    19381 caagagagtc ttgttcaaca gggtcaatca tttttggttt ttttatttat tgcttgagat
    19441 aagcacaacg agtacaaaat atatgcttaa atttatgttt ttttatacat aaactaataa
    19501 actttccatt tcttcatctc gattagtttc tttaaagtct ttagcggcgc gtctgcacgc
    19561 tattacgcag tctaagctag ttagaataat tcctatagta aaagttgcaa ttccaatata
    19621 caaaacaata tcgataaaca ttgttttaaa gatataaaaa tatgtgtaaa tctgtacaag
    19681 acctacacgt atatttttta ctgtaaagtg ttttttcact aaattatttc aaatttagat
    19741 ttccaaaagt ccactacacg taaccctatt attaagtact ttgtcggatc agttgttgga
    19801 acaaacacat ctattgataa tttgttatcg tttaaagttt tttcagtgac gcaaaaaaca
    19861 gtttttttgg gctttgctct atttatgcat ttcataacaa atccgggaga caggtactga
    19921 tactgcattc tgctaaaatg aaacggagaa aacaataaat cttctaagta aaatttttga
    19981 ttacgtaaaa atattggagc cgtagcgtca attgagcggc tgggtatatg tctgacagaa
    20041 ctaaccttta caaaacacct gtttcccatt atgcaatttt gctcttcgtt gcgcttagtt
    20101 tttgacatgc tgtaaaacgg cttaagcgca ataatatctt ctaacgtact tacttccatg
    20161 ttatttacga acttgaatcg gctctctaca aacaaaacaa atattgttat tttttaagca
    20221 atgtgtatga tagccgtgcc cacaagcact cgcgataaaa gtacacgtgt tacaatggcg
    20281 ccgcaaccta caaatatgac atataccgtc acaatttttg tatcgtttta atacaacagg
    20341 tcgccaaaac gtaacagtaa ccggcatttt atacctttaa aaaaatcagt ttttaattca
    20401 gttatttaaa actattctat caacacctgt ttgctgaata aacctgttag cgtaaactat
    20461 tccatttgca actgttatca atttttcatt aaccattgct ttgatagctg ttttaactag
    20521 taattcgctt ttgagcatag cgtttaaatc atctatagat atgccagatt tagactcgta
    20581 cgatttgttg taaatcaagt aatgcgcggt gtttcctatc acatcaactt tgtctgtttc
    20641 atcagaaata gtaaactcta tatacccgct atgtggtgta acaataaaat cagcgtctgg
    20701 aatccatgat tttgcaaaat taataacatt tactagctca ggagcgtgtt tttctatgtc
    20761 aagttcatca ttcaacatga taggtgtgtt gtaagaatcc acataaaacg cgtaaatgtt
    20821 tgttattctc ataaatgttg tttctaaatt ataaatgtat tttgctacta cttctaaagg
    20881 caactttaac acttttttaa ccaacagtag tgttccacgg tccactatgt cagatgtcag
    20941 caaccgtttc attactttta ccgatgtgta attttgcatt tctgtaaagt ctttgtaatc
    21001 tattttatta agtatgtcaa atatataagt catgaaactt tcaatttctt gctgcgactt
    21061 actttcatcg tcaatatatg ctacaatttt tctataccat ttagcaggac actgaaaaaa
    21121 tgaatatttt tttatatttt tttctttaat aatttcataa tacatagata ctaatttaaa
    21181 atataagctt tcatcatttg tttttttact cttttcatat tcttcgttaa tagcttttag
    21241 taccgatttg ttaaagtgtt cttttggtag caaagattgc attagttcta tgtactcagt
    21301 aactgatgat gaaatttcat aacacgagtt tgttagggct tcgtaatctc taacggctat
    21361 tcctttacta actttggata ttaatttttt taagaatgat gacaaggcac cagaatcatt
    21421 tttatactta aacatgtcta tgattaattg gtacatgtta attatgttat tttcgtggta
    21481 acaaacaata ttgttgacaa taacgtgata gtttcttaaa attgatttgt ttaagttaac
    21541 taaggtttcg tacttaaaca acgactctgc gttccaaaac cactcaccca aatctacata
    21601 aaacttatgt gattttagca tgtatcttaa ttttgcatca attaagcacc taaatttgct
    21661 ttcaaaaagc tttataaaat atgaatctac ttgaaagtca tcttctacac gttcccaatc
    21721 atacagcgaa atttgcatca cgccatttat gttatctcta atgcaattta ttcggtgcat
    21781 aaacgcaaca tctagttctt ctacttcgcc tagtatttca ccaggcaacg tccacgtttt
    21841 tctcataaca gcttgctcta aacacataca gaacgtggat tgttttattt tttttgcttg
    21901 tatgagcatt agaagtgatt ttgcttgtga gcaatctact atgtcgtaga catcgtcaaa
    21961 aaatcgagta atcatgtgaa tcaacaaagc gtcagtcatt ttgtctgatt tacaaaaatg
    22021 aacctacata aagttgtggt aatatttatg tttttttata ttataatatg ttccagatca
    22081 taacaaattt cgtttatgga ttcggattct gattttttca acattattag tttatttaca
    22141 aattttttat ataccgtaga agcggttaat tttacttttc tttttttgta tttacagaac
    22201 gtgtaaggat tcgatagctt atatacagtt acactcgtcc ataaaacgtg tttttttaca
    22261 atatttatta attctgatat attattaaag tttttattaa tatgagactt tattaatgat
    22321 ttagaacaag actttatgtt taacaacttt attaaatctt ttattttttt ctttgtttct
    22381 tcgtttaaaa aacatttgtt ttttgtatat ttagcgttgt ttacaacaga atgaacacaa
    22441 attttttcat ttgtattgtt tattaactta aacatgtctc tggttgacgt gagaacgtct
    22501 ttcggtgagt ataatacaaa atctaaaact cctgatttta aatgatcact aacactgata
    22561 gctaattttt ttggagatac gtgaccagaa atagttatct gcgccacatt ttttaagaaa
    22621 ttgtttttgc agtactttaa gcacgcaagt agtttaaatt tatttctcga aaaatataaa
    22681 tcgttatcgg acaaaacgat tacagaaggt tttagtgtct tcatttttgt aatcgtattt
    22741 ttagaataat aatggtgttt tttcatttat gttatatttt taaaactata aatgagtaac
    22801 atgcataaaa cgccttttta tataaatacg gcaatgggtc gcgtactggt actaaaatat
    22861 attaaagtat gcgaaatacc agaagttcaa tgcgccgcta caaaggcaat gtgtgttctt
    22921 aaaacagaag aaccaatgtc tccaaagtgt gaacgcgctc ctgcttcgtg ccctctatca
    22981 ccgtctagac aaccacaacc accggcgtgt ccactttctc cgtctaggca gcagccagtg
    23041 tgcccgctat ctccaactag gcagacagtt gttcctagaa ataataacgt cccatttatg
    23101 aacacaaact tgttagaaaa tttgttttct agtaataaaa acgcagtgtc taaaattttg
    23161 ggttagtgac ttataatgtc ttttgaaata tcaataatgc tatgatttcc agttttttta
    23221 tctctgctaa ttaccttaaa aatgctttct ttagtagata ttaaagattt taatagtaaa
    23281 ctaacagctt tttttccaga ttcgtaatcc gttaaaagca aaaacaaaat tatatgcgct
    23341 gttatcgcgc gtctacttat gtcgtgaatt acattttcgt tactcaacaa aatagtgttt
    23401 gaaaaatacg tgtataaaac gttttttgaa accaagaatg ctgaatttgt tatactttca
    23461 aaatctaaaa cattttcgtc cgagttcatg taaagaatat catgagccaa aacagtttca
    23521 tctaagtaaa cttttgcttg gttaaaactg ctattaagcg gtcgacaatc taccgttaca
    23581 attctagaga cttcatcgat tgtagcaaac agaggaaatc cgtctgcttt ttctgaaaag
    23641 tttacacaga gttctaccct cgcgtactct aacaaagttg atagtctctc tattagtttt
    23701 aaaggatttt ttgctaaatc ttccaatcta tctatttgag atagcatctt aagcatagtc
    23761 attaattgta tcaacggatc aattatgtat atgttattta ttaatatttt aggcaccgca
    23821 tccatagttg actgcctaat attaaaactg tccaatatgt gttttccgtc ttcgtcgtgc
    23881 aagacgatat aattttttaa gtacggaacc tttaaaagcg ttacttgcct tccagttata
    23941 aaataaatta aaaacgccat atttattaaa aaagttcttg agtttgtttg aactatatca
    24001 atgtctccgt actctatatc agagtttaac aaatggagag agtacgaccc gtagcacaga
    24061 cagcttttat tatgtcgtct taagtactcg tccattaact cgtttacgct attaactaaa
    24121 tcggaagcgt tgtgtcttcc catcactttg ctgttaggag ttgcaacgtt gtacgactct
    24181 acagctgttt tagctaaaat tacagtacat gaaacattta gagtcataac agaagaatat
    24241 aagctaggtg ccttagtagt tagcacacca agagtttgag tgtatgttgt taccagcacg
    24301 gtttgaagtt ctattattga aagtattttt cctacttgta tggtatgttt ttgtttagaa
    24361 aagtattcag aaactctttt ggatatagct gttggtgtag catttgtttg atgagagaaa
    24421 aacttacgtt tattttttcg taagagagat ataaatacag ttttattaaa cttgagaatt
    24481 tttgtaatgt ttttataata agcactgatt aaataatatg aacttatttc cggttctctt
    24541 cctaagtact cagtaattac ttgtttagta gactgcatta tgtaaattta ttgttatgat
    24601 tattataaaa tacacgcact agcgtagctc ctaactcaac agtatttact attttcttaa
    24661 gctttatgtc tataacgtcg cttatatgac gtatagactt ttttaactct gttaattctt
    24721 gaacaacttc agtgaccgat tcataaacac tttcatcact tttcagtact tcacaatatt
    24781 gcgatattat tttagttaca aatctttgta tattattaac tcctacgtat ctaacagatc
    24841 ctattactaa gtaagaaaca atagtgacca agagagaatt tagagccgct tgatcgttag
    24901 acattggctc taataacttg tattgcttag ttgtttccat tcctaaatta ataaattttg
    24961 ttaacttatt tagcactaaa gcgtctatgt ctccttttaa aacagtaggt tgttccatag
    25021 gttcgcattt agctaactga gatgcgggta cccaattagg agcgcagtct ggaatataaa
    25081 atagtccgta tgttgcaaat gtggctatgt ctgaaatttg tttgcaaagc ctttcttcgt
    25141 cagtgagcca attaacatct aaatagtact gaaggcatat ccctttagcc atttttaccg
    25201 tactaacgtc tctaaacagc aaagattgta aattaggaat gattattgtt tgcaatgcat
    25261 ttttaagatc gttagaatac acagaaggat aggtttcgtg attggcctga ttgtcgtata
    25321 aactaatagt tacgttaacc gtttttaacg ttagaggttt aaagttgcca agttctgtac
    25381 tacacataaa atattctaaa gaattaataa ctttatcact aaacagagat tctttgctac
    25441 ctataaacat taaatttagc aatagattta ctgtgtccga ttgtaaagga tactcaaaga
    25501 gtaatttttt cattctgtaa gcgcaaaatc cgtactggtg tacatatagc gctaaaagct
    25561 caaaattgtc gttcaaccag ttagtttcaa aggcgtaagt agtaaacaga gtttgttcgg
    25621 ctactgaaag caaagtagtt aaatctaaac aatctaaaaa atcaactaaa tcaacatatt
    25681 tttttttggc acattctgtt gctacagcta agctatgcac tgggatgtgt ctaaccttaa
    25741 tgggattaat agaatgttta actatgttta cacacagtgt ttcatccata acagacgtat
    25801 caattttttc aattattaat cccagtaaat cgtagtattc tttctctatt aatacattta
    25861 ttataaaatc tatactaact gtataacagt ctataaactt acacacattg gacagttgta
    25921 ttctagaaag ttcattagga tagctgttta agtctattcc gttttctgga aatatgatgt
    25981 tgacataaat acccacatct tgaacgtgat cttttaaaaa ctcttttgcg taggaaatat
    26041 agtgttctag tttttcacca tctacgatac acgacagaat atatgtttta ataggagtgg
    26101 acattaaaat gcttttaggt aaaacgctaa tcaggttaat agcgcttttt ggagtagtta
    26161 cccctgccaa aatagttttt aagtctttag gagatacaga gtctattcct ttgtttgcgg
    26221 gaactatccc gtagctaaaa tgcatatccc atagaaattc ttcagaaaat agctggtgtt
    26281 cgtataatgc atctgcgatt atatcatcat taagtatcat gtctctagca atttcttccg
    26341 taaacaaata acttaacctg cgaatactct tatatgaaac tgtagcaaga agaatatccg
    26401 attgctcagg atatttttca gaaatatacc taacatcgtt atctgttaaa atcatatgcg
    26461 gaacgcatct agaaactaac tcaaaagatc cgtgttgtaa gatataagat tggtgatatt
    26521 gaatatgatt agcgtaaata gttggattag tttgatactg aagcaccatt aacaaatcta
    26581 aagggttaac gtgctgaggt ttaaacaagt atagctttaa aggagtattt tgaactacag
    26641 aactgtagtt ttttctagac aacttgctag gatgaaatcc tttttttata aactcatcta
    26701 tttcgttgct ttttagattt ctaaaaacgc aagacagctt aacattttga cactttgcct
    26761 ccgcaacatc acgtttgatt gctgcaatgt tcaacatttt gcctaaaatg aaggtatgct
    26821 ttgagagact aaaatttaag ctttttaaac aaataaaaat tagatataaa actcaggtcc
    26881 gtaagattct acagacactg atctttgtct ttgtggctgg ttaactttaa caaacttttc
    26941 tagtaatact tttagagctt ctgcacatgc caaattttta gctgatctct ttgaaaatcc
    27001 acacgctgat gccaaaatta tattatcaat tagtgccaaa cagctaaatt taggacatgg
    27061 tacagtttct acttgagaga agatgaaaga ttgtgttcta gcagttaatt gacagtactc
    27121 attaatagcg ctagctggag gaacgcattt cagatgttct attttttctt tagttaattc
    27181 atcaccaaaa ggattaaatc tttttctata gttgttgtta gcaacgtctt ctgtttcctt
    27241 gtttttttct tcctcttcct tactttcttc tttttcttct tcattgttat ttttttgaga
    27301 cgtacatacc cacaaaggag ctgagccgtg acagttttcc aatcgtttta ccgaacattc
    27361 tttctccata ctgtaaagac agatattaac ttgtttaact gggcatctta gcataaaggc
    27421 aacgtcttta gctaggtatg gttctggtgc tgcgtcaaga agaacactaa ttttatcttt
    27481 tagtcttctt acatcaaacg caactaaggc gctagaacca gtgcatgagc agcaagccat
    27541 ttttaagaac aattattttt taagttaatg agttttaact gtttttgtgg tatataacca
    27601 agtgcaaaaa tttagataat ttatcatttt tttatatatt taattaagtt cataaggaga
    27661 accgtcttgg tttccgttag gagtaaccat taacgactca atttcttgca tttcgttgtc
    27721 ttcgttttta aattcatcta gagactcgtt atctgacgcg taatcgttgt ctgcttctaa
    27781 ttctatttct tcgtcttctt ctcgcaattc tttagttttt ggattggcct taaacttggg
    27841 aggcttaaaa cgtttcttgc agtctttaca aacgtggata actagcggag cttcgtctgc
    27901 ggctctgtgc tgaatcatta acggaatcgt gtttttgccc ttacatcccg ggcagcgtat
    27961 attcttgctt tgatctaaaa cattaaagta ttttgagtag tcgtaatctt gaagtttttc
    28021 aatgtcgtat tccacttttg cgtctatgca ttttaacgca aatagaatat acctaagaac
    28081 ttctttttct ataccgctag ttgtttttat taagtctgaa atatacttat acttcgtgtc
    28141 aacttcgata gttggtttgg ttttatataa aagtttattt ttagagtctt tagaatactc
    28201 gattcctata ttatgaatgt ggttaaactt tggttcttct atatttacct tgctattgct
    28261 aatgttttta atcatgtttt tgctcgcaga gacagttgcc cacgaaacga cattagaaat
    28321 taattctgaa tttgatatgt atttgcttat tatagaaacc atgtcatact gttcagactc
    28381 cattttgttg caaaatgtat ttataacttt tccatttaaa attattttaa tgtaaaatga
    28441 attttaaacc gtaatcttaa cacactagat atgtatttga gtaacagcac cagcgatatg
    28501 caagaagcta tcactattaa ctatatactt ttattaagta tatgtgcatt aataatcgtt
    28561 ttgatatttg cgtttttact ttactattgt ataaagctat gcaagctaaa ttatagaaat
    28621 gaaatatcta ataattacac agaatttgat gaaaatttta ctcatgacta ttcaaaattt
    28681 aatcatgtta cgtttgtgta ataaaagtga atcataaaat tgttttttta tatatgttct
    28741 gtatgctttc agtatgaaca agcgcaaatt actaacgatg ataagattta gtattaaatt
    28801 acttaacaca aattattctg atgtgttatg tggtaaatat tctttgaaga gtgttttgcc
    28861 tcgtattaag aaaaaactag tatgtaaata cactgcgcaa atgtgtaatg ggtcagaatc
    28921 gtggtattat atagtattat cactatttaa atttgtagag ttaagaaaac acattagctg
    28981 cgttaattgt gacaaaaagt tatcgcctag agaatttgcg tctttagtta ataaatgcgt
    29041 gcagttttta aacgtatatg atagatattt atagcgtaaa tggacttcat aagacgtaaa
    29101 tacctaatac acgtaataga aaacaacata aacgtgttga gggacgatgc ggttaataaa
    29161 gttagtaatt ttacattaaa tcatgtttta gctttacggt atttaatcac tacttttcct
    29221 aaagcgatac tgacaaaaga tgtgtttagc aatccaaatt tttttgtgtt tttacacatg
    29281 gctcaaagca gagatgtgtt tgatgccgtg ttaaaagccg catttgacgc tcctacaatg
    29341 tatataaaag cgttggttaa acactacacg ttgttttcta acgcgataca aacgtacaaa
    29401 gacttatgcc aaaagctaat aacagatgac cggtttatag aagttgttaa attttcgtca
    29461 gctcttaaag atgttatagg tgtaaactac gatctaaccc taaacccttt gttttataaa
    29521 gaggaaccta ttcaagacat agaaattgtt tttacaaagt tattcaagga aactaaattt
    29581 aaagctgtaa agaaacttcc agttttgcgt ctaatgatat gggcctactt aagcaagcaa
    29641 gacactggta ttgaatttga agacaatgac aggcaagata tatttactat tttccaaaaa
    29701 gttggtcctg taatacacag tcatctgaca gagcagttta gggagtttat gttttctaag
    29761 gataaaacta gttactggat atggttaaat gataaaatat caaacgattc agatatttac
    29821 aaagaccgac tggctgaaac aatgtacgaa aaaattttaa gctatattta ttttgaagta
    29881 acgcaagggc gcgtaaacaa aaacatgtta aaattagttt atatttttga agacaacgtt
    29941 gaaataaaac aaatgttgtt agaaattatt tacggagtac ccggagatat attaggaata
    30001 ataaacaacg aaaatgaaga atggaaacag tactttattc atttgtacaa agaatcgttt
    30061 atagacggaa acacttttgt taatgaaaag actttttacg ataatttatt taacgtagtt
    30121 gcagctatcg atcctgttta ttttaaagct gaaagaatta ccagcctatt tactgtagat
    30181 gttaactcga gagaaatgtt tgacaaaatg aaaatcaaca gtacgtatat atctcaaatt
    30241 atttatgaaa ctttagacat agacatgtac ttattagaaa agcaagtaag ttgccaaatt
    30301 tacaacgaaa acacggttta ctacattaaa gaatacaaca catacaagtt tttatcagaa
    30361 gacgatcctt tagtaataaa caaaggctct ttggtaaaat tgtcgtctat aaacgacata
    30421 aaagaacgaa ttgacttgtt tagtttaaat attttaaaat attacttaga tggtagattg
    30481 gcgtctattg gattagtgct agacgattac gccgtagaca tagtttctaa aatgctgtcg
    30541 catatgaagt gtattgaaaa cgtgtcttgt tttattaaat tcgctgtcga aaaaaacgaa
    30601 tctattatac cagctataat aagaaccata atagcaaact ttaatgtgcc tgtaattgtt
    30661 ttatttagag atttcttaaa acaaaattta catcacgtgg aaacgttttt tgataatact
    30721 aaatatttgc aagaaaacga caaaaagtat attcgtgctg tgatagagca cggtaggtaa
    30781 taaaaatgag cggccgacga atgtgggacg tagatgcagc tgttcaaatt agaaacgatg
    30841 atcagaaaac atttttcact aagggattga gtcctgttat gaaacacacg tatctgtttc
    30901 acaactacgc ttacggctgg attccggaaa ccgctctatg gagcagtcga tttgccgact
    30961 ttagcttgtt ggactactac cccatatcgc tagagtttat aaaaaaaata gagtttatgt
    31021 tatcgcttta taaaggccca gttcctgatt acgagtcaaa gttaaacaca gaattcgtag
    31081 acagaggatc tttttctgga cgatacaatg actttttaaa gagatttgtt atacttccta
    31141 ccggtgagtt tataagtttt ttattgttaa cttctatgcc ggtgtttaat ttactgtttt
    31201 ggtttaaaaa tacgactttt gacattaaaa aacatactct gtttagtgaa gtttacacaa
    31261 ctaacgagcg ccatattgag ctagctagat actttaggaa atccggtgat tacaaaccta
    31321 tctttagtag gctagaccaa gatgctatct acaccaatcc ggtgaccaat atagcaacgg
    31381 taggaaatcc aggaccgtta ggaaacctgt ttccgtctga ttacgagacg ttagctaact
    31441 tgagtacgat actgtatttt accaactatg atcccgtttt aatgttttta atgttttatg
    31501 ttccaggact aagcataaca acaaaaataa ctcctgctgt agagtacttg atgtctaagc
    31561 tttctcttac taaaaaagac atcgtattag tttgaaaaaa aagtataatg gttataaaac
    31621 atatatagac aaaatgctcg gtgaatcgcg cttatacgtc actcttctat ctgaacatgc
    31681 tacggttcct acaaaaggat cagagggttc tgcgggatat gatttatata gcgcctacga
    31741 ctatgtggta gaggcaaaat ctagagcgct agttaaaacc gatattcaaa tttctttacc
    31801 ttcagggtgc tacggacgaa tagctcctag atctggattg gcagttaaac actttatcga
    31861 cgtgggtgcg ggtgttatag attcagacta tagaggaaac gttggaattg tgttgtttaa
    31921 ttttggagaa aaatcataca gtataaaaaa gggcgatagg gtagctcaac taatttgcga
    31981 aaaaatagaa atgccccaaa tagaagtagc taattatcta gattgcacga aaagaggcgc
    32041 taaaggcttt ggatctaccg gaaattaatt tttgttgaaa agtaacttca taaataataa
    32101 tcatctacgc gtaaactagc ggaaggtgta ttaaaaatgg agtcttatta ttattctcct
    32161 ccccgtgacg ggctcgtgta cttagttacc ggaggctgcg ggtttttggg agaacacatt
    32221 gttaaaatgc tattggaaag agaatctagg ctaaaagaac tccgtatact tgacatagaa
    32281 tacaaagact ggcttaacga gctagttttt aagttcaggt ctgttgaaat agttttcatc
    32341 aaggcaagca ttacagacaa tgacattgta cttaatgcaa cagctggtgt tgatttaatt
    32401 attcacacag catgcatagt agacgtgttt ggaaaattct cagatcgtca aattatggaa
    32461 gttaacgtaa cgggtactaa aaatttatta gaagcttgta taacaaatgg tgttggttac
    32521 tttatattta ctagcagtat ggaagcggtt gggccaaaca cagacaggga acctttcata
    32581 ggggacgaag acacagcgta caccgttaaa catccacatg tctactctcg cagcaaggca
    32641 gaagctgaaa aattggtgtt gtcctacaac ggaagagcag tttgcggagg aagatttatg
    32701 actaccgcgg ccatacggcc aactggagtg tacggagaag gagacgctct tacaatgaaa
    32761 agctttcatc aggcaaaaaa actaagaaat aaaatgtaca gaacaatttc acctaccgtt
    32821 gaacactcta gagtctatgt tggaaacgct gcttggatgc acgtgttgtt agctaaacag
    32881 atgccataca aaagcaaaat agtaggaggt caagtgtatt acacatacga caactctcca
    32941 acagggctaa gctatgaaga ctttaacctg ctgtttttca agtttttcgg cgttaaacta
    33001 gtaggtgaaa caaaaccagt aattccacac aacatgttaa aagcattggc atatgttaac
    33061 aaaggtattc aaacttgtct aaagccgttt tgcaaattta cacctatgct aaaccctgct
    33121 actttagcta tagctacaac aacgtttgct gtaaagacta ataaagcaaa cgaacacttt
    33181 gggtacagag cagtttattg ttgggaagct tctcagctta gaaccattaa gtggattttc
    33241 aacactgaat tgttagaagt ttaataaacc aggcaaatac aaatgagtaa tttttatagc
    33301 agtgataaat atagagaata ctgtaatcgt caaaaaatgg cggttaatat tctttcatat
    33361 tatttgatga aaaacaacga tatagaacca tacatgatgt tagttaattt ttataacaga
    33421 tgcaataaca cagaactcaa gttttatgct ttaaagagct ttacaaacgc gttaatattt
    33481 tataaagaat ctaaacaaaa tatattgtca aatagtcaca taaaaacagt taacgagtgg
    33541 caaaaagacg ttaaaaaatt cgagcaagta tgcgacaaag aaatttctaa atattcttgc
    33601 atgagccgtg tacggaagta tttttatatt cgccgtttaa agtgcaaaaa agatacgttg
    33661 tcaaaaatta tattaatgaa aataaagtat aacgagataa acgcgtaaca gatttttaaa
    33721 atggtcaagt acgcgtatac taaaattaaa aatgagcttc tcgatgacga agaaactaaa
    33781 aaattatcat actataaaac ttatataata ttagcttttg tgttagctgt ttttcagaca
    33841 ataacatttt cgtttatcta ctatggctta gtaaaccatt ttaacgaata cagttaccag
    33901 ttgcaaatag acgtagttaa ctgtttagat ggtaaaaaca ccgctctaca ccgttgccaa
    33961 gatatcagaa acagtttgag ttcttacgtt aacaaaaaca acgtccaaat gtttaaagat
    34021 attttaaaat cagtagcaag gtataagaaa tgcaagtata gtaaatttaa cacatctgtt
    34081 gcacacgtaa ccggaaacaa taattggaac gaaagactat atccgaacaa ttacagtttt
    34141 ttaggaaata aaataacatc atggagtaat accagcaaca acgttgttct tagcaatagt
    34201 tactatatag atggagaaat aattgtaaca gtatcaggct tatattacat atacgctcaa
    34261 acttatttta agttaatatt tggatacaat agcaaaggaa acagcaaaaa catacaaatg
    34321 gttcagtata tttataaaaa cacatcttct tacggagatc ctctaatgtt gatgaaaagc
    34381 gctagaagta actgctggga taaaaccgct gagtacggtc tttactcagt atatcaagga
    34441 ggaatacact atctaaaaaa aggagatagt gtgtttgtaa cagttactaa caaaaacttt
    34501 ttagcgatgg actacagaag tgactatttt ggagcgtttt taataaagta atttttatgc
    34561 aaaaataaaa aaaataagca ataaaatatt agtcgtttct attggtaaaa caatggaaaa
    34621 cgttttaata agagacgtta gcgttcttag tgacgatagt ttaacgaagt ttgtacacat
    34681 atgcgcactc aggcttgtcg agaatggttc aaaacaccag tataatgcgc tgtttgtgtt
    34741 tatagaaaat actaaatctg cctcttttaa gcaatatgct gcgagtgctc taatagccgc
    34801 tcttcatatt agattaagag catctaaaaa acacttgcct gtattagaaa aacatagaga
    34861 aatgattaga acttggacgg ctagccgaaa catagtttta gaagaagtta ataaattagt
    34921 taactcgttt aacacaaaaa ctagcgaaga caaacatacc gcctttataa acgctgttag
    34981 atgttacgcc tctggtaata taagcgggta tttagctcta aagcaaatgt atttactgca
    35041 cggtcatata ccggctaaaa atatgctaga agaaatcgct atcttaatga ataatgcata
    35101 attaactata aaaaattggc tttgtcccga acaatttttc aaatagctga gttgacaaaa
    35161 ctttgttatc tagcaaatta actatttctg tagccaatct cttaaaataa atttcataga
    35221 atattctttc accgtctaag gtaaacgatt tgtcaacaat tctttcaaaa gtttttatat
    35281 tagtaagctt cttttgccac ggaagggtct cgggacacac gtaagcaaaa taatatcttt
    35341 ctcctatctc tattgcttct acgttttcag agttgtactt gtttaccaaa gccatgttag
    35401 ggttatcgtt tagtttgtaa ttgcagtgat gcgttctgct aagcaaaaac atttccaaag
    35461 gagactgtcg catttcaaat tctaacatca agtctaactc taaagatttt agagtatcga
    35521 cacacacttg tttgtccgtt aaaataccag cggataacgt atccgacagt tgtgttttgt
    35581 atttttttat catgcatttg tgaaactttg aaacgtctcg tctggtttcg ctagttcctt
    35641 tgttaatcct gactgcggaa tctgcgtttt tagatccggc cgcaattttt aaagtcgaat
    35701 attttttctt agactgcata attaagtttt tgtaaacggc ttcaaactct attctaaagt
    35761 tgtcaaataa cactattgaa tttattattt tttctagttc ttttgcgaca actagagtag
    35821 tttctacgtc tttactatct acttctaaaa atacagaatc tgtatctccg taaacactgt
    35881 taaagttcat tgtaatagaa gggtcaatag atgtagagat ttcttttttg ccgaaccctc
    35941 caaaaaatgg attagttgga ttagatgcta gctctaaaaa cccatctact agctttgctc
    36001 cgtttaatac agagtctaaa tacgttatca tggatctgcc tatagacgtg cagcttttag
    36061 cagacgcgta agaatacaaa acgctacttc tgaaacccat taatccatat actgagttag
    36121 ctattatttt atacatgtac tgcatagagt cataaatttc tttatcggat gagttctctg
    36181 cttcctttaa catttttttg tatttagctc ttttgtctag aaagtttaga agcaacttag
    36241 gaatgattcc tctttgttgc ctgtcaaata tggcaacttc tgaaattaaa tcttccgatc
    36301 taggttcgca ttctactagt atgtagttag gttgaggaaa ctttttctta agctgcttta
    36361 aattaatatc gtactctagc ctgttagagc taacaactac actaactaga gtttccggag
    36421 acaaatttcc gtaaatgcac acgtttggat ataaactatt ataatcaaat atcataacgt
    36481 tatttgtgaa cattttcttt tttggagcaa acactctacc gccttcgtac ggtaactttt
    36541 tttgtttacc ggactttacc aaaaccgttt ttgtctctag cagcagttgc aaaagcggtc
    36601 ctttaatcag agtgctggct ctgtactcaa aagctaaaca ctgaggcaat atatacgtag
    36661 ctgcggctgc gtcaattttt gtttcaatgc cgtaatgttt ccaaagatgt ttacataata
    36721 cggcgtcgtg caaacagtag ttggccatct caatagctgt aactagtgta aagtttttgt
    36781 acatatccga taaacttaca ttgtctttac caaacgataa ctcgtatgtt tcgtttgtaa
    36841 ttggagtaaa tgcgtttttc atgtccaaaa caactttaaa ttcagaagga taaatttctt
    36901 ttcttacaac tttacatacg tggtcgttaa tagtaatata atttccagtt gccaaaacag
    36961 cggaaaacag ctcagctttg ccctttgcat cggtgctgtt gtttccaaca aacatgtaat
    37021 taccgttttt gtcggggcaa gcaactgatt tacagtaaaa tgcatgttta gctattgaat
    37081 ctaatttgta agaatccaac ttttcggtct tttgtatgta agcgtacaaa tcaaaaaaca
    37141 gagtgccgtt gttgttgtta acgtggtatg tagtatttgc cattcctccg gcccctttgt
    37201 gactagctaa atttctctcg tatacacata gtctaacggc ttctgcttta tcaggagttt
    37261 taaataaaat atattcatta gttaatatag ttagcctcgt ggacaaatac ttaatatcaa
    37321 aattgtgacc gttaaacgta actatataat caaatgatag ttctagcaac tttttaacta
    37381 ttcttaataa tgtaatttct gaacataaaa caatatccgc gtcgtagtcc atctcgttta
    37441 ctgtatcaat ttgtagtatg tcaccagcct tgtccaactc ttcttgagac aacaactctt
    37501 tgttaactat tgtaaacttg tactctttgt taaatttatc tatgtagcaa cagcttatgt
    37561 gcgaaacagg attagtaaaa acagaaggaa actttttctc aaactgacat tcgatatcaa
    37621 aatataagta agtttttgaa acgtcgaatc taggtattgg atttttaaaa cacaattcgg
    37681 gattgttgca aaagtaacac ccttttcgta ttaaagttag ataatctgta tttagcctaa
    37741 agcatccatc tggtacgata ttgtttatta agaaaaacca agttatgttt aaaaactcgg
    37801 ccattagctc ttcttttata actagtttac taggatgagc tattaaccac aacgtagaat
    37861 tttctggaac ataatttttt acagctgtgt tagtaataac tctttcatcg atgttaacaa
    37921 tattcatgtc acctaagcac ttgctgtact ttggaactat cgttagttca ttcttagttg
    37981 attctctaac tacgtagtag taattatgct caaacttaat aaacactgaa tcattgtttc
    38041 tatctcgagc ctttaaaaaa agcgctcgat tttctccttt gctttcgaac cagtttaaac
    38101 actttatatc cattttactt acgttaataa aatttcattt aaatggaacc cagattttgg
    38161 ggaagatcta tgtggacggt aatttttatt atattatcac aagctaaagt tcacaaagat
    38221 gtagaacttt gtaaaaaaca tctttacgta atttgtacca ctcttccgtg tgttgtttgt
    38281 agaaaacacg ccactaaagc tattgaaaaa aataatgtaa tgtctagttc tgatctaaac
    38341 tttatttatt atttttttat tagactgttt aataacttag caacggatga aaggtacaaa
    38401 atagacgtaa caaaagtaca acctttagtt taaagactcg tcacgtcaaa cttgttgtta
    38461 catgagtaaa aagtaacgga tacatttttt ctgggaaaca ctgtagccgg aagcgtatct
    38521 gttataacga atacaacaga ctgtacgtca tctgtttcct ttttttccga atcggatacc
    38581 agtagcccgt gattaaaaat ataaaattcg ttgtttacca ttgacgttgt tccgttaacg
    38641 cagtgaaaat aaaatatgtc tttatccttt atagctatat aaaaatctga cttatctacg
    38701 tctatgtatt tgtctaactc atctaaaaag gtattaattg tattctttat ataattaact
    38761 ctagtacact ctccgcacgt aaatgccgga gatgaaaact ttattttacc tgattctgtg
    38821 tccaaaaaaa tattaataat ttccatttat gtcttctaaa accattaaaa caacttttaa
    38881 aaacagatgc aagctatgaa cctggagagc gcatgattca atttctagca tttcggtaac
    38941 aacaatgcta tttactggaa tttcttcatg aggaatgttt agagtgtcca aaacagtgct
    39001 aattactttt gttataaatt ctctagttct tttagtgttt ttgcaaatat gaattctgta
    39061 catgcatatg gcttgcatat attcaattat acaattaaaa aacagtacaa ctgacacgta
    39121 ctctggattg attggagaat agccttttat tatgtcacac aagtaaacat ttgacaactt
    39181 taccaaattg ctggagtcac tgagtccatc agagcatatg tttgcctgtt ccaattgttc
    39241 catagcagtg gcttgtctga atattgatac gttaagagac tttgttcctg cgaataaagt
    39301 aaccaaagga ccccatgccc tagtgtttaa aaagtccaaa tcaacaactc cgtgtctggc
    39361 caaaagtatt aaatcagaca aaatgcttaa caacacagaa tcagtaactg cgcctaccac
    39421 caaattgtct tttattagat tagtgtgaga aagctgaaga accttgctaa ataattttct
    39481 tttagttatt ggattatatg taattataca attaaaacag tcacactctg gaggcattgg
    39541 agtgttggag catctgataa tttcatcata tgtttttttg taagtctgaa gtattctagc
    39601 acctgtgtaa tcaaacaagt ccatgtaaat tattccgcta accattctag agaacgtact
    39661 agttgatgac aaactgtatg ttttccaatt tctaattact ttaatagcca atagcttagt
    39721 ttttagactc accgttgaca tgattatggt ttgacaagct agcggatcca tgcaaaagtc
    39781 agacattaaa ttatctaatt caccttttga aattttgtag tttgcagcgt caacgtattt
    39841 tagaatgtca tccaaaacgg cgttttgaca ctttatgtgg cgaactaaag gatggttgac
    39901 tagcttgtcg ccgcttctca tggttagtgt tcttttactt aaccgctgtg aacggtccct
    39961 aaatctgatt gaaaacctac tagcagctgc gtcatacaac gcgatatgtt gttctacaaa
    40021 acattgttct gaaacagtca atgtgtcaat atttagcgga attttgattc caaacattac
    40081 tattgcccta atcccatatt ttaaaaccaa ctcttctgga acaatagtag aagctataaa
    40141 ctcattcaaa tgtttgttta gttttggaag ctttttgtca attatttcta tgcatccgta
    40201 cacgaacgtc tttgatgctt ttacggtttc acagacgtac ttaattacag gatactcaaa
    40261 gtgttttttg ataaattcta aacattttgc ctcatctttg attttcttta aagtagggtt
    40321 aaccggtgga taggataacc tttcacaaaa gtacaaaagc tgcttttcag atatgttgat
    40381 ttttgaaatt acatttaccc aatcttcttt gtttattaac aaaagagtgg ctaccaattc
    40441 tagagcagtt aattgcatgt aaccgcatgc tagcctagga gaattaataa gcaagaatgt
    40501 agtggtagtg atttgtttct caaggatggc ttttacatct tcaatgtaaa ttaaatcatt
    40561 ggccataagg aattttagag cggattcatc tccgctttca attattgttt ttttgtgata
    40621 catgattgtg ttctcaagtt cttttggaac agtgtcaaaa tactttaaag acgctatgag
    40681 gtcagaaacc tttatagtgt ctaagttaaa aaatctaaca ttgataacag acacacctat
    40741 cgcctcgtcg tacaaatcag aaggaagcat tccatgtaga ctaaagcgca ataacgaact
    40801 aacatgtttc ttcgaaagct tttcaatttt taagtttgca ctgattagct ttttaagagc
    40861 caaacgcgct tctttcgtgt aaagaaacat aatgtcgttg acacaataat ggttttattt
    40921 cagtttttaa aaaaatacta cttgcaccta gaaagtctag ctttaataga cagagccaaa
    40981 acctttgaca tcagagcatc gatgtaagtt gttgaattaa cagtcccgct gtactcttcg
    41041 tttagcggaa ttataaaatt aaacagagaa tatagctcat cagccgctag tttgaatata
    41101 tcatcgtcgt aaatatcagt gtttccatca gttaacgtga tacatagcag ctttagaaca
    41161 tggtcaaatt gaatagttgt gttgttgtac ctaaaccaca gaacgctagt gtacaaaatg
    41221 tactgaagca agtaatgagc ataaattcta accctagcta aatataaatt tgtctttttg
    41281 aacgacattg taatggtagc caattcgtca tctaaagtta tgtaactatc ataacatagc
    41341 ttaattgcat catgacgtat aatgttgatt attgaacaat ccattacgtg ttcgtacaag
    41401 tctgtgtttg tagtgttaaa caatttaaag aatattcctc tttccattaa tgttaaaaga
    41461 tctaataaca gctggtttat agcgttaacc gcagacaatt ttacttgtac tctgtgaaag
    41521 tttagaccga cgaaggcatc ggcttgagaa attatgttga cgtaagagtg accgaattct
    41581 ctccaaacat caaagtactg attgttatgg tttggtgatt cctgaatatt aggtattata
    41641 attttgtaac actcttctga tttgaatctt tttgttggct cgtttccgcc gttaaacgat
    41701 ttagaaaata cttcactaat tattgcccgt cttcttacaa agctaccaac taacacaatt
    41761 gatccgtctg acaaagtaga ctctatgttt ttatcgcttt ggatttccaa gtgcattgtt
    41821 tttgtgatgt ttaacggagt gtttagagac atagatttag ggcaccattt gtaagcctct
    41881 gtgtacataa catgatgtaa atacgtcatt ggaaaccttc ctgcaaatgt atgatttaac
    41941 aatatttctc ttactggttt aaacttgtga gatgtaacaa ctccaaaata acacggatgt
    42001 tcgctaaatt tttcagcata aattctaaat aaatctaatt tgttgtcaga aactaaagcg
    42061 ttaatgtagt gaaaatcaat gcatagtaaa tcttctagct ctatagaatc tataattttt
    42121 tgcaaatgcg gatatgatgc tatgtttgca agttcttcaa cttccataag ctgtattgaa
    42181 aatgtatttg tagctattag tgcttcaaaa atacacggag tagttactga atgaggaata
    42241 actgcataaa tttttctcgc gcatgatctt attagcacag cgcagtgttc ttctgataaa
    42301 ctattttcca ttagctttaa gtatccttct gggttactaa ccgcacacga aaatattttt
    42361 gacggcgcaa gttcagcaag ttgtataact aaagttttta ctaaatcttt tatgtccatt
    42421 agttctagaa catacacatt ttttaatagc atattaatat cgtccattgt tagcatatta
    42481 aaagtttcta gttgacccat ttctataatt tcatcttctg tagctacaca tacatagtat
    42541 gacattccta taatagccct caattctacg tttgtgtaaa aagtagttaa acatgttcta
    42601 attagtggct tagacacgtg cggacacaag ttattaatta taactttgca tactttttca
    42661 gagcagaaag ttttatgatc tacgaatgat gtaaaatcaa tttcaggatt tttcataaaa
    42721 tggaaaacaa tgtcacataa aacatttgga tctttaattt ccaacaaccc gtgattgtac
    42781 gggagaatat tgtatgactt gaataacttt aataaaattt gcgaagggac atatctgtaa
    42841 tttaatgctt cagttaccac tctaaagttg tcgtctaaaa accactctag tttgtcatca
    42901 tgaataaatt ctacagctga aggtattcct tttactagcc aataaggaaa tgttttatga
    42961 tatttactat acccttttcg tatagcttct gttaaaaacg gcttcaaagg gtgagaaaac
    43021 gcgtaagatg cgcaaaagta attgtactct ctctgtttgc atctttcggc atacacagtt
    43081 ttatactttg tagaatgaat ttgaactaat ttaataagca tgtcatggtc aagaattttt
    43141 acacaagatg gaacgtgttt gttcacgtac ggtatacaat cgtcgtgaat tctggtgcag
    43201 tttaatatca tatcaacaac atgatgagcg taaatgtagc ttggatgtac atacaacgca
    43261 ctcaaagtag tgtactcgga taattttatt actaatttca ctacatcaaa atcagaatac
    43321 ttgtgcaatg ttccacataa agtggtttta cacaacgaag atatcgtaag ttcatcgtgt
    43381 gtattaaaac gctgctcgag cgcttcacgt acctctgcgt tcaggacaaa ctccatgttt
    43441 gctataaaaa aaaataatta tcttttcatt aatactttat ttgttttttt tggtttaaaa
    43501 gcagtttctg gaagtattgc taaatatggc attaagtagc taatcgataa ccacgaacaa
    43561 aatacaaaag ctaataaaaa tataacaatt agtaacattt atatctcttt aattacgaaa
    43621 cgttaacgct ttgaatagtt aagcattcaa caaccctgga aacgttaact ttttcattat
    43681 ctttaacaaa aggagcaagt ttttcgtaaa attctggttc aaactttttc atgcatctat
    43741 ccacgttaga agaaattgcg ttaaccaaaa tattatgttt tgtgtaataa aactctccta
    43801 ctttaacaat atcgatgtta agtatggtag cgatacacgg gtctcttaga atgacgtaaa
    43861 ttttaggatc ttcttgcttt gtaactttgt taaagaaatc atacaacctg gtttttgtaa
    43921 tacacccgtc tttaacttgc ggcgctttaa acattctaga ctttataaca gaaattaatt
    43981 ctttgctaat gatgtaaacg ctgtctttga cggagcaaac atcgtctaga ataattgttc
    44041 cgtcaatagc catctgattt attagctctt ctattctttc atgatctatt ttgtatgtaa
    44101 aatcgttaaa acaaatttcg gtagcgggct tttttagcct tcctgccaaa actctgacat
    44161 cgctagtgtc tatgtataaa gacgatgaag gagcaataga atttaaaatt ttaacttcga
    44221 tgtctgtcaa aactagttct ttagctattt ctaggtttag tttaccatct ggcataaaat
    44281 aattattttc taccaaacta ttaataaggc tagttagaac tcctgatttg tattgacaaa
    44341 gtttaaatcg tttaacgaac ttttcattta tcaaatctgt tggaattcta aactcagttc
    44401 ttttagtttg ttgctttttt ttggctaagg gacgtctggt aactagctcg tctacgatat
    44461 cgtttatttt agatgtcaaa tacgccttta gcgttctagc gctaatactg tttaaaacga
    44521 gcttatcttc acaatcagac atcatttaat gttgttgtgt tagttttaaa tacaaaacga
    44581 ctaaactaat aaacaatata ataaaaatta ttacaaaaaa tatccacgac tgtaaagaac
    44641 aaggtttttt tttacacgta tcatcgtcgt ccactattac tgactttaca gcgttgataa
    44701 acttttcaaa atcgtcgtct ggattagaaa tataaactcc aaagatcgct gtatatagtt
    44761 tattcattta ctatacatta aatgaatcgt cgtcgtcttc ttctacattt acatcttcaa
    44821 caacacataa tttacgaaca caatcttcct catcttcctc atcttccgcg ctcattttta
    44881 ttttagcact ctctccgtta atatcaagaa cagttattga gcaatctttt tctaccataa
    44941 tttttttaag agcaaatgtt atctttgttt cgttgcctgt tctgtaaaca accagaggaa
    45001 caagcaacac tttgataatt tgcggatctc gtaaagctaa tgattctagc tcgtcgagta
    45061 tgcatttttg cctagatcgc tcacagctag acgaagacgt atattctacg atagctccgc
    45121 ttagtttgtt aacatatata aaatcttctt ttatagtttt ttcaacgatg ttagttacct
    45181 gtaaagttga tagagatggt ggaattctaa cattttgatc aatgttagta taaatatgtt
    45241 ccagcaactg gtaaagcaac gggctagcgc ttttagggcg aattctcaaa aagaatccac
    45301 agttttgctg tctaaagtta tcgttagact tgtttttgta aatttttcca tcaccttcta
    45361 tcataattaa cggagaagtc aatttagcag atagctcttc tgtaagagtt atattaatat
    45421 ttgaacagct cggatactga gactgtgtaa gagttacata atctatacat tttgtagtcg
    45481 atttagatat agatttggca aaacatacaa cgtccgcagg tgtcatgtcg cgtttttcgt
    45541 taactttctt gttagtttta acagccgaag ctgcagcagc cttagtgccg gtagagcttg
    45601 ttttgcgcat ttttactaat aatatttttt aaaactatat gtttcttttc agttattttt
    45661 taaacagcgc gttcatgtaa ttaacataaa gagcgatagt tccaggaaca aacaaattaa
    45721 cagctaacac ctccataaaa tacataaacc ttgcttttgc aggagaaata aacgacacta
    45781 gccttgttgg cgcaactaac ttaaacaata atacactccc tgatataacc attataagag
    45841 ccaaaaatgt aaccgcaata atagacgcta tatcgtattt gttcatttat atcaagttaa
    45901 atcaaataac ttatattatg tacgtgagcg ctttagtttt aaagtttaaa ggaacaactg
    45961 aaaaatttga ttggggtttg tttctagact tggtagcctt taacgttggt gcgttaaaag
    46021 aagatttagt tattcggtaa gtgtatttat ttctccaaat tacgttttct ttttcaaacg
    46081 ttccttcgaa taccacgtct cttaaaaact tatctttggc aataactaaa ataatgtcta
    46141 gtttttttcc acctatatgg gttataatgt ccatataatt tttatgaacg catcttattt
    46201 ctacattaga tggtaaatct agtatattaa ttattttctt aggtattaac gtgctcgcgt
    46261 ccacagtcgg tgctacgtga taaaggttag acgtgtcaaa ctcgtgttct atttcgcaca
    46321 aagctgttat ttgagcagga atgtttgcca tcccctcttt atttccagaa agagttacgg
    46381 tagaaaactt tcctatctcg tcgttaatta tatgcaccga tgttgatatt cttctaatat
    46441 acgcaacaac atcagccaaa taatctttag aaaaagtata tataatacca caatgaaaat
    46501 cctctactct accaaagaat aaaatagcaa ttgcgtattt tgggtctaag ggataaaaag
    46561 ttataacgga tgttggcgcc gtagcaggcg cttcaactac cggtagtact agttcgctag
    46621 taatatgact aaagctaatt tgatttactg cgtactttga taatatttca cggatttttt
    46681 tttcaacagt aacggcgttt ccttgataca caaatctaat agccgcgtgc gtgctttgtc
    46741 ggtcaccaac cccagctaac catcctattg gtgtaaaata aaagtcagaa atgtacgcgc
    46801 taggtaagtc tctaattgac tttattattt ttttaagtat ttgatgctcg tacttgaagg
    46861 aatttagtat tagcaacgat ttagcaacgt cgtctaacgt gtttgtttgt tttgtaaaga
    46921 ttagttcgtt gttgtagtaa aatgccaaaa agttaaaatt aacagtgcac tgtttcatag
    46981 aaagatttga ctgaaacgtt aacagctttg ttggtttttt aatgttcgaa gcagagtgct
    47041 taacaaactg gttcataatt aactagtaga ctatttatgc gtgatgttat tttttcttct
    47101 aatactttaa tagatttttt tgtccaccgt tccattctaa cgtattcttt aataccttcg
    47161 ctttttgttt tcgtagtttc tatagtttgt tcttgtacgt taaataatat agactttaac
    47221 attgtcattt ttttatctgc caaaaaccta aaaaatgtgt atgtttgtct aagggaccta
    47281 aaactgtcag gtgggtttat tgcgcataaa atcataaata aagagctaaa cattccacac
    47341 tctgattcta atagttggtt tacttcgtaa ttaatacatc ctttttttgc cccaaaacag
    47401 tctacaaaaa atcgcatcat gacgtctacg tcacagttaa tttgttctaa aacagaatgt
    47461 ttcttgttta gattaaatcc gtcagaaaaa gaataaaaat aaaaattttc ataatgataa
    47521 aattgttgag ggttgtttcc tgcagaatcg taaaacgcta ttagtttatt ttctttatcg
    47581 tatatagcgc atttccaatg agaaaaataa caaaatccaa acataacata tcttgttgta
    47641 gcggttgaaa cggcatcttt aatagtgtaa tacatcaagt ctcttctaaa tttttctgtc
    47701 ttttcatata ccggaacttt gttcataaaa ttaaaattaa actggcctag gtacgttact
    47761 tctgacttgt aagcaaaagg agcaactaaa ctagctatgc tcctgttagt catccatgcg
    47821 tcaatctctg gacgaatttg caatttgaca actttaggat taattcctgt atgaatgcct
    47881 atttttgcta aatcgtctac gttaaggttc atttgagaaa aatcaattgc gtgagacact
    47941 ttttctctta gctgaggttt aaaataaaaa gaaagaggaa tttttgacgg taaatttatc
    48001 acgtctttaa aattaggata ctgccgttta agtgctagta caagttcttt ctttttttct
    48061 aattcttcgt ctaaagttgt tgactctgta atgggcttct gaacttctgg tataaccttt
    48121 agtagattgt tttttgctaa agccaaaagc tctcctattg gaatacaaga taccagtcca
    48181 gcgcttttag atttatcaaa cctttctact acgtatccgt tgcagttagt ggcaaatttg
    48241 gacacgtcta aaggagtaca cagtccaact accgaataga tgttataaag taagtttgta
    48301 aagcctaatt caggtatttt gttaataact aaatctgtat atctatccat ttaaccatgc
    48361 aaaatatacc aaatttatac ctttttccaa actgtgtaga tatatttaca cacgagtaca
    48421 gcgacgaaga ttttgacaaa atgagcaagt cagaaaaaga tatgtttaaa tttgcagtat
    48481 ttcctttatt aaaacatcga tggaaatccg cttacgttgt aaaacacaat aacgtaataa
    48541 aactaaataa agaaaacgta acaaaaacaa gcaaagatac aatatggaaa aaggttaaca
    48601 gatcaactct aaaaactatt catgtaacat ccgtagataa gaaaaaaaga atgtttaaaa
    48661 gcgggaaaag tctaattact tacgaatgct acgcgttttt aaaatgtgac attaataaag
    48721 atttaaactc gtttgacgag tatacgcttc gaggattaat ggatgcagga aataaactta
    48781 aaattttttc aaattctgta ggaaatgcaa aaaacactat taacgtacta ggaaacaata
    48841 aacccttttc tgttgttcct ctagcttctc taaaacccgt agcacaaagg gaaatatttt
    48901 ctgcatggat aaacaagcag tatgttatat taacaggggg gaccggagtt ggtaaaactt
    48961 ctcaagtacc aaagcttcta ctatggttta attacttgtt tggtggtttt ttgtcttaca
    49021 gcaaagtaag taattttgaa gaaaagccaa ttgtgctttc gttacctagg atagcgctag
    49081 ttaggatgca cggaaatacg tttttatccg cgttgggatt ttcaacatgg acagggtcac
    49141 caatatcgat aaaatttagc gcaataagcg aagaagaaat aaataaaaat ccaaggccgt
    49201 atggaatggt gatatctaca cacaagttaa ctctttctaa tctttttaac tttagtacta
    49261 taattttgga cgaagtacac gaacacgacc aaataggaga tattgtaata tctgtaacaa
    49321 aaaaaaagtt taaagagcta gactctgtgt ttttaatgac ggcaactcta gaggacgaca
    49381 gggagagatt tacagaattt ttacctaatc ctgtgtttat acacattcct ggagacacgc
    49441 tgtttcctat tagcgacgtt tatatacgaa attctgtaag tataaccgat tatagaaatt
    49501 acactgctca agaactaaaa aatatatcta cggccataaa aaaatataca cctcctgcaa
    49561 aagcgtgtgg gatagttttt gtagccacag tgtcacagtg taaggcgtac ttagattttt
    49621 tagctaaaga attaccctct gttacatttt ttataataca cggaaaaatt attaatatcg
    49681 acgaaataat taacaaaatt tattctaacg aaggagtttc tataattatt tcaactccgt
    49741 atttagaatc cagcgttaca ataaaaaatg caacacatgt ttacgacacg ggaaaagtgt
    49801 tcattcctta tccttttggt ggtaaacaaa gaataatatc gttatctatg agagatcaga
    49861 gaagaggtag agttggtaga actagaccag gaacgtacgt gtatttttat gacaccaagt
    49921 acttaaagcc aataatcaga attgattctg aatttttgca tccttatgtt ttgtacgcaa
    49981 agtattttaa tttaaattta ccagacgatt tgctaataat tcctagcgac ttaacactgc
    50041 ttaacaagac tatagagtac atagatagtt ttaacataag caacgaccaa tggatgaaaa
    50101 taatttctaa ttattatata acaatggttg agtacgctaa gctctacgtt aaaggtaaat
    50161 cactagccat agaaatggac aactttgaac gatttggaat aatgacagac aacgtgttta
    50221 aaaacattat ttctttacaa ctaagggcaa aaataataag ttcacggtat aataatgtta
    50281 cgtatattca caattgcaaa gttatgtttg gacctttttc tggaactatg tttaaagtag
    50341 cttataagcg cgctttaaaa ggatatattt atatgataac cgaaactaca tttgttccag
    50401 aaacagttgt taattgagaa ctatatatac gtttttgtta aggcttgaaa aattttcaac
    50461 ggtgtctttg ttggctagta taatacagta agatgataca tgtgattggt ttattaaaaa
    50521 attatatgct ttttccggat atatactaaa tgcaaaaaca taatacgtgt ttttttcttt
    50581 taattttgta tgatccaaag aatatattaa tccttttcgt ttcatcgtcc acattagtcc
    50641 tgttatgtaa acgctagaaa gattgctgcc ttttaaaatt ccgcacacaa aactagattt
    50701 tgcagttaca gaatacttaa cttttttagg aaaaattatt ttattataat tgccttttgc
    50761 catagaaaac gcagactctc tatgttctaa tatgtcgtct attgacctac cgctaacaaa
    50821 aaaagctaaa aatacaaatt ggtaagtgat tgctggtcta gacttgctat attttataaa
    50881 tgtatctgac tctaaaatag tgttcatgtc gtctgcagaa aaagtgtgtt taaaactaat
    50941 accatcgtgt gttttattga tgttaccgta tctgaatttt ggagtaagag caaaagatac
    51001 gaaactcaaa agttcagaat cgctatagtt tacgtaaact ttgttaacca tacttttttt
    51061 cattaaagaa ataacattag ttttactagc tgtatttgtt gaaggtagcg cgtctaaaac
    51121 aactaattta tgattttgct gatccgagac attaaatatc gatgagctaa aactaggata
    51181 tacaacaatt atatttctat ttactattga cagatgcacg ttttcctcta gcgattttaa
    51241 aattttttct ttgttgtcgt tggtttctaa ccaataatca aaaatatcat gagaaatcca
    51301 tggaaagttt aaatacatat tcattttaaa gtcatcactg tgtgaaaaac ttacatttcc
    51361 aggtatttga aagtttaaag agctatttcc gtgcaaaaaa ctttcgtagt catattcgtt
    51421 aacaaacgaa attagcaaat atagtttttt atttatagtt tcatagtcaa tcaaatgata
    51481 gtattccgtt aaacacaaaa tagcaagaac gttgtttagt gtgttttcta tttcaaccat
    51541 aacagtataa aacggagaag gaatcattgc tattttacct ttttgttcgt ataaagtagg
    51601 aattgatacg taactagggc agtcgggtaa tgttccaaaa gtagatttaa gcaaatctac
    51661 tattttgcag tttatctgct taacaaaaat aactactgac gagccagata gttgtttcat
    51721 tcgtaaagac aatagctgtt tgacttcgtt ttctttttct agcatagata tacgtcctcc
    51781 gttgtacaag tcacctccgt taataaaagt taatatgtcc atgcagtgaa atagttcatt
    51841 gcgaaagtaa tattcgtttt ctagctctct tatataattt tttatattga cagaagaaaa
    51901 atcatttttc aattgccctt tattaaaaaa ccaagatact agctctttga cggattccat
    51961 aggagatccc ctaatcgact tgcaccaaaa gctcataaaa ctcctagccg tagacgcgtt
    52021 tgccacaaac tttgtatgat caaacgaaat taatacgtgt tctaaaagat gcgcaatacc
    52081 taaaatatta tcaatgtctt gagaaaatcc aaaatttgat ataccgacaa atatgtcctt
    52141 tttcatattt tcttggaaaa aaactttaac tccgttagaa aaaacaatca tttactaaga
    52201 agtaaaatag gaaacacggt ttgcctatct gaagaagaat caagattgaa cgtttttgta
    52261 tctttcccaa attttattgt tattttttta ttttgagaat cgtaagtagc gttaactttt
    52321 gcgtatatag gattgttata atcttgaaaa attactgtat ctaatattga tggtaatgaa
    52381 ttatctattt tctggctagc gttttgccaa taattcatat tctttattgt taattgcatt
    52441 ttgtttgagc taccaaacgt catagtatat aataaaataa caaaaattat aaacaaaata
    52501 aagttcaata agcaatatgt catttagaga gctaattttg ttcaatgtat taaagtttat
    52561 aattatgtct gatacaaaat cgttaaaaac gttagcatct ctgtctttag cttttggatc
    52621 agacattgta gaaaaaaact taagtaagtt taataaacgt tattacaagc acattcttca
    52681 gataacacag tgtaccgaat atgttccaat tctagactta gaatttgata gtgacgtaat
    52741 tcgagaaatt attaaactta gattactcag ttttaatcac acaattaagc ctctgtctaa
    52801 gctaaaatta accatgaaag gagtaattac tgttagtcgt aacaaagtat acatttatga
    52861 cgcgaacgat gagcttttag aaatggtaat gaagcagtac aatccaagta tgtacaacta
    52921 tatatcttct aaaaaaccca aagtcattaa agggtcaaac attttagtat gcggatttcc
    52981 aaaaatttca tactttgcgt attcaatttc aaagatatac gtaaacgtgc ctactactgt
    53041 agttgttaca gacacatgca taagtacgct gttaaaagat aaacactgcg atatcttaaa
    53101 aaacatattt aacaacggta gcggagtatt gaacgagtcg tttaaacagt tattttattt
    53161 tttatacgac caatctccgt aagacgcaga ctctataact ttctgcattt ctttatagtt
    53221 taccgcgtct ttatctattt gtgcaacaac tataaactgc ttaaacggca cgtacgcgca
    53281 ctcatttttt tctggagaat attttagaag caacacgtaa tctgttgaaa aatattctgt
    53341 tagttctgta atgagactat aaacgtccat acccaaaacc cttacagctc cttctttgga
    53401 aaaaagtgac attatattaa tacgtaaaac gttgtaatta ccttctatct tctttagcaa
    53461 ctcgctagcg agctcgcaaa taccacaaag aggtttacct ataagaataa gcgtttctgt
    53521 catttatggg tatcaaaaat ttaaaactac tgttggtaaa tcaacatact cttaagcaat
    53581 gtgtggaatt tccaaatgga aagtatcctg gagtgttcgt ggatacaatg agtatattta
    53641 tgactctggc ttacgcgtgc ggttctcagg aagaattaat atgcgcattt gctgaaaaaa
    53701 ttcaatattg gaagtcatta ggtagcgatg ttattttatt tgtcgataaa ggagaaataa
    53761 caataaaaac aaaacttaga gaaaagagaa aaaaggtttt aacggcagct gtagaaaaaa
    53821 aaattaccga tagagattcg atattagaga caataaaatg tttagaaaat aaccaagacg
    53881 agtttgctga tgaaatgcta gcagatgcgc aattaaagtt agaaaaaaag atgtttcata
    53941 tatcactggg ggagtcagtg tttgtaaata acttagtagg aaaaataatt agcatgttag
    54001 gagaagacgt taccgtaaag gtatgcgagg gaatagacgc tgaaatgcaa atgtgtatag
    54061 acgcctatca agttgctgtc gaaacagggc tgtggcctat actagctagc ggcgatcaag
    54121 acgcacttct tttcgctact atcgatgact tacctaaata ctttgataca ctatcttgca
    54181 tttacgagtt tttgccttgt gcgtatagcg cttacatttc taagctagca gttctggcta
    54241 acggatgcga tttctttccg ggactaaaag gaataatgct aactcaaaag tctatagaaa
    54301 acatggaact atttgaaacg tttaatgcag aaaatgcggc tataagtttg gctacgagaa
    54361 acttggtata cacgaaaggt tttgatacat taaaagctcc ttgtgatgaa attgttgatt
    54421 ttattaacag atacgcagcc ggagatataa ctatttatga cgattcgctg ctagaagagt
    54481 gcgatgctag atgttttatt tttacagcgt tgcggaaaaa atggctggag ttttttaaat
    54541 atggagataa tattaaaaaa ttatctatac ctaagcaact cgttttgtta ctggaagaaa
    54601 gagttagaat atcgaaaaat gatattgata ctttagtaaa cattatttat gatgagtcta
    54661 tacggacaga tttggccata agcaacgttg tagaaatatt aggatacgaa gtaaattcag
    54721 attcagagat tccagtaata ggaattagcg aatccttagg catactgctg tatttgagta
    54781 acgatatata tcttaacgaa actcgaatta ttaaaacaac tgacgtaatt aaaattgggt
    54841 aagatggtat ttactttagt gtgttccact tgcggaagag acttatctga agctagatat
    54901 aacttgcttg tcaaaaacat aagcctgcaa gaagttttaa agagttttca acacatgtgt
    54961 tgtcgactaa aaatttcaac acaaattgaa ccgcatagaa atttaactgt attacctctt
    55021 cttgacataa actaaatgac aactgcgtct tatgaattca taaaagcgta tgttcctaga
    55081 ggagcaataa tttttgttaa ctcgtggcac tcgctaaccg agcaatttaa tccgtcaaac
    55141 gacaaacacg cggctattta ctttggagat aagctgtgca cccatttgct aaaaacaaga
    55201 tgtgtaagtt atgataatat ttgcgattct actttgtacg ctatagagtc aacagccgtt
    55261 aaaggtgctc acataatacc tttaaaaaca ctaattacta agtccgatat taaaatatat
    55321 attttagata acttcgactc gccatataaa ataatggaac aggctgcgga taatgctcta
    55381 gaattggtag gtgcaccgta cggattcaac agcaacaatt tgtactgctt caaaatggta
    55441 gcaaattgct tcgaagcagc aggtgtagac gtttctacgt atcgcttatt aggaaaagat
    55501 atttatctta gccagagctt cacaaacgat cctaaatgga aaaaaattta tagctcagaa
    55561 tcaaataata tgtgctctat agtttaaggt cttatgaact gttgctgtct ttgattagtt
    55621 atggcgcacg tttgaacact ttttgcaggt actttggata acgtgtctga tattttttgt
    55681 ggcacagtaa gcgacttaaa cggagagttt atattaaccg taattccttt tgacgcacac
    55741 gctaaagacc tggttttaat agcgttagct aaaactctta tcgcgtacaa atattctaaa
    55801 atagagtact ttgttagctc cgaatccgat aactttataa actcactagt gttttcagca
    55861 tttccaagag ggctcgttac tctaccgttt aaaatttttc cgtcattaaa gtctttagct
    55921 gtgtttagta tttgctgttg ttggttatac agttgagctt gattttgctg tatagataat
    55981 tgaggagacg gcctcctggc tatttgctgt acgggttgtg tctgtagcgc ggtttctaca
    56041 gttgtcgcta aatcctgaac ttcttgaatt tttaaccctg ccataaactc agcttgatta
    56101 atagatgctg caattccttt ttctgctaaa aatttgtaca tgtcgttaat agcgtcgcat
    56161 tttataggca tgtctatcat tttttctacc tctatttgag ttgattcagc aacattatcg
    56221 tgtataggag atccgccaat tacttgaact ggttttccta aaataacagg aaacatttta
    56281 tactgcacca agttaattaa cgcgtacttc atctgtagta gttcaaatag ctctactgat
    56341 aacggttttt gtgtgttaaa caagtaattc tcaactgatt caactatgtc cgctgcataa
    56401 aataactgat tagacaaaat taacgtaatt aacacagata acgtagagtt tacagtatgc
    56461 tgaaacacgt taaaaaaaga gttacaatga gtaaatcgca ttaacgaaca atacagtctg
    56521 tcgaattcat ttagattata aacataagca gaatgcggct ttagtctttt aagaatagtt
    56581 aataacgtca aagtgtcgga aacgctaata tctgcttcta tttttgcgta taatgcgcta
    56641 agtagttggt ctcgtttagc agcgtcgcag ttataaactg acctggctag tttttctaaa
    56701 gaatttggat ttttgataat tcctttagtt actgatctaa caatagaaga agatatagtg
    56761 ctatacaaac aagaagctcg ctgttcgtca atcatttaac tttaaataat ttataaattt
    56821 caaatgagtt taagaattaa actcgataga ctgcggcaaa tagttattta tttttctgaa
    56881 tttagcgaag aggtgtctat aaacgtagat gccgcaaatg gacaaatgta catattcgcc
    56941 gctctaggag gttctgtaaa tatttgggct attatacctc ttagtgccag cgtttactac
    57001 gacggtgttg ataattgcgt gtttaacata cccgtaatta aagttaaggc gtgtttgtgc
    57061 agctttcaca acgacgctat aatatgcata gagcccgata aagaaaataa tctagttaca
    57121 ctaagcagct accatgttgt tagcgtcgac tgtaacaggg aaccaatacc tcacagaaca
    57181 gatacgtgta tttctctaag tatagatcaa aaaaagtctt atgtttttaa ctttcacctg
    57241 tacgaaaaca agtgttgcgg tagaacagta gtgcacttag atctgctttt agggtttata
    57301 aagtgcatta gtcagtacca gtttctcacc gttgggtttt cagataaaaa cttaattcta
    57361 aaaaccccag gaaaaaaaga tacgttttta cgagaatatt ctatgacaga atggtctcca
    57421 gaactagaaa gatttaactt taaaatggca atttcttctc ttaataagct tcgaggcttt
    57481 aaaaagagag tttctatgtt cgaaactaaa attgtcatgg ataaagacga taatattttg
    57541 ggtatgcttt ttagtgacaa aattgcttcg tatagaatta atatatttat ggcgtttcaa
    57601 gactgatata cagagtaata aatatgggag gtggtataac tttgccagaa agaacacctc
    57661 caccacctgt tccaacagga gagtcaaaac taaaagttac agatgtgtta atggctattc
    57721 ctaatcttaa aattggagac tttttgagaa taggaaataa agaaaattct cctaatgtaa
    57781 ccgctatgtt accagagttt gcattacatg acgtcggtat aggtacctta tcagaaatta
    57841 cgagaataaa gtataatgca tcaaaccagt tttgttgctc tagctttaaa aataaatatt
    57901 actggttact tcctgataaa tcaatatcgc taaactacaa agacaatgca gtgttgtaca
    57961 cgtgcgatcc agataccttt gataaaggaa actgcgatat gtttttgttt aacttgtgta
    58021 aaacaacaac tgataatagc gacttgtgtt ctcagtggat agtagaatct tttaaccgtc
    58081 acgaacttcc atctagaatt agcattacta gctttgacaa attaaaaaaa atgttaatcg
    58141 actcgtgttc gaaggacgca accactcaac tctgtaagtc gtggctacag gcactaagaa
    58201 accacagatc tgaagctaat gatttattag tggatcaaat tttgttatcg cagagtgttg
    58261 actttaaaca aaaatacatg aagtgcagct ttcctagcat agagacggaa gaaaaggcgc
    58321 taaaaataaa cgaacctaga gagtgctggg atccggaatg tgcgcaagga gaaattcatt
    58381 atatgctaac aaaaaatttt aacaatctag gcctgtgtca actaactaga tgcaatatta
    58441 gcataaatca actatcgatg gatgataact caaaactaag aatggcgtgt aaaaccaatt
    58501 ccgaaaattt ttcatctgct ccagtaaacc aagcagaagt aatatataaa aacgtacaag
    58561 actcatttag tataaatttt gagttaatga tagtaatgtt tttcttaata atatgcataa
    58621 caattgtaat gttttaaatg ggagcatcag taagcgttca aacagttgta aacactatca
    58681 atgataaaat aagaacaaag ctagaacaac aagcgtctgc atccgcaacc gctgtatgcg
    58741 acgtaacaat aggaagctta ataattagga aaaatttagg atgtagcgtg tctgttagaa
    58801 atttgtgttc tgcacaagca gatgctcaat tagatgctat attaagcgcg gttacagatg
    58861 tatacaacaa ccttagcgac agtcaaaaag cttacgttcc agagctttta acagcttcgt
    58921 taaacattca aactaccgtt aacacagctg ttaaagactt tgaaacttac ttaaagcaaa
    58981 catgcaactc tgacgcgatt atccacaaca aaataaaggt ccaaaatgta gttatggacg
    59041 agtgcgcgtc acctccagga gcaataactc atatagattt taccaacacc ggaaccgcta
    59101 aaggtaactg cggtgttaaa gctgtattag acgtgttaac taaagcgagt acaaaggaat
    59161 cgtcttccca gatagctaat atacctacat attatttaat tattgctatt gttttagtaa
    59221 tatttgcaat gatattctta tactacgcaa aacatatgct agtgacatca actacagaca
    59281 aaattaaact tatactagcg tcaaaaccag acgtccactg gaccacgtat ttagacacgt
    59341 tttatacgta ctctccatct gtgctgtcca acaaacaagt ttaaataaaa ctgaatctat
    59401 ataataacaa ttacgttaaa acgcgtaaat atgatgaatc aagtattaat agctaaatta
    59461 aacaacatag aacgacaact gcaaagagac gagctgttca taaacgccat agagcattac
    59521 attataggaa atatggtaat ggtctctaaa ctactaaagt tactcttaga catcgtgttt
    59581 actatatacg ttattatagg tttattaatt agattcactt acagaaatca gtgggtatta
    59641 gtgtttttaa tattagttat gttgtttacg tggatatctg attatttcca aaaatatttt
    59701 ttgtaattac acagttatgg cagacaattg agatctaaca aacagttcgt tagcaaagta
    59761 aacgtcgttt atgttaaagt cgtcaacttc aaatattaac ccgtctgacg aaaacattat
    59821 tctgatattt tcgttaatgg atacgtttgt aagcgttact ccaacaacaa atgaatcgtc
    59881 tcgagaaacg tataccaacg ttcctgggtc tgttgacttg tttatttgag ttcgtggaga
    59941 attctttttc ttatgcttaa acaaatcatt ttgttgttta gaaaaatagt caaagtggtt
    60001 tcttaaaagc cattcaaaaa aatagtcagt agtgaaatgt ttccagtttc taagcgcgta
    60061 aaacgttttt atgtagttta gataacacga ctgaggaagc tctgctctaa ataacctaga
    60121 tgactttgaa agaattaata aagagtctgt gttggtagaa aatatcattt ggttaataga
    60181 gtaaactata gtagttcttg gtattgtgac aattaaaaat tctaaacaat cagcgtatat
    60241 gtttttttta tacatacagt atagagctac ggctagttga aacagtattg gaactgcaac
    60301 gcagtagtcg tgcggattta gttctgatac tttagaattt ggaaattctt ctaaaaaaat
    60361 tgttcttccg taattgtagc tgctggagcc aataaccaaa ggaaaattaa cagcaaactt
    60421 accaactacg gcggaagata gctctatcca acatgacgct tcttcttcag aaacgtgctt
    60481 tacagaatat gtagaactac tagaattata tatacttagc ggtatttttt tgtaatattc
    60541 acaaattcgg ttatctatat agtctttgta ttcgttatga ataattttgt ttactggctg
    60601 attaaacgca ggctttggat tttgtggtgg tttttcgtag tctacatttt ttggtttatc
    60661 ttttataaaa gaattaggtt gatttttaaa agtatttttt ttacgcgtct taaacgtacg
    60721 caactcattt gtatccattt atctcaaaaa aaacttattt aaatgagttt gattcttgaa
    60781 catatcatcg atgacgacag tgtatttagc ggaggagccg ctataccatg tttagaagac
    60841 atgcccattg ttatcgcagg agctcgtgta aagtttccaa agtcaatgct ttctcttttt
    60901 catattattc ccagaactat gtctagatat aacttggaat tagtaaacac tgaaaacatt
    60961 gttggtggaa catttacaac agcttacaat atacgacgaa atatgggaat aacatctgat
    61021 cctttaacaa taaagttaat agaaaaatat tttttagatt cagctaacga agtcctaact
    61081 ctcatgataa ggaatacttc gttttcaaat cttaaacagt ttaaaaagaa aggaaagaga
    61141 aacaataatc cggttatatt tagaagcggc tcgtcgcctt tgttgctgat aatagagtca
    61201 aaaactaaac aaattagcat ttataaagaa gacactagca agcaaaacga ttcgtatact
    61261 ccggttggtg aaaatgtagc tttagttagc aagtacgcag gtattactct tttagacgta
    61321 catacgccat caaagtttat ggaactaact gcaatttatg gaataaaagg caataacaca
    61381 cttaaaaaac tatccacaga caaagattta aaagagtacc aagagtctcc gctgtctgaa
    61441 cctgttaggt taaatgattt tatcaactta tttgaaagta ttaaacagaa catacctatg
    61501 acgtcggtac ctgtatcgga ttaataaaat aagttgttta aatgtctaca actgttaatt
    61561 tatcgcctgt gtttgtggct cctacttttg agcactctct tttacgagca gataaatata
    61621 tttttatcga attgtttgag tttatcgtag ttgtgttttt agtatatgta ttttttaaag
    61681 acgagatagt gtctatgttt actcctgtaa cgcctataaa tgagttagat aaatataaag
    61741 atacgtattt gacgtgctat ggaaataaat tatatataat tagtgacaat aaacaacttc
    61801 ctgcactgtc gttaaacttt aagcaaatcg agtttgaagg gtgttcaact attttacgaa
    61861 acataaatgg atcacgcaca gtacgtatta gcgatgttct taacagacaa taattctttt
    61921 tattcataca tggctgatca atcagatcaa gacgcgctag aaatcgtatc agaaataaca
    61981 gagtacttga attacttgct aaagctttta ctacagtcca aacaaaaact agaggctata
    62041 ggatactgct atgagcattt agcagaaaac tttaaatctg tagtatgttt tgaagatatg
    62101 cgtatactaa aaagactcgt tgataaaacg cctacatcta aaatagacca aattaagctt
    62161 aacaaagatc atttagctga ctttgttgtt gcgttgcata gacttaaaaa aaatatgcct
    62221 ttagatatac cgctttctgt cactcaggta aacatgtcgc aaaatacttt tttaaataac
    62281 atattagata tacttactga aagcgagaac aaagataata aaactaaaat taaataattt
    62341 acttttaaaa aagaacccta taaatacagc ttacaatgac tgctaaatct ttaaataaac
    62401 cgtttatgta ctatgacgag attgacggag aagaagaata cagcaaaact attgaacagc
    62461 tcgctcctgt taagttttca tctcaagggc aactgaaatt acttttaggt gaactgtttt
    62521 ttctcaataa attacacgtt catggaattt tagacggggc aacgattata tacataggtt
    62581 cttctccagg aactcacatt aagtggttat acgactattt tacacaaata ggtatcgtgt
    62641 tacagtggat attaatagat ggtagaaaac acgatgtaat gttatcaaaa ttaagatacg
    62701 taacgctagt tcacaagttt tgtgacgagg aatatcttag agaacttaaa aggactaaca
    62761 aaaatgcaag aattgttttg atatcggata tacgatctaa aaaatcagga gacgaaccgt
    62821 ctacagaaga tttactaagc gactactctc tccaaaacat gatgctgagt atactaaaac
    62881 cagtggcttc tagtttaaaa tggagatgtc catttccaga tcaatgggta aaggagtttt
    62941 acattcctac cggtcgagag atgcttcaac cgtttgcgcc tccgtactcg gcagagttgc
    63001 gaataattaa tatttatacg tctgataaag cccaactgcg tttaatcaca atagaagacg
    63061 ctaaaatcta tgaaagaaaa atgttttatt ataataatac agtaagaaaa aaagtgatta
    63121 ttaattttga ttatccaaat caagagtacg atttctttct tatgtattat atcttacgaa
    63181 gtgtttactc agataaaaaa ttttctagca caaaagaaaa agtgctgttt ttgcaacaat
    63241 caatatttaa gtttcttaaa atacctttaa cagtaactac taagctaaac aatgaacaaa
    63301 cacaacataa agtacctagc aaaaatcctg tgcctaaagg caaaggtcgc gcacgacccg
    63361 ttcgcgacaa taagtaaaga cgtattatca atgtacgaca ttactactaa ttacggagac
    63421 atagttagta tagtaactgt tgttcacaaa atagacacta aagtaaccgt ttttcaagtg
    63481 tttaatgaag cgtctgtaaa ttattctcca attaacaatg attacggcgt tccaataata
    63541 attacttcct atcttcagcc agagcacaac aaatttccaa taagctttct ttatattgac
    63601 gcagtagctt cagatttatt tccaacattt aagagattaa cacaagaaga gtatacaaca
    63661 gttactagtg ttctcttaac gggaaacaaa aaagaatcgc taaagcttcc aagaatgtta
    63721 gatacagaac tgtctgctaa aattttatat cataaagagt atccagctaa aataattaga
    63781 ttttttagaa gcaatttagt tacgggatta gaaatagcgg acagatcggt tgctaacgtt
    63841 atagaataaa ctatttagat attaatatca ctatcgaaaa tgctataatt ataaaaggta
    63901 gccactgttt tggatcaaaa ataggatata ctatatcctg gttgagatat tttgctgaaa
    63961 atttaactgt tgtatgtgtg tgagatccgc aaacgttaaa aacattcata ttaccttttt
    64021 gtaacgaaac gtgtcctaaa gaaacgctac aatccgatac gttgcatcgt gatatatttt
    64081 ttttaagaaa agcgggtagt aaagcatcag ctcttttgca cggctcgtac cagcagtaat
    64141 aaggtaacct agtttcttta cctattttaa caatactagg gtctgggttt aaacacctac
    64201 atcgtatatc tgtagggtta gcgtcgcagt actcgtatat ttccttgtcg gtctttggat
    64261 ccatttattt atcttgtaca taaaacagaa attaaactta attctattaa tactaaaaat
    64321 atctgaaact aataaaatgg cagtaattgc aaaagtttcg tacagtttgt actcgcaaaa
    64381 tgaaataaac gctactgatg ttttaattag tcatataaaa aatgacgacg aaataggaac
    64441 ggtaaaagat cctagactag gtgctaacga tggagcattg tgtaaaacgt gcaataaaac
    64501 agagctagaa tgtttcggtc attggggaaa agttaggtta tacgaatctc atatagtaaa
    64561 accagagtat ataaacgaag ttgttaggct gttgggtcac atatgcatca gatgcgggct
    64621 aatgagatct agggatcctt atatcgtaga aaacatcgag aagcttgact cgcactctat
    64681 aaaaaagtta aaggacaaag ttttgtcaaa gaaaaaaata tgctggaaca acaaatgcat
    64741 gcaaccgtat caaaaagtta ccttttcaaa gaaaaaaatt tgctttgtta acaaggcaga
    64801 tgatatacct atacctaatg ctctcatata tcaaaaactg acatctatac acagaaagtt
    64861 ttggcctttg ttagacttac agcagtatcc aggaactctg ttttatagag gttcgtttcc
    64921 tgtaccgccg ctaattatta gaccgtctgt taatttttgg gttgatagta ttcccaaaga
    64981 aacaaacgaa ttaacttatt tgctaggtgt tatagttaaa ctgtgtaata acaatgcgga
    65041 agagcacgct attcagaaag ccgttatcga gtacgacaac ataaagataa tagcaaacaa
    65101 ctctactagc attaacttgg cgtacataac atctggaaaa caaaacatga tacggagtta
    65161 catcgtcgct cgtagaaaag accagacggc tagatccgtt attgggcccg atccaaattt
    65221 atcaattaac aacgttggtg ttccaaacta tataagaaac acgttaacag aaaaaatatt
    65281 tgttaacaat tttactattt ctttggttaa ggaacttttt gaaaagaacg aaattaagtt
    65341 ttattacaac aagcaactaa aacaacttac tagaataaag tctggaaagt ttatcagaaa
    65401 caaaattcat ttagttcctg gagactgggt agaggtttct atgagagaga atactagcat
    65461 aatagtaggg cgtcaacctt ctcttcacaa atataacgta atagcgtcat ccgctaaacc
    65521 ggcagatgga tttactatta cgattcctcc aggcattgca aattctcaaa acgccgactt
    65581 tgacggtgac gaagagtgga tgatacttga acaaaatcct aaatctgttg tggaacaaag
    65641 tattttaatg tatccaacaa ctatactaaa acacgacatt cacggtgctc cggtttatgg
    65701 gtctattcaa gacgaaattg tagctgctta ctctctgtac aaagaaaatg acttatcatt
    65761 gtcatccgtt tgtaacatat taggtaagta tagcttatcg ttcacgggaa acaaaaaaac
    65821 atttaccggt aaagatattt ttgagttttt gataaatgaa aaaattagct atccgggaat
    65881 aatagacgat ggtaagttaa taactgacgt tatcgataac aattttgttg tatctatgag
    65941 acagatgtcc tttgctggtc taatttcaga ttacgcatca aacgtggaag gtgctgcttt
    66001 tgtagacaag ttatcttatg ttttaaagag ataccttact cagtacggat ttagcgttac
    66061 tttcagagat ttgcgaccga gtcctacatt tactaaccaa ttgcgcgctt taaatcttaa
    66121 taaaatggag ttaattaaag aatcgtacaa aaactatttg aacgacgtag cggctaaaaa
    66181 aattttacct atgttcgaag ccgacgagtc cgatgctgtt gaaactgttt ttgcgaacct
    66241 aacaaacctc aacataaccg aaattaacac ttatatgcaa gagacgttga agaataaccc
    66301 aaacaataat ttgctaaaaa tggcacaagc gggctacaaa gttaattcta cagaactgat
    66361 gtatatttta ggaacttacg gacaacaaag agttaatgga gaaataccaa aacctagagt
    66421 gttaggaaga atattgcctt ataatttgcc agactctaaa gacccagaag gatttgggta
    66481 cataacaaat tcgctgatgc aaggactaac cggatctcaa tactactacg caatgcttgt
    66541 tgcgaggtcg cagtctaccg atatcgtatg cgaaacttct agaacaggaa cattggctag
    66601 aaaagttatc aaaaagatgg aagacatggt aattgacgga tacggacaag tagtatacgg
    66661 aaacattctc attaagtatg cggcaaatta cactaaaata tctggacaat acggaaagcc
    66721 ggttgaactg ctgtttccta atgaaaacat gacctggtac ttagagatta gtgctttgtg
    66781 gaacagtatt tataaaggtt ttatatactc gcaacggcaa aaactaacta aaaaaattct
    66841 ttctccgttt aactttcagg tatttgtaaa gaaagctaaa gataacgaaa ctgcaatatc
    66901 tgcaaaagaa ttatacgaca tgatccaaaa cgtaatccta aatattaagg aaaattatta
    66961 ctttaacatt acaaacatac agtttataga atacgttttg ctaactcatc taaatccgtc
    67021 tcgcgtaaaa ataactaaac aaacagcaat attaatattt gaaaagctgt acgaaaaact
    67081 taactacacg ttaggcggag gaactcctat aggtataata tcggctcaag ttcttagtga
    67141 aaagtttaca caacaagcat tgtccagttt ccacacaacg gaaaaaagcg gaggagttat
    67201 gcgaaagcta ggttttaacg aatttcataa cctaacaaac ttgagcaaaa ataaggcaga
    67261 aataataact ctaataactg aagacgtgga taagcttaaa actcttaaag ttaactttga
    67321 gtttgtatgc ttaggagaac tattaccaga tatatctgta acaaaagaac cagactacta
    67381 cgttatcagt gtggtaataa acagattata cattaagcga ctaaacttaa cagagttaat
    67441 agtagagcac ataattgaac gatttgtttc ttataacgta atggtaacag aatggggtct
    67501 tgatactata atagaagatg atcaaactat aaagtttaac atttacgcta actttgcaga
    67561 gcctcaagtg cttaacgtta acaagttcat gatagtttta ccaggagccg cgagtaaagg
    67621 aaagattagt aaatttaaaa ttccaattac agagtaccta gcttattacg actttgacag
    67681 tactaaaaaa atgtatagaa ttacagttga actaatgagt ttaaaagagt taggaagctt
    67741 tgatctagaa aacgttaacg ttatacctgg tgtttggaac acgtttgaaa tattcggaat
    67801 tgagtcggta caaaactact tgtgtgagtc tctactgaac acgtacggtg atggttttga
    67861 ctacctttat caagcgtgtg acttgctatc tagtttgttg tgttcaaatt atgaacctga
    67921 atctataaac aagtttaagt tttggtcagt gagtgctctt aaaaaggcta cgtttggaga
    67981 caatagagcg ttgcttaatg ctgctctgca taacaaaaca gaacctgtta acgacaacag
    68041 cagctgtcac ttttttagca aagttccaaa aattggaaca ggatactaca agtactacat
    68101 taacttagac atgctaacta gattagagaa aaaaatatcg gcaaacatag ctactaagaa
    68161 agttgaagaa attgatgaaa ccgctgaaga attttagagc ttatctgtaa cataatattt
    68221 gatgacctgc tttttaaacg aagcattttc taaaaacgca cttctttttt cttttaagct
    68281 gtggtaaacg taaagaaaat acacgaatga tggaacgttc aatggctttt gagacattaa
    68341 gtatgccatt atcatcacgc cgcttctatt aactcctgca acgcaatgaa ccaacactgg
    68401 cattttacgt tcttcgcatt tttgcaaaaa tccagtaaca tcatcaaagt atttagtaac
    68461 gtctgtgaca ttatcgtctt taataggaat gttaaacacc gtaactcctg gaattgtagg
    68521 tgtgtaagta gaagttgtta aatttagagt atatttaaaa tttattccgt acaagtgcat
    68581 gtttaatacg ttattaaagt ttccaagata aatatagttt gttatttttg ttatgttttt
    68641 aggagcttgt acaggaatga cattagttga tttcattaat aggtcttcgt atagtgattt
    68701 tttgtccatt tacacggctt caaatgaccg attatacaac actaactgtg cgtggtttag
    68761 acttaaatta cgtcaataca caagaagtga aaggtattag tgctgttagg acttctactt
    68821 tatgtttttt tacacttatt ttagcagtta gtgcattaat tttatggctt tatgtatcta
    68881 ataatacagt gttagaagag ctttctaggt acgtaagaat taaaaacaca gtaaggggat
    68941 ggaaaccatt agttaatgct aaaagtaatt tagaaagcga tcgtggtcgt caaatatctg
    69001 cggatagacc agaattgttt aaatttcaat gtgtagactt tggtacttat tttttacccg
    69061 tcaggttaaa taaagataat tatttaccag aagcgataca acgcggtacc ggagatgggt
    69121 gggttattca aaaagctgcc aaagttgatt tatcagctca gcaattttgt caatacgtaa
    69181 tacaaaaata ttcgcaaaat acaattactt gcggaaatga aatgatgaaa aaaattggat
    69241 atagcggatt ttttgaagga gaccactggt gcgcgttgta tcataatctt ttaacttaaa
    69301 ttattgctgt aagaagcaac ccagcaataa accacaaaaa cggagatcta acatagaaaa
    69361 ttatcaaaaa agctatataa attaatataa taatatcaac gacgttaaca tcaaacaatc
    69421 ccataataga aaatattggc gtggtagaaa aatatactag ttttggatac cactttgaca
    69481 accaaagacc taacttttgc caaaaacatc cggacatgcc tcctagacgt ttctgaataa
    69541 cgtagtaagg ttcgtgtcgc aaaatttcac tagggttaga aactacatat cttgttaaat
    69601 ttaactcaga ttctattttt gatatttcaa aagacagacc ggcggatgac cctccagtat
    69661 tgataatatt tttataaata ccataaagag cactaagtct aactatataa gctgacaagc
    69721 taaagtctat accccctaca tacccgtaaa taggaggatt ttgtactaaa agagttaagt
    69781 taataggaga aagacctgga gctgtaacag tgtcaccaaa ttgaattata tctatttttt
    69841 ggcttttcat agccataatt agtggtttta aaagttcagg cttcaaaaca gtgttatcat
    69901 cttctacaat tataacaaat tcattttctg gatctggagg aggtggagtt ttttgttgtt
    69961 tagacttatc aatttcgtta acatagtgtt cccacagcga aaagtgttga gttagtctat
    70021 atttagtttc gttagcgcaa agtgctttac acgagtttga gaaaaaatga ggataatctt
    70081 tatcgtgttc tagatcatct ttagtaacgt gccatagagt aacagttatt acatgatctc
    70141 cgctaggact tggtggtgtt ggagttggtt gcggctgtgg ttggggctgc ggctgcggtg
    70201 taggtggatc agctcctaaa gaatttgaac cttcgtttaa acacttaaaa ttatgacctt
    70261 gattgacgtt tttataaatg ttagtagttc tgtcgtctgg cgttgaatcg ccgtcaaaaa
    70321 ggtaagtaag tgtaggaaat acttctgtag cctttctatc tacaattgga ataacaaatg
    70381 cataatactt ttctgggcta ggtggatcgt ctttaagatt tggtctaagt ctctgcgcca
    70441 tttagttatt ataattaatc atatacaact cctttatctt tgcagaattt tcactaatcc
    70501 atttagggac gtccacgtag ctagacaaaa ataagtaaaa tgcgtattct aagtcgtatc
    70561 tgactaatga atcactaaaa taaacaaaaa tatcgctttc tggtagcagt tctctcctaa
    70621 ataagttata accgtttact ttatattgca cgtgctcttt gtcaattaac atgtcgttaa
    70681 aaggaaacgg atcaccaaac ttaaacacca acatttctgt cttcgaaaaa taatatttta
    70741 acacgtttga aacaaataag cttttaattg gtatgataac ttttttcttt tcgatttcta
    70801 tttttaagtg ctctgcaaat atttctaagt ttatagcgtt agtgtcatac attctaatta
    70861 aaactctaga ctctacacct aacaactttt caaattcttc tctgtgttcc ttcgtgtcct
    70921 tagctgtagc cgtaggcttt ataacttgag taggatactc gtctgcttta tcgcttatta
    70981 atctcttgct agctatcatc gttgacttaa aaaacattat agctctaaga gcatcttctt
    71041 ttgcagtgct ttcaacgtca taaaaagcct gtaacgcagt tcgctgaata gattctagtc
    71101 tattgagctc gataactatc cgtgcatagt gagcgtttag ctcgtcgggc ataatagaag
    71161 tgtatacatc ggttaacaaa attatagtgt ctagagatcc tttttctgct gcgttagttt
    71221 tgactaaaaa atcatatatt attacggata tggaatattt taaagattct tctgttacgg
    71281 ttttgttttt gtttttcatg tacgttacta taaaatcagc gctgctgttt aaaattataa
    71341 ctaaagacac gatgtaattt aaatttaaca ccttagacgc gtaaaacaat tcagatgccg
    71401 aaacgtgtat gtcgaataag tttgctgtta atcgcaagaa aaaaactcct tgttttattt
    71461 cgtttacaaa ctttttttcg tactcgtgac gttttgagtt tattgctatt aaaaaattta
    71521 gaattaagcg gtttatgttg tacttcatta tccaagcttg tgatttcata attgtatcaa
    71581 atgacataat aatattaaag atgaatcgct gactgtgtac aaagtagcta tatggctctg
    71641 tcaaaaatat agacttgtta aacgtagaaa ctataacatt agatttaaca acatccgcag
    71701 catctgcgtt aaacatagga acgttcatgc cgcatataga acaatacgca acaccatctt
    71761 cgtagtatat aaactctgta acaaaattgt ttattttaac aaagtaatct acgtcaattt
    71821 ttaatacttc ttctaactta acttggtgcg cgcacggcgt atactcaaaa ctaattccct
    71881 cgttccagtt atctatgttg tctatgtaaa taatatctgt tttagtttta gtcttaaata
    71941 aagtattttg tatatctatc aagtctataa ataggtctct tagatgataa ctggataaaa
    72001 acaaataatg atatattttt ttgtttttta ttttaggcaa tgctagtttc ccccaatcgg
    72061 ctaacgcctt gttgttttct tctgaaaaag agtttttgta aactgtgttt gtgtcttcca
    72121 agtaaacata ctttacgtct aagtaatctt ttattactat aggaacaact atatcgttga
    72181 ccttataaga ataaacgtag cgcacgttaa actttctttt agatatgggt attccaatat
    72241 gtctacaaag ataagcaaat tctaaatatt tttttgaaaa tcgtaactgg tccaaattct
    72301 tagcaagata aggaagtaaa tccttcatac tgaaaggtat ttctctaatt tctgtttcta
    72361 tatttgtatc aaaagacgat acaatattgc tttgtttata gttaacggct acgtcgctgg
    72421 ttgattcgtc gttaactaat atactaacaa atttttgtct gatgtacaag tctaacgtgt
    72481 taaagaataa gtaatatata gcgtaagtca tatcgtcagt aattctttct cctacagaca
    72541 aactaaccgt tacgtcctcc ctaacatttt tttcaaactt gtatcctatg taagaaaata
    72601 tagatattag tgtttgatca tcggtgtttg ggttttgttc tattgtaacg tataatagct
    72661 ttatgtcttc gtccgttacc gacgacacat tgtaaagatt aactacaaat atggatttat
    72721 ttttatcgat aaagtcggtg taagattttg gaccagtgtt aggatctagc aagtattgtt
    72781 ttatctttgg aactatttct gtgagtacag cttctttcga atccatttaa gaataacaac
    72841 tcgtttctgt taaactaata aaaatactcg caaaaatatg aaaaactata cttgacattt
    72901 taaaacgttt caattgaaat catacacaaa gacataaatt attatggcgt ggaccataac
    72961 tccaactgcc ggttcatcgt ttcaaacttt agattctctt agagaacacc taaaagagtc
    73021 agtagaaaat cctcaagatg aagaggaagg accggataac gttgattgtt tgtttccagc
    73081 tgacgaaatc acaaaaccta aacgaaagcc cagagttaca aaaactaaga aacaatcacc
    73141 acctaaatcg gaagaagact ccgcttgttt gaaacctaaa agaactccaa aaatggcatc
    73201 taaagaaatt tcatcctcag atgaggaaga cgattgtgga acgtctccgc agccttcgtg
    73261 tcctagaaac agttttgaaa atatacaaaa tcaagaaaaa gatttttgcg aagaacaaga
    73321 catctcaaca gacgtagacg aatttactga tctgacagta gctgttacag aaattacaaa
    73381 agcccttaaa gcaatcactg taaaggttac agctgtttca tctgttttga gcgatgtaca
    73441 agccgcaagt gttaccagaa cctacacgtc tcttcaaaaa gctgttaata atctgagcga
    73501 tttggctaat tgtgggaaat cgttaactac tagatcaaag cgtaaagcgg ctcctaaaaa
    73561 gcgctaatat aaatgaaagg attatattac aaagataata agcttttttt tgataaagaa
    73621 ctaacgcaaa atgttcctaa ttctaatcct gcgtattctg tgttaaaatc aataaaaatt
    73681 cctgcgcatt taacggacgt agttgtatac gaacagacat tagaagaagc tgtaaacggg
    73741 ttaatgtttg taggattaga ctcaaaaggt agaaaacaat atttttatgg aaaaaatcat
    73801 gtaaaaaaca gaaacgaaaa aagaaataaa atatttataa acgtttattt agtgattaat
    73861 aagataaata actttataga taataattta tctaaaccta ataaagacaa caaagacttt
    73921 aaatcacaat tagcggtgtt tatgttaatg gagactagtt tttttatacg aatgggaaaa
    73981 atgagatact ttaaagacaa cgatacagtg ggactgctta cattaaaaaa caaacatata
    74041 attattagca aaaatactgt taaagtaaag tttgttggta aaaagtgtat agagcatgag
    74101 tttgtaatta gaaaatcaga taggctttac gaacctattt tagctttagt taataaaaaa
    74161 aaaccagatg actttttgtt taacaaacta aacgaaaaaa aagtttatga tttcgtaagt
    74221 caatacaaca tacgagttaa agatttacga acatacggag ttaattatac atttttatat
    74281 aacttttggt caaatgttca atctataaca ccaattccac caataaaaaa attaatatct
    74341 atatctcttt cgcaaacagc cgatacagta ggtcatactc cttctatgtc taaaaacgcg
    74401 tatatggcta atacagtttt agatttagtt aaagataaat ctatatacga aacaataaat
    74461 agcagcacgt ttgatgaatt tttaaaccat gtaattgact atgtaaaaaa tactaatgtt
    74521 gtaaatggat gaaaaaatta aggtgttgtg ttctacgatt tttatcgata aactgtctac
    74581 tacagatttg ttagcgctag aactgtttct taacaagaaa aacatttttt cacaaatgat
    74641 ttgtgttgac gaaaataata gtctagtttt agactttaaa tttgaatcgt acaatgtttc
    74701 agactactta actgtcgagt taacgcaact aactagcaaa gatagaaaaa aacatatttc
    74761 agaaatagcc aaacatctaa ctacagtaaa tgtaatacaa agtaatccag aagattatgt
    74821 taaaaaatct ccaactttaa aaacgttcgt aaaagtatat aaaaataaaa aacgtataga
    74881 taaagcaaaa cgactaatga aaatagcaga agaaaaaggc ataaactgcg catttgttgc
    74941 agatactttg ttgatataaa tgtaaaaaaa acatctagtt gttaatatat taactatgga
    75001 aaaatctaaa gttagcgact ctctctcgtg ttttttacac gctttagtta atgaaataga
    75061 cagtttacca ccacataacc ctaaagaaga taaacatcat gaactagagc ttgtgtttat
    75121 tcatcctccg ttaataactc tttctaacat attaaacata agcacattag tagattcgta
    75181 tgttcaattt acagtaacaa tgtctgaaga taatagcaag atacgaacta gaacaccgat
    75241 gacaaacgtt cacgggttag atattaaaaa caatcagttg gttgacaata ttcaaagaat
    75301 tgtttgggaa aaaaaatctt taatatcaca aaaagaattt tgttataaag aatgtatttt
    75361 acggcacgct actgaagaaa actacgtatt tgtagacttt agaaaattta actcgtctat
    75421 aaaaatagaa ctcgttaatc gggttcgcgc aaaactaaaa aatgttatgg ctgagtttaa
    75481 gattaagtac tttttggggt ccgggtctca atcaaagagc tccatgttgc acgcactaaa
    75541 ccacccaaag tcaaaaccaa acacaacttt agaaatcgaa attttgtcta ctgaagacga
    75601 gcgaccatcc aaagaagagt tacgagatga agtttttaaa ctttcaaagc tattgtttat
    75661 gggtcatcct gacaatatat tcttttacta tcaaagccct aaaatgtatc caaaaacaat
    75721 aatgctaaaa aaacaagaac tgttaacttt acaattagaa aatttataca ttgtaggtaa
    75781 aacagacggt gttacaacac acgtattggt tgaccaatct ggaattttgt gctactttaa
    75841 acacttgggc tacgcgatta aatacaaatg caataaaaag ttaactggtg ttattgagct
    75901 agtttgtgaa gcagtaaaaa accaatctaa taacacttgg actctatatg ttataaaagt
    75961 tataaagcca tctatgaacg acagattatc agaacttgag tttgttaacg aagaactaaa
    76021 aaatatatgc gatcgtatca cgtttaaaac aaaaaagttt aacggtcctt ttactacaca
    76081 cactgagtta atagagtcgc tgtctaagat gatggaggac caacctgagg gtgtaatagt
    76141 attttattct aaaggtccaa aatctacact agattataaa ataaaaaagg ataacactat
    76201 tgatttattt ttaaacatta catacagata catgtctagc gagcctgtga tatttggaga
    76261 aaataattta tttttggaat acaaaaaatt tgcaaacgac aaaggttttc ccaaggactt
    76321 tggaacaggc aagttgataa tttccgattc cgtaaaatat ttaaacaact tgtactgtat
    76381 atcttttcat aatatgttta acgacgtagg tataaaaaca gttactgtac caattaagtt
    76441 tgttggagaa ttttcataca acggcgagtt tattaaacct agactagata aaacaatgca
    76501 attttttaca gacttgggtt actacggaaa ccaatacaac gtcgtcatga ctcatataaa
    76561 tgaccaagaa ctcaaaataa acgaaatatt tgatacggat aaactagcgg acgtaggaaa
    76621 gcggtctcag tttgatgaca cctcaaggct aaatcaagat actgcttact ttacaaaaaa
    76681 gagaactcgt ggtccattgg gaatattaac aaactttgta aaaacattat taatatctct
    76741 atactgttct aaaactttta tggataacac agctaggcga aaagtactag ctatagattt
    76801 tggaaatggc gcagatttgg aaaagtactt ttttggagaa atttctttaa tggttgctac
    76861 tgatcccgac gctagagcta tagaaacagg aatggaaaga tacaataaac taaacgctgg
    76921 agttaagtca aaatattaca aatttaacta catacaagaa acgattagat ctagctcgtt
    76981 tgtctctagt gttagagaag tgttttattt tggaaaattt gatttggtag actggcaact
    77041 ggctatacat tattcgtttc acccaaaaca ctattcaact attatgaaaa acttatcgga
    77101 gctaacggcg tctagaggta ccgttctcat aactacaatg gacggtgatt ttttagaaac
    77161 attaacagaa aaaaagactt ttgttattca taaagacttg cctccgagtg aaaactttat
    77221 gtctttagaa aaaatcgacg attctaaggt actcgcttac agtccagcta caatgtctaa
    77281 acccatggtt gaatacattg ttaaaaaaaa tacaatcact agagtgttta gtgagtacgg
    77341 ttttgaatta atagactatg taagctttta tgatgttata aagcgcagta aagattttat
    77401 tactggagtt tcaaagttgg aaaaaagaca atctaccaaa aacttttttg agctaaacag
    77461 aagtgttgtg cattctctag atagcttaga cgtcgaagat ctgttacgat attacgttgt
    77521 gtatgttttt tctaagcggt aagtaatatg atatgtttaa gctatcgtca aatgttctaa
    77581 acgagttaaa caagtttatt aaaactcgtt ttatgtattc tggacttaat gtttccaact
    77641 catttgtttt actatctctt atatgaaaag ttttctttgg tattaaaaag ggtatagagt
    77701 ctaaaaactc actattagga aatatagcgg ctaatgcagt aatattattt ctaaaaacat
    77761 atttagctat tttatatatg ctatagtttt caaatcttgc tattgaatca tatatataga
    77821 taatatttgg taaaccgtct tctcctctat caataactat aaaatcattg atttttgttt
    77881 cgatggacat ttatacagtt aaagataatt tatatcctga tagcattagt aacaaatgct
    77941 acgttctatt aggaaatcat gatattttta taaaaaaatc actaaactct ttatcagata
    78001 ttgttatgtt ttctaaattt gaaataagcg ccagatctcc gtgtgatttt ttagctaata
    78061 tagtacattc tagcgctgtt ttaaataata gattcttatc gcctgttgag tttttagaag
    78121 ctagttgtcc tgcattttgt agtaacgtgt ctgttgatga tttagaaaaa catattagct
    78181 gcaataacac aacaataagc gtttatgtaa ctgtatttaa agacgtttac aaaaactgga
    78241 aaagcgtcgt gtttgttcaa tgtcctagcg aaattagtgt tcctaataac ataacaataa
    78301 ataatattaa aatatcaaac ttagacataa ttttatctaa cccgtattta gcttttacgt
    78361 catctctaga cagcgacaca aatcaacgtc tttttaataa cttagttttg cgcgcaagcg
    78421 ttaacgagat gataatatac aataacaagt caaaattagt tagtttttta aaaaaaataa
    78481 tacctaactc tttcgatgtc aattttatcg ctttagttaa tgaatccgat acgtcaaatg
    78541 taaagctagc gcttttaaac aacaacagta acgctctaaa agcttttact cacgcgtggt
    78601 tttctggtca gttatcagca aacgatgaag aaaacataaa aataacaaac acgtataaat
    78661 cagtaattac gttgttttaa ttaacaatga gagtaataga attaacggta agcccttata
    78721 aattggagta ccatgaggat tgggaaccaa taatagaaca attagtagac ggttacacag
    78781 aaatagctcc gtggatacta cagcatgaaa cttctccacc accagacaag ttctttgttc
    78841 aactaaagga gcctttgcga aacaagcgat tgtgtgtgtg cggaattgat ccgtatccaa
    78901 caggggctac cggtgttccc tttgaatctc cttcattcgt taaaaaaact attattgcct
    78961 ttgcggaagc cgcgtcaaaa gcaacaaagg taacgtccta ctctgggtac aacgtagctc
    79021 aaatacctgg agttttagct tggaattatt accttagctg tagagtagga gaaacaaaga
    79081 gtcacgctat tcactgggaa aaaatatcaa aacttttact tcagcatatt actaaataca
    79141 ttagtgtatt gtactgccta gggcgtacag atttttcaaa tttaaaggct agactaaata
    79201 aacccataac cattgtttct ggatatcacc ccgctgctag aaatggtcag tttttaaaag
    79261 aaagagcatt agaaatagtc aacgtattgc tagagctaaa caatcacgag cccgtagatt
    79321 gggcaaaggg atttttatat aattaaaatt ttaatgaaat tttaattggg gggtctaaat
    79381 ggcaactcaa gttgaaaata acattatttt cgtattaaaa aaattagccg taactaagtc
    79441 atgtcgagaa tcagaagacg aacgatacgt agaagcattc acgtgcgaag aattagaagc
    79501 ctatataaaa cagcatccga catgcagctt attcgaaaca ttaagaaatg aagaagaatt
    79561 ttcggtagta agattatttt tagacattga tgtaagttat ccaatggacg agcaagaata
    79621 tgtattggca ctaaaagaac taattacagc gtatactaag tttgtgacta gttttgtgtc
    79681 ggtacattgc tctgtcaaaa atacagacaa aattaaaaag tgtatgatga caaacttttc
    79741 aataacactg tcaaacgata ccgacaagac aagctcgcat attatatttt tagatgtata
    79801 cacaacaatg gatactctaa tcgcgatgaa gaaaccgttg ttaaagttta taaagtcatc
    79861 tgaaaatcca ctaattagat ctatagaccc tgcgatatac cgcaaaagca caacattaag
    79921 agttgtcgat actagaaaaa caaaaaccaa taactatgta catcaaagaa ggccgccgca
    79981 tacgaaaata tcagattatt tatttacgta tgttgaaatg tctgagaaga catgctactt
    80041 tactatcgat gcagaaaaaa cagataacgc agcgatagag aaaatttggg aacctaattt
    80101 tatatctttt agcgacgcaa tgaaacgcgt taaaaaagct atagtaaacg aaattgttaa
    80161 cattgatgaa attacagata gcaactttgt atctgttccg ttaataatag attatgtttc
    80221 tccgtgtgct atttgtaaaa agaaatcaca taagcacact catcatcttt ctgtgagaga
    80281 cgacacgctt agaatatata aatctggaaa tccgtatagt tgtaaagtaa aagttatttc
    80341 tttagaagga aacaggctgt tttctgcagc gcaacacatt tttaacgcta acgttgttca
    80401 gatgaacgaa cgaggagacc acatagtgtg gcttaaaaac tcttggaggt acaacgacga
    80461 atcactatta acaaaattaa ttctcagcat gagggataac ttgttagaat ataatataga
    80521 tattttgtgt ccacgtaaaa gaaaaataat agagagtaat ctaagagaca tgatcgtgga
    80581 cactgtagaa acagatctct attttgataa actgccgttt aataacggag tattagatat
    80641 tgcaacaaac aagttttaca caggagaaca agctaaacca tttatgtgca ccgtttccac
    80701 ggggtataat tttaaagaag atgtaattaa gtgcactgat caagtaaaag aggtgcaaaa
    80761 agaactatat agtattatag acgacattca acccaaaacg gcagaaaatt tagaaaacag
    80821 agaaatttac gaacgtgttt tgtcaagctg tttatgcggt atgactaaac aatgtttagt
    80881 tttcttttac ggagaaacag caactggaaa gtcaaccact aagaaacttt taaaatcagt
    80941 ggttggatcc atgtttgtag aaactggaca aactatttta acagacgtaa tggataaagg
    81001 acctaatccg tttgtggcca gtatgcattt aaagagagca gtgttctgta gcgaacttcc
    81061 agactttgca tgcaacggcg ctaaacgaat tagagctgat aatattaaaa agcttacaga
    81121 gccgtgcata gtaggaaggt tatgcttctc taataagatt aataacaaaa atcatgctac
    81181 aattattata gacactaatt ataaacctgt gtttgacagg gtagataacg ctctaatgag
    81241 aagaattata ctagtaaaat ttagaacaca tttctcaact gttgctggaa gaaaagcagc
    81301 agaaaataat tcttcgtatg acaaagttaa acttctcgac gaggaactag agacaaaaat
    81361 tcatcaaaat tattttagaa ccgcgttctt aaatatacta attggttggt atcaaaagta
    81421 tcactgtccc atacttaagt tagagccaac accacacgcg gtacctgact ttgcgtttca
    81481 tattaaggtt aattcgttaa taatagcaag tgcaatgtcg catatggtgc atattgaaca
    81541 ctttgcaaaa ttaggttata gtatattaga cggagaaatt ggattaaccg cgtcattgtt
    81601 ccagcagcgg ctaggaaaac actttaatag caaaattagt attcatgata ttgaaagttt
    81661 tgttaataga aataaaaagt ttaacagcat aggtgaagaa tacgttgctt ttatatttat
    81721 cgaagacttg ccaaataaat gaacgcaaac atagtaaaac tgtttaaaaa tcatgttgac
    81781 aacataccta gtatactacc tcatcagcta ggtacgttgg attttttagt acgcacagtt
    81841 ttggaaaaca acaatagtgt gctgctgttt cacattatgg gttctggaaa gacaatcata
    81901 gcgttgttgt ttgctttggt ggcttcgaga actaaaaaag tttacatttt agttcctaac
    81961 ataaacatta tgaagatctt tacgtacagt ttggacatcg ctataaactt gtttagcgac
    82021 gaatttattt tagaaaacat tttcatctac tcgactacaa atttttattc tctaaactgt
    82081 acggataacg taataaacta taacggatta acaaggtacg aaaactcaat ttttattata
    82141 gatgaagctc acaatatttt tggaaacaac accggagact tgatgactgt gataaaaaac
    82201 aagagccaag ttcctttttt acttcttact gcatcaccga taactaatac accaataact
    82261 ttatctaaca taattagttt aatgtctaac gaagaaatag actttggaga tatagtaatt
    82321 cagggtagga aagtatttca aattttgtta aacgagagag gtgtagaaat tcttagaaag
    82381 gttctcaaag gcagaatttc ttattatgaa atgccagaca ccgacatgcc ggaagtaatt
    82441 taccacggaa aaaaattttt agatactagg gtagtctact gtcacatgtc gagtttacaa
    82501 gaaaaagact acattaacgt tagaaaactg tgtaataatg aaatgtttga aaaaaatatg
    82561 aacaacgttt ccttagcagt tttaggtcct ctaaacttta taaataactt agacgtttta
    82621 tttcaggtac aagataaaga cctataccca aatttaaaaa tcaataacgg tgtattgtac
    82681 ggagacgagc taattaatct taacataagt tctaagttta aatattttat ttcaaaagtt
    82741 ccttcgttgt ccggtaaaca ctttatatat ttttctaatt ctacttatgg aggtgtggtt
    82801 ataaaatata tcatgttgag caacggttac gtagaatata caggtttaga accttcttct
    82861 agaagcggaa acaaaaaaac atttgcgatt gtaacaagta aaatgaaatc gtcgctagaa
    82921 cagcttttgg aactttttaa ttctccatct aacaacgacg ggagtcaaat aatgttttta
    82981 ttttcgtcta acataatggc ggagtcgtac actctgaaag aagttagaaa tatttggttt
    83041 atgacaatac cagatacgtt ttctcagtat aatcaaattt tgggtagggc gcttagaaag
    83101 ttttcgtaca acgacgtgtc aaagccagtt aacgtatttt tgttagcagc tgtatactcg
    83161 gactttaaca tgaatataga tactttagac gattttaact tagacgaaat aaacatgctt
    83221 ccgtttgata taaaaaagtt attatatttg aaatttaaaa ctaaagaaac taacagaata
    83281 tactctatac taaaagatat atcaaagtca tacagcgctc cacctcacga atctataacc
    83341 aatattgtgt tgggtgaaat agttagacaa tttttttatc acaaaacaag agtttcgtat
    83401 tctgattcta aattacggtc tataataaaa gaagttgtag acgatggaaa cagtgtcagt
    83461 aactacatag atgacatttc tactaaacat ttttttgtaa ctaacaaagt ctttaataaa
    83521 gcattattgt ataaatataa aaaagatata attactgttc cttttaagat atcacacgag
    83581 ccatttacat gggctttgaa ttttagaaaa gaacagagta taatagaata aaactgaaca
    83641 aacataattt tctgttgatg taaaacatgt caacctttgt aagacaaatg tatttgccca
    83701 tcatgatgga tccgcatgaa ttaacatttg aagtgtggga gaatataaaa agaatagtga
    83761 tggacactta tcttcacaaa gaaacaagtg gtattatggc aattaacatt actgtttaca
    83821 aagacaaaga acttccgtta ggtgagctaa taaacaacca aataatggtt caagttccct
    83881 gcaacgtagt gtttaagtat tacaaaatgg gagatattgt aagcggaact ctgtcaataa
    83941 cagacgagaa cgatgttcaa gtactatgca gcgatttaac ctgtgtttta gctagaggag
    84001 caggaactgt atctttcagt gactcaaaat attgctttgt aaaaaatgga gttgtttatc
    84061 caaacggaag caccgtaact gcagtattaa aagaggctag gtctagcaaa aactctaatt
    84121 ttgaattttt agctgcatta gttgatcctc caaaagaaga agacgacgaa ttagcgagtt
    84181 caaagtgaaa atgtacacgc gtaagtacac acaactatgg aagagtgttc tattacgttt
    84241 gagacagaaa gagaaaaagt aattttaact cctactccta aacctacaag tatatcagga
    84301 gtgagagttt ttgcaatatg tgtaaccact gataacgtgc ctatcgttgc tcagagacgt
    84361 acgtcttttg tgtttcagca cattgtatct acttcatcaa aaaaaaatac aacaaaggta
    84421 tcaaaacacc tgttacagta catgtacgaa aacgaggtac gagaactcgc gtgtcgctct
    84481 tctgttcgta aaattgaatg ggacaataac ttttgtgaac taattatgat aggaggaaaa
    84541 gctaataaat cagagtccgt aaattcttgc ttacgtagag agatacgtga agagagcgac
    84601 agtacagttt ctgttaagtc aataagtgat aaattttttc acgttagtat atatgataaa
    84661 ctaatacaaa aatgttttga atgttactgc acactttgct acattaatca gtctttagaa
    84721 gacatcactt ctacgagaat ttttaatata gaagtaagaa gtttatgtcc tctgtactct
    84781 tataaaaata acgataaatt tgaatacctt aactttatct ataaaagcct tagctaaact
    84841 aaatacaatg agttctgtaa agcctagatc ggtgctgtcc acaatttcta aaacaaatag
    84901 acgcttagca agaacgtata atttttctga cgatgagcaa cggttgcgtg ttacgggttt
    84961 tgttaacaac aagatgtata acagcaagct agtgtcggta tgcgcgattt tatcgacttt
    85021 agatggaaaa tatttagctt gtttgagaag aaacagtttt ttgtacagcg aaatacgaaa
    85081 atctaaaagt agaaaacgca atattaattt gctaacaaaa tattcaaaat ttcttcgccc
    85141 cggagaatta aaggaactaa agacgcttca cagcataaat aaaacttttg tagatggtaa
    85201 caataaagga aacgttattt ttccaggcgg atctccaaaa agaggagaaa acgcagtaaa
    85261 gtgcatatct agagaattaa aagaagaaac aaacatcgac agtaaacatg tttctttaga
    85321 tactaggttt tttgtttatg taaacatcga cgacttgctt acaggaaaag aatacgatgc
    85381 tatattcttt ttaggaactg taaacttaac cagtgacgag atcgttgaca actttttctc
    85441 aaatgacgaa gtagtaacgc tgctgttttt gtcgccgtac ggtcaaggaa tagcgtgcga
    85501 cattatacgg tacgcgctgt ctatacaaca gctagactgt tggggaacga gaggatacaa
    85561 aaactcatat ttatcttaga ttaggaaata tgtaaactag tttattgttg tttattttta
    85621 ttatcggatc agcgggcatg tttagcaaaa atattccgtc tttatcatat acttttccat
    85681 cgctagtctt aaagccgtta tagatagtta tcatcgccgt agatctagcg taccaaatgt
    85741 tttctccatt aactgtttta ttaacgtttt ctgttgttgt aactaacata ggtctagata
    85801 ttaaagattg ccacgctgat tcgtcgttga tgggagaaaa tgctgtataa tgttcataaa
    85861 tccactcaat agaggtttgt ttataaacgc taaatagttg tgaaaattct ctagttttgt
    85921 tttgtataac ctctagcaag tcttcgtcaa cagtaggagc tccagaagac agtctagcga
    85981 ttacaaagta tacgtttacg tatcttctat ctggggcgtt taacgcgtgg ctgtttaacc
    86041 taatggctct tccaacaatt tgacgcaacg acgcctcgtt ccatgttata tctaaaataa
    86101 aaatatcatt aatggaataa aaacttaatc cttcgccccc actaagagaa aaaacacaca
    86161 ctttaataat atttccatta gtattatctt ctgagttaaa atcatttact agttgatttc
    86221 taacatcttt ggttcttgac gaaaattcga tactagttat gttaaatatc gaaaaatact
    86281 ttagtaaaat ttttatgcct gaaagattaa cgaaaggttc aaacactaaa cattttcctt
    86341 ttgaagctaa tattctaaca caaacttctg tgtacttaca actcctttct ctcaattctg
    86401 tgtacagtga cacgtcgcta gcagacgctg tattgtctag atagtttccg tttttaaaag
    86461 cattaattgc tgcttctgaa aatctttttc cttgtataga cttttcaaag tctttaacca
    86521 acgcacttac gatgctttcg tactcatcaa ttgttttatc ttttttatca gggaattcgt
    86581 caaatgcaaa catagcagcc attctcctgt gaattttaaa cacggctgtt ttagacttaa
    86641 tttccgcgat cttagcccgt tgatacaccg cttcttgttt tggagacatg ttaacataca
    86701 gcatcttaac agtttttttg gcaaaagtag aagatccttc aacgttttcg aaaatggatg
    86761 cttcgttgta aactaaataa gaacacatac atcctagctt gttaattaac tcatcttttc
    86821 caactaagta accttgctca aaaagcggaa caggctgtaa aacgttaggg cgtaacaagt
    86881 taactaacat tgtaaactcg cgtgatgaat ttactatagg cgtagcggat aagcataata
    86941 gcttatgatt atgttgaggg atatttttta acaaaaaatt atacactctc tttgtaggac
    87001 gtatttttcc attttcctta gacaaagaca tagatataaa gttgtgacat tcgtcgataa
    87061 ctacacaaac tctagttcta gaactaatag ttttaataac agtaaaaaat ttattgtgaa
    87121 aattatgatc gtcgtagtta ataaaaatac aatcgtttac aatttctggc gcaaatttta
    87181 gtattgtggt tctccacggt tcgtcgatga gcgccttttt taccaaaaca attatggtcc
    87241 aagttgtgta tatgtcttta aggtgtttta atatatacac cgacgtaatg gttttaccaa
    87301 ctccagtttc gtggaaaagc agtaacgagt gcattttatc caaacctaaa aaaactctcg
    87361 ctacaaacat ctgatagtct ttaagcttta ccgtgctatc tacactagcc atttcagaag
    87421 gcatgtcttt tgtacggcga agtgcataat ctatatacga cgcgtacgca ctcatttgga
    87481 gtataaaagt taatattaac tagtttagtt ttaaacgctg cgtgataaca attacattaa
    87541 cagctttact agtttacgct ggctatcgtt ttccaaactc ttagaatccg aagtcatgct
    87601 ctcgaacagc aaagaatgcg ccacgtataa agctttgtaa acctttgttg aaaaatttaa
    87661 aaatatgtct ataaactctc catctaccgg atcttttaaa atcataaacg gtacattgtt
    87721 ggactctttc cacgtagacg actttgttac gtttttaaaa tgagttaaaa cagtatgaat
    87781 attttttacg tgtggatctt cacacactat tacaaagcta tcctttaacc aactgtcgtt
    87841 ggcacactta aataacctta cagttttaaa caagctgcag tacactcgca ttgcatcaac
    87901 tatagttctt ccaaacattg taggaagttt aataataacg tatttttcag acgtatagtc
    87961 aaacaacggt ctaaacaatt caaaggtaat tagtttataa tcgcttatgt ataaattatt
    88021 ttctgttaaa aagttgtttg attttatcaa tccacggtct cgtttataaa gtttattttt
    88081 agcactcatg tcaacaacta tagcttctgc cttaattcct ttactgtgag ttttaactga
    88141 ttttatttta agagttttac aaatttgatc aatgtccgtt tctggaatca tgacgtcgtg
    88201 tgtaaataga cttaatagtt ctgtaggtag cctattaaga tcgtttactt tagacaactg
    88261 taaaaaataa tttgttccat attgcaaaga cggtaactgc ataacaccta acgtaagatg
    88321 tatatttggt aagttttcgt aaaaaggcat tcgtgcgcta acaccatctc gtatttgagc
    88381 tttcacactc tcgatggtgt ccatttagaa atgattgtct tctttcatta ttgatgatcg
    88441 ctggttactt ttattgctag aataccattg tcgttggtta acttgtatag atctgaactt
    88501 ataacgacta gttgctttgg aacataataa attggattat tctgatctag attggcataa
    88561 ataacacgaa tcattagctt gtcttttcct ctagatgtgt tagagttaag tgttgtgggc
    88621 ttaaagaaag tatgcggagt aaagttaaag ataagagtac gtacgctttt aggtcttccg
    88681 aaaagttctc cgtaaacttt tgaaataggc gatgtttcag aatatagtac atcatttcca
    88741 aaccttacgt ccaatcttga aattacgtca attttatttt taaaatcaat tccttttatg
    88801 aaaggatcat taacgaataa atctttagac tttgacgact ctgatctgtt gtccccgttg
    88861 tacacgtttc gctgacacga ccaaagacta acgggaatag aagcgtcaga aatattaatg
    88921 ctgtgtgaaa cgctagtaaa tataattctg ttggttgcca cactgtagta accggcaatt
    88981 acagaaaact ttttagatag gttgtacacg attgaatttt ttctagttcc aaaaactagc
    89041 aagtttgaat gaaaatatac attcatatcg tctggtacgt tgtctatctt cacaagaact
    89101 tctacgtctt gaagatacac aattccgtta tccggaactt ctacaatgtc cgcagaagga
    89161 ggaaactttc cgcaaggaac ttgatcacta acaataacca tgtcttctag caacctctca
    89221 acaaacgcac acacataatc tttttctgtt tgagcatacc ctggatacga tataaatcta
    89281 ttatctgctg tgctatagca aggtttaacg tatacagata caaatgttgt agcgtgaacg
    89341 tctgtaatag ctgcagttga ttgattaatt tgactaattt gttttctcgt catctctata
    89401 aaagtgggtt tcagttgaac gtttctaacc atgtatccta taaaacttag ctctgttacg
    89461 taaacaaagc ttttaacaaa agcctcaacg tcaaacgtag aatcgtaaac aataacttca
    89521 gatattgagt gaaacgttac agttactgta atttttgaat ttgctagttt taagctgcta
    89581 aaggtatttt ctacatcaaa tgctgttttc agatacacgt atacagtagt tgcctctttt
    89641 atagtatcgt tttgtgtaag tcctgtagag atatcattta gctctctcgt aaacccagac
    89701 agttgcatag cagattcatt gcttgaacac gaatcgaaaa tttcttcgcc tgatttttcc
    89761 cagatagttc cgtggtcaga agatatggac acgtgtttaa taagcttata ccctacatag
    89821 ggaacaaatc caaatctgcc aagtcctttt acatcaggga gttctatact cagtactaga
    89881 ttatttattg cagtaatata ttggtctcta atttcaaacg tgtttgtttg agagttagta
    89941 cagtccttaa aactaattcc ttgcatcgtt atgtactgtg gcatgtacaa agtaggctga
    90001 tgttcgtcga cgccaaaaac atttgcgcgc ttgacaccat cgtcggcgct tagcaacgaa
    90061 attactgtat tgttcatggc tatttaactt ggtgaaaaaa atttaataga ggcttcgtaa
    90121 agacatctgt attgtatttg ttttttcgtt aaaaaaacag ttaccgtaca agccttcttc
    90181 ttctttgcat tcgtttatta tttttataac tttttctggg tctttgtagc atgttagcgg
    90241 aagcaaagaa atttttggct cttctcttaa cgctatgtga gtcttaacca tacaagcaaa
    90301 agaatctcta cagattctag aacaaaaata tcccacaaaa gaattcatta acgtctcaat
    90361 tgataaatat ttaccatcaa gttgctgatt acaaaaccaa caacaatcgc ttttagtgtt
    90421 taatgacaaa atgctatcgt ttaaagtttt ataataagaa ggaagaacgc accctaatga
    90481 ctctttatat gtgcttttta tggcagcttt gggtgcgttt attacaacat taggcaagct
    90541 aactcgctta gccatttata aaaataattg tttttttaat gtgcgttata aatctaatga
    90601 gcactctacg aacatgtctg gtttaaaaac gtactcgtgt ccaaagtcaa ctactatacc
    90661 tgattttttt ttatctcgca tgtaaactaa aaaattttcc caaactagtt gattactatt
    90721 attttttgca tagtttttta ccgtttgagg tttaagattt tgagtaacgt ttgtaatatc
    90781 aaaaattttg tctaagaaaa aagaatagtt aatagttttt gaaggtgtgt tttcttgaca
    90841 aaaaaatact aaatatttaa agatttcaat gacttcgtta attttatcgg tagttaaatt
    90901 taacttttcg tttttaacat tgtttatgat ttcaaaaact aacttgtagt cttttttgtt
    90961 tatttttgag tttgctttaa gaaaactaga tacaaaatta gcatctacgt cttctgcatc
    91021 tatatcacaa ctgctcataa caaccttaag ttcgttaatt acttcatcag aacactgatg
    91081 agacaaaaga cgtcgtaaaa catttcttaa gtgaatcagt ttgttagata cgtgaaaatt
    91141 agacttttta aacgttttta aattttgagt aaaaacagta tcgcaaaaaa tacacacgtc
    91201 aaatccttct tctgatacaa ttccattatg cttacacact ttgcacattt tcaagttcat
    91261 tatgttaaga ctctgtatac ttctttgtct agtattttat aattgagtgt tttgtttcta
    91321 caaaattcta aaaacgatct taaaattttt aatctattag gctgtgcgta tagtagcctt
    91381 tttatatttt cttcatcgtc ttttaaaaat ttagttaacg ctacagaaca attagaacac
    91441 ctctttggag gatctaaatc tacggtatag ctactatacc attccattta tattataata
    91501 gtattattct aaaaccacag tccttctcca actgttctag acgaaatgta aggtgcgtaa
    91561 tcttgtgcgt acacgagcag acagcattgt ctagatatca tcaccatcgc ttcgtcgata
    91621 gttagcaagt catcctcaaa cacagaaatg tttttcatta gctgttcttt ctttctagct
    91681 actatatttg cgccttcgtt tctcatccaa tcgtaaatac ttgagtcgtc gtccgcgttt
    91741 acctcttgtt tgtataactg ttttatagct ctcattaacc tagcttctct agaaggtttg
    91801 ctcaatatag acatcggatc gtacatccag ggacctagtt cagtgaacaa aattgtataa
    91861 tgaccggtaa gaaaaacttc agaattacta gatccgcaac tgtctagaaa gttatctcct
    91921 gttctataac aaaccgctga ttttagtttg tacattattc catttaggtg cagttcttga
    91981 gctacatcaa ttggtgcgtc gttaataaca gatctaaacc ctgtaaagca ttcaccaatt
    92041 accgattttg cgtttcttct ctctactaga aacatcaatg ttccgttaac tataataggt
    92101 gactgaggcg ttctatccat aaatccttgg ttgtttccgc acaatgtagg aaacgtttct
    92161 atgctacatc cagttgacct gtaactaaca tttggaggaa caaacattac tctgctactg
    92221 ctaccgtcgt acgctagaga gcacacgttt ttagtattaa tcgaaatagg ggaagttgat
    92281 gttgtgatca ttctcatagg atccacaact acgtaaggag ctgattgaag agtaaggtcg
    92341 ctagacattc ctctagacac ggataccaga gccggtttaa atcctactat agacagaatg
    92401 gacgctagag tttgttcttc gtcgctcata acagtagaac accctgtgtg aataattttc
    92461 attagctgat tatcaattgt ttcgtcttct ttgcaatgaa aaactcccat tcgcatattc
    92521 attacaattt ttcttatcat tgcgtgaagg ttagctctct gaacctcggt tgaaataatg
    92581 tctcctattc cggaaatgat gattgggtgt tcctcagtta gtctgctaac taacagcata
    92641 taattttctg gctgaacttt tctatactcg taaagctgat gaattagcat aaacgtatct
    92701 ccagaaataa aagtgttctc taaagcagct atcttaactc caaacaaagc cattaaaata
    92761 ggactaacaa aacatgttga atcgtgtgat ttataacaga aagacaaatc gctggaacta
    92821 gacatgtcta taaagtggga ggattgaaac ctagatgtag caataagtgt tggatagtta
    92881 gatggttcat aaaccatttc catctctttt atctgctgtg ctagttttgc gtttgaccta
    92941 gaataaataa gcattagagg gtgtccggcc ttaaccgaca aattagaatt agttaacgag
    93001 ctcttaacat gcgccattat ctcaaatagt tcgcttctgt cccgtcttgc gatgtttagc
    93061 ttttccataa ccattagcat gtcttgaata gtaaaagatt ctatgttaca tttgttattt
    93121 cttatatacg cagctattct atcgccgtcc tttcttagtt ttagaaccca ttcttgagta
    93181 gatgtaagct catctagcgg aactgtttct aaattttctt cttgataatt acgagctttg
    93241 caagcgtctt cccttcgttt tagttctcta tcgctttggc tttgactctg cttttgtctt
    93301 ttataaggtt tttgtctagg agctccaccc gatacgatat tatagttggt tactgatgaa
    93361 agcatgttac ataccgaaca cgaatcggtc tgaacagctt tatgaatatg ttcttcatta
    93421 actagcgaca agtgctgatt gttatagtta ctacttaact gaatttttgt gttaagaaaa
    93481 agatttatat ctgaactttt tagcgtatca tggtccattt atattcttag tttttattat
    93541 aacacgcact aagaataaca cgcttagttg aagtcgtcat tatcgtcatc tggttttaaa
    93601 tcaggattga ggcttctcat tcggttcatc agcgcagcgt gtaaacctga aatatctact
    93661 tgcttaactt tgttagatga ctcaatggta cgcatagcgc tagttaagtc tttaacagat
    93721 tgtggcggat caacgggagt taggggttta gcggctatag ctcccggtga ctcaacggat
    93781 gaaggataca ctattggatt gtctttcgct tctgcgctag attgttttat agaagtttta
    93841 atgttatcta ctgtattttt agcttgctct gacactgtaa catctttttc aacagtagta
    93901 cgacatacag gaatgtcgta aatattatct tgtgaaaatg gttgcggtaa cagcggaagc
    93961 ggattttgcg gaaattgtct aggtgatggc aacggaggcg ctggtggtag tgagggatta
    94021 attggacaag ttggtggttg catcggacaa gttggttgcg tgtttggcgt gggcatacat
    94081 tttgcatcat cgtacgttgg tggcaaagga ggtaaaactc taacaccccg ttgagatgta
    94141 gacggtgcag gacacgatgg ttgttggttt gatcttagca agctttgata atattgttct
    94201 gttgcgttgt gaggagcgtc tatattcatc gaaggacacg ttttaggagg tactggagga
    94261 ggttgattta atgtatacag tacggatgac tgtggaaacg taaccatttg tgcctttttt
    94321 aaagtttcag caaatttact tctaagatcc atttaaatta acaaaattga aagacgattg
    94381 tgtactaaaa atggctacgt ctttggatga cgatgttgat attgaatctg attatgaatc
    94441 tagtgagtac gaaaaagaag acgatgaaaa agaagacgaa gatgacgaat tcagtgattc
    94501 tgatgttgaa aaatcattag atatgactag cgaactcgcg gataaatcgt ctttaaagtt
    94561 taagtctcct gaaaccgtac catctattaa tgttcaagat acagtacaac agagtaataa
    94621 aatatcactt attaagaagc gatacactcg tcgtatgagt ttatttgaac ttaccggaat
    94681 actagctgaa agcataaact tgcttcaaag aggaagactt cctttggtag aaggtctttc
    94741 gggtagtact cttcaaaaaa accttttaca agttgccata caagaaatta gagataagac
    94801 gtgtcctgta attattaaga aaaacggaga gtacttgtcc gtaaacgatt ttgacgaaag
    94861 cgcgttagaa caccatttaa cttttataac aaaaatctgg aaacaacaaa acagatatta
    94921 attattttga taacttatca aaaaaacttt ctttggctgt ttttattaaa tcacacacgt
    94981 ttaacacttc gctgttgtag caaatgttgt tattattaac aatttgctgc aacaaattaa
    95041 caatattatc ttctctagtc gtgtattctt gttctagtat tgatttatat acagatttgt
    95101 gatcggatat atatccaata aggctttgaa tgtttctaac gcctctagac tttatatctt
    95161 ctggagaaac ttttgttttt agagattcga gaacgttaga gagcaatatt cttacgtcgt
    95221 cgtttccttt tagttggcta taaacaagaa tgtacatctt tgaaacggat gttataaatt
    95281 ttgttgcgtt aagatcgctg ttattttgaa atattataat attagacaaa acttttctaa
    95341 aaaatgtagt gtatttgtta ggctctacag aaatagaaaa cgtcagttca gaaatacact
    95401 ttattccgtg ctttaaactt tctgtagaaa ttgttagcag ttgtcgatac tcctctagtt
    95461 tttgtttgtt atttaccatt tctgagtcaa acacagctac tagtttaagc aagtaatttt
    95521 cgtctgaaaa tattttatta acagttctta caataaaact gtaatgagag tttaataaat
    95581 ggtatattct gccttctcca gacaaagatt ttatttgtgt aataatttca agtattttct
    95641 ttgaatccgc tactatatct tcagtgtcgt gtttgatgtt gttatacatg ttgtttaaca
    95701 ttattaatgt ctgtgtaact gtgagcatct ctttaaacgt gcatataaaa tctttctttt
    95761 cgcactccga tagtttattg taaacagatt ttaccactgc attagatcgc ataaaccaaa
    95821 aagtaaagag ttgataatta cagtacttca ttagctttat aacttcagca tctgttaaag
    95881 atggtgatat ttcgcatact ttttgttcaa gtaccggaac tatagacatt agagtcgaaa
    95941 catctacgtc aaactctgga tcgtcggttt gttgtccggt ttcagattcc aagtaagttt
    96001 tgctaatgca gtaaaatttt tcgtataaag ttttaagttt atccattata atttgtaatt
    96061 tattttgata ttcagtagtt taatttagct taatagccta tttatgagga taatactttt
    96121 ctaataattg tttaactgtt gctggatctg ttgttggtgt tatgttaaat tgtaccatta
    96181 tattaacaat ccatgttttt ataaatctgt ctattgattt agtaacaacg tacttaaaca
    96241 tatttgaaaa gtacttaact atcggtcccg atgacacaac gttatctgta aatgtaatat
    96301 actgagaaga tatagtttct gtaaatcgtt caccgtcaac gtaaaatcca tctgttgtta
    96361 gcgttaatcc agagtcagaa gcgatttcta ttttgttatc tatgtaagga aatagttttt
    96421 ttagcggatt ggacttaggt tgtataaaat taattacgtc gctatctgcg tctttttgta
    96481 ccaatagtac atcgtgaaca atttcttgta caactattct aattttgttt cctatgtcgg
    96541 tataattagt aggaaagtat accatatcgc ctactattaa aatattttta tcttcattga
    96601 cgtactttat tatgtcttct tgagttctaa gtctagttat tgtttcttta gcacagcagt
    96661 gaactatata gtaaccggac gttgattgaa gacgcttgtt gtcgggttca aaatctgcat
    96721 tattatctac gttaaaataa tcgtcaaata atataggcaa aaaagatatc ttagattcag
    96781 taactacttt accaaagttt agaacatacg gatttataac tgttcggtca acttctttgt
    96841 tatgaacgca agaagaaaat gtttctgtat gagattgagg ttttaaaaaa caacacggta
    96901 tgcatatttt ttgcagtctg tgaaatatag ataaaaatcc aatgttgtta tatttaccca
    96961 aaggatccaa acacgaaaac atcacaccgt tggcgttaac gaatacgtct ttagtttctg
    97021 acttataaaa attttcactt acttttgtca tgtccgcgtc tagcgattgt attataacgg
    97081 gtttacggtt tttatttttg ctgttttggc aaattcgtga ccagtaaaca gtttctattt
    97141 ttgtaaaatc agaagactgt tgaacgttgt tgaacatgct gtttatagca ataactaaaa
    97201 aggcaaaata cttttcgatg ttaggaatat gattttttac tttaatagat atgtgatttt
    97261 ttgccaaaat aatagaaata cgtttgtcta cagataacaa aatgttatta gtggccgttt
    97321 caacaaaaat aaaactagtt tctatggcta gttttatttt agacgttata ggcgtaaaaa
    97381 ggttaacttt gtaagttata tctcccttta tcctttccat ttgtgggtct aagtcggcta
    97441 ctaaactaga aaacaagcta atgttgttaa ctgtaatagt acttccatcg cttgataatg
    97501 ctacagtgcc gtcagtgttc cagactgtta agttaatatc ttcatctgtt aagataaagt
    97561 tgtttcctgt taaattaata aaatgttcgt cgcttttgta caacagtact ttgtttttaa
    97621 ggttctgttc ttgtagcttt tttactattt tgcgcaatcc tgttgttcgc aaatttgttc
    97681 taaaaatatt gttaaactta gactccacag tcatgtttaa gtctaacgtg ttaaatattt
    97741 ctaacatttt tgattcaaat tttaatatat tagagtttac ttcttccgac gaaccaaact
    97801 ctggaacggg tgtatcgtta gctctagcaa cccatatgac taaaaaatta cacgcgtcta
    97861 tatacgtgtt gtataaaatt ccatctattt ttattaaagt ttttttctgc gtgggagaaa
    97921 aagggttaaa tatagtattg tcaacatagc tgtactctag gttattttta tgggagtata
    97981 taattatgtt ttcgtctata tttaacaggt cttgaaggta tccttttagc tgtcttattt
    98041 tcatcgttaa cagtatgtgg cgttttaaca aagtaggagt ttttatgtct aagtgtttgg
    98101 ataagaaata gtatattgtt gatgtttcat ctatttcgtt atacggtgtt aagtaaagcg
    98161 ctctttcaat attttgtgac gcgtctacca atagaaccag ttgaggactc acagtataaa
    98221 tcatgattta tactttgtaa agtgaaaaga tattttaaca attttgtatt attaatgtat
    98281 tttagcacaa tgtttaaaga agttccagct tatcaattgg aagcagatgt taaaattgga
    98341 gacattaatg taaacgtaac taaatccaga gctagggaaa actcaagcta tgtttcaaaa
    98401 actagacgtt tatttcctca gagatctaaa aacgatgagc acaagctgtc tttgggattt
    98461 ttccttcaaa gattgtcgtt tttagggtat aaagaaacgg cttatttgtt taggtgcgta
    98521 gacgctgtaa agaatgttag tatcactaag aaaaataacg taataattgc accgtatatt
    98581 gctctaataa caatggcgtc caagggatat aaacttacag aaactatgtt gcagttgtat
    98641 tttcccgagc tttacagcga acgcagtaag cggtttaaat tcagtactca gataatgtat
    98701 attcaagata aattgggtta tcctcaaagc gagtactttg tttattcctt tgaagaatat
    98761 ttttcaaccg ttgcgttaat aatacgcgat gaaacggata ctgtgttcga ttctaggaaa
    98821 gaaagctcgt taatatcgtc gttgtcagaa ataacataca gattttatct caaacagctt
    98881 aaagaagatg ctatacaatg gagcgttagt accggaacgt taattacgca gatgataaat
    98941 actgtgttaa tagctacata cgaaatgtta aagcaagcta tagaattaaa cgctagtata
    99001 tcatgcaagt tagctaaaga aacgcctgta ccttttaact tgcttatcga aaataaaaat
    99061 aaatttatta attttataaa cgatataaaa aaattagaat cttttaaagt caacaagaaa
    99121 gaaaaagatt ttttaatgac tttctttgaa ttaaattaat ttttacccgc agacgttttg
    99181 tcgcttacgc attttttatt atcagtatca ttagatttat cggttttgtc atcttgaaag
    99241 gcgtacaata aaacaattcc taatattaag tacattaaca tgttaattac tattcgtata
    99301 acgacataac taaaagagtt agatcttagt ttatgttcac aaaaatacat aaacacgtgt
    99361 cttataagtt ctattgcgcc gttagcaact tgaaatagcg ccaaacctcc tattgatttt
    99421 attacagcaa tataacatga catttattct gtatcaaaac acgcggattc tggattagcc
    99481 atgttgagat tttttttcat ctgcatatag tacattttag aaatatctga atagtaattt
    99541 gctagttttg ctactttagg cttaactagt tcgtaagctt ttctaagatc atccgcgcta
    99601 atttcagagt ctgttatgct tttaccgttt ctccgtagca agtacataat tcctcttatg
    99661 gtctctagag caatcagttc taaataaagt tcttttgaca attctgtata tagcttgaac
    99721 ttttgcaata ttccttcttt tacatcgtcg ctgataggag tcttaaacaa gctttctgtg
    99781 ttgtatatag atttagccaa ttgcttaaat acagcagcga tattgcacgt gttttgtcta
    99841 agtacgtcaa actgtctagt ggctaacgct gtaacagaca tgagagcttg cgtagcggct
    99901 gcgctattgt ctcgcatata attatctttc agtactgcgt ttattatacg aacaatttcg
    99961 tttgaaggag ttccttcgtc ttcgttttca tttacgctat cgatgatttc actaagcgac
   100021 acagctcgcc catttcctcc acctacttga atgtacctat ctaccatgct aattggcata
   100081 gttcttacaa cagcgtctcc agttagctga ccatcgttaa tgagattagc caaattattt
   100141 ttaaaagcta cattttctgg cataaaaaat tcagtgtcta taatttcatc ggttgtagtg
   100201 gctgccataa tgcctcgtac attaattctt tctaaaatag atagtggctc aaacatgtca
   100261 attgtagtga cttcattttg aacatcaacg ctaggtgcgg cttctgttgt tgtatttgcg
   100321 tttcctgcag aaaaaatact aaaaaacttt ggacaggatt ttctacttgg acaactttga
   100381 tacgacaatc tgttaatgtt gtaagaaaat atatctctaa tatctcctat cgataccata
   100441 aactgaagta ggtcgtgtgc tgaagacatt attttagagg cctcatcctt tgaacagcta
   100501 tttttttcta aaacagattg aatgctactt tttgatacct ttggagagac tgtaacagct
   100561 acgtgattgt gactgcttac catgttttgt ttaaaagaca ctttgtatcc catcgcggaa
   100621 aacaacagcg ccaaaaattc tttatagcaa tctttcttaa taacgtgagg aggaccaacg
   100681 tcttctagtt ttaaacctgc gtacatcata agaacttctt taagagccgt ttctggagtt
   100741 ttatttgcca ttaatctaag gtactggaaa aacttcataa atcctacttc tgacaagcct
   100801 atatggttaa cgacgtgtga actttttcga ggaaagtctt tatgtgttat agagttgatg
   100861 ctgtttaacg tttccgccag caattgagga acggtttttc cggcaattga cctaaccaag
   100921 aaacacactc ttgatggtgt ttttcctgaa gatatcacat tggcgagtct agaacaatat
   100981 gtaattccgt tgtgatcata aaggccaaac acgtaacaag ttgagtttag aaacatggtt
   101041 ttggttaacg gcatgctttt gtattcgcta taaggaattc catcccaaaa caaagatgta
   101101 tctgttgcca taagtttatg aacagctgtt ttttcgctgc gagaaatcat actaaatagt
   101161 gtaatataat aaactggaag gctggaaata tcgacaaact caactcctgg aattgtaatg
   101221 ttagcgctag ttatgatacg agtagacgcg tttctaactt tcatctcgaa atacgactta
   101281 accggaacac ctggagccat ttgtttaaac gtaggaaatt gccgttgaaa atgcaaagat
   101341 gctataaaat taagaagttc gtagtcgcta agcagtactt catcgccgtt gtatgtgaga
   101401 tctctaaggt catatctaga gttaaagtgc tgaaaataca ttaccaagtg cttgtatggc
   101461 atagttgtta agtctgtatc tatagtagga ttttgagcta taacaatatt atgagacgct
   101521 gcggcagatt caacgttata atccttgtcg aatatttctc tagatggcgt tgttaacaaa
   101581 gccctaacgt ttaacaaatt aattaagtct tttgccatca taattccgtt tacgagtcta
   101641 gctctaaatc cagtatctgt tcctataacg tcagagtaaa gcaagttaag taaatatgtg
   101701 ttgctaaaag acaagttagg catcggaatg ggatttaaga tgctaggaga tgctagagct
   101761 tctacatatc ctccaattat cctagcatga ccctcacagc ccgtaactct agttttaact
   101821 aaatctttag taaacaaagg caattcgttg tagctatgtg tatcttgaat aggattgctc
   101881 ctgtcgctta tggaaggttc ttggcagttt tttacaatag ttcccggttt tacaacagcg
   101941 ttaaatagcg actgagaaga tgttttatcg agtaaataat ttattcctag tttttgaaca
   102001 gacaagtcgt attctaatgg gtcaactaac gcttctaaat ctgcagaaaa aagtgcgtca
   102061 aatggatgga cgtatgttgt tttatacttg ctttctattg taaaatccaa acacaacgac
   102121 ggtagtaccg tagagaagat tttgtacata tattctacac cttctagttg gtcaagagta
   102181 attatgttgt ttaaagccgt catttaatac taaataaatg acggccgtcc ctgtgacaga
   102241 tatgccgagc gaatatatcg taactgcgtt ttcagaagat aattaccctt ctaacaaaca
   102301 ttacgaaatc acatcggggc aaatgtctat catgagaact atgcacaatg cattgctagc
   102361 taataaaaac gagtacgatg agcaatcatc cgacgacgaa gaaactagtc ccacaccctg
   102421 ttctgacatg gaagaagagg ttgacgaagt tgaagacaag gtttcagaat cggctataac
   102481 cataccaact gccgcagcag ctattgcaag aactagagta actcccactc atcaagacat
   102541 ttcgtttaaa aagtctatta atataatggg acctaatgga actaataacg aagttatttt
   102601 tacagcagaa caaaaaagag taaacataac aatgtctgac ttagacaccg ttttagaaaa
   102661 caacggtcac atggataagt tttctaaaat cacatcgatg ccgatgcaca caactccttc
   102721 tttaggagct gtctttgacg atagcaaaag agttaaacta ctagaacaag aagttcaaca
   102781 attaagaaaa caaaaagccg cggctccttc aaacttagat aattttacta aaattttgtt
   102841 tggaaaggtt cctattaaaa cggcggatgt caacaaacgc atggttatcg taaactatgc
   102901 aaatttaaac aacgtttcac taagcattga agatttaaac gactgttcag atgaagaaat
   102961 agaaagaatg tttaaaacaa ttaagcaata caatgaaatg aggaaaaaaa aaattattat
   103021 aactaatatg attattatcg gaattacaat tctagaacaa gttctttata aaattgggtt
   103081 tgaagaagtt aaaggcctta gcgccgacgt cacaagtgaa attattgacg tagaaatcgg
   103141 tgacgattgt gaagccgttg ctaacaaaat aggatttagc aacagtccgg tgtttaatat
   103201 tgttttgttc atagttaaat tatttgtaaa aaagatgaag ataatttaac acattccaga
   103261 gtctggacat tcaatactgt ctttgttata cataacagtt gtttgtcttc tccgtctggt
   103321 cggcttggtg tctccactgc ttttagtagt acgaggtttt cttcccgcat taaccaaatc
   103381 tactcctagg agatcagcgt taacttctcc tacggttcct tttacttcta gttttccgtc
   103441 tctaactgta ccaaaaacaa tttttccaca gttagtaact gcttgcatca tgttatcatc
   103501 ttccatagga cgcctagatc tcggagctcc catttttact gaccttttac taggagttga
   103561 ttttgtccta gaagtttttt tacgagcggt tgcttcaaat ggcgaaccag cggcacatac
   103621 agactctata gtggtatcta ccgccgatgt atcaggagct gccaagagag gaggctgcat
   103681 tcctgtttgt tcgctgctaa tatgcgatag cagcgttttt agctgaggcg cgagtttttt
   103741 aagagtagtc atataatcgt cgtaactgct acgtggagtt attttatccg ccatttaata
   103801 ataaaaattt aactttcaag atctgcacta ttatcgtcag atgattgact gttttttgaa
   103861 acaagttttg cgattgcctt aatttgatca tttgtaagtt tgtcattaaa cgaacctttg
   103921 tttatttcag gaactatagg attctttttt tctatagtgg tttttgtata aatattataa
   103981 accaaataaa ttataataat tatgcaaaca aacgtaataa ttaaatctgc tagcgccatt
   104041 tagttacagt taagttcgat gtcgcttacg ttgcgcatat tgcccgcatt aatcaaaact
   104101 ggaccagtgc aatatcttcc gtaaccgaca aataagaata atcccactag aataatacac
   104161 gctactacaa aacacgtaat agaaagggct ctccatgtgt agttgctagg agtggttttt
   104221 gaaaagtcta aaaacgcaaa aatagccgtt agcaccaata gagcaatacc tccaaacagc
   104281 gcacccgaat aataagttct aattgtttga ataaggtcca tttaactggc gtgaaaaatt
   104341 tatatcacag aatgtataaa gtggaacata aaccaaataa atacgactgt ttgaatcgta
   104401 aatacaatgt ctaattttgt ttgtgaattt aacaatatat tacatagcag cgttaacaaa
   104461 aatatgctac ttataataac gggctcgtag ttagatatca tttacattat aaaaaggatg
   104521 tagcaattgt ttgtcaaaga gcaaatatac tttacctatc caaacttttg attttagata
   104581 cacgcaagtt tttaacaatt gagaagccgt agggtttatt aaaacaactg gtccgttttc
   104641 ttctattaaa aaattatcat cgtaaaaata attatttttg tcatactctg taatcatacg
   104701 gccgtctgta gtaaatatat ttaatggata taaagaattt tttctacgta atataacaaa
   104761 atttttatct agtaacattt ataatattag tttttaatct actacgtgaa tacacacaaa
   104821 taaagtaaac aataaccata attactacaa agacaacagg tatagaaatt aaagcgtagt
   104881 tagcttcttt ggatttattt ttatcggtgt aatttccagg gtctacgtct cctagtatag
   104941 gaattcctgc gtggcagtta gagatgagcg acacgtttga cttttccata gttaacgaat
   105001 caatatttat gctgcatcct acgtatctac atctagttct ttgtacgtcc tggttgtata
   105061 acagccattt tctatcacgg gtgttatctg tgcattcgtg tttccaacaa acccgaggtc
   105121 ctaaaaatct atttttttta tcgtccgcaa acaccttagg tggattgacg caccaacagt
   105181 ttttgttact gctgtggtcg ttacagtagt ttatcaggga gctatccccg aacgcgtaat
   105241 tttcaggtct aactattcgt ataaattcag agcaatatct agaatccata ttttttgcac
   105301 atatatcaga ataggtagat aaagcaattt tgcgtttttt tctaagccag tctaagcata
   105361 aaatattatt tggatcatct ttacaggcgg aagacataac taaatcgcaa tcgtcagttt
   105421 caaaattgtt gtttaatctg ttaggacata acggcgttgg gtttgtacag cagcttttat
   105481 acttgtcgtc cgcagacagt ggcgatttaa caaatttaca caaataaccc gtttttacat
   105541 acgctttaac gctatcgcta actggctcat tgtactttat aactgaccca ggtctaaaag
   105601 aaaaagactt acacgggtcg cccttaactt gaatatattc tttagatata gacggtgata
   105661 ggtaagtgcc gcagtaatta ggatccatat tgtcttgtaa gcaaaatcta ggatttatta
   105721 catctttaga attgtcagaa attacttcgc tttcttcaga aaacggaatt atgtatctaa
   105781 caccggctga atcttcgtct attaccattt ctaattcacc gcgcacatct gttttttgta
   105841 caaacacact agttatacta ctacccgcac ccatttattg actttaactt atgtatctga
   105901 aaaactagcg ctaaaactag tttttctacc cgctctcatt agcggacacg cttgtggagt
   105961 agagaagtac gacagtctaa acacgtacat acaaaaaagt actcctaaga tgatgtaaga
   106021 tataacggtt acgtgatatg aacatgtaat atgagtaaga gttatagcta aaattgccat
   106081 aagggaacaa attatagcca ttcccaacgt tttgttatag gacgaataga ttgcctgcat
   106141 ggacaaacaa tacgctagaa ccaaacaagg tagaggcagt acaatagcag ccaatcctat
   106201 caaacaaagt ccaacaagag gagctgatgt tattgccaaa acaaaaagta tcaatcctaa
   106261 cagcactctt atgtcttcaa attgaagaat attataagga gctagcggcg aaataggctt
   106321 tccgtcaata atggaagaaa tatcatctcg aggtaagaat gattgttgtt cgtcttccgt
   106381 aaaaagttcg tcgtctaaaa ctccagcacc gccttcaaac tcactaaagg ggttataata
   106441 actaaaataa ctcatttata tataaaaaaa tgtttggtta tatcaacatt actaataaac
   106501 tttacactta tataaaaaaa atttctggat ctcaaccttt atttcttttt aattctgata
   106561 ataaccatgt agaagttttc ccaaactcct cttttaagtt tttggttcct gctggattat
   106621 tttcttctta tcgagtaatg ctacgagacg aactaaaata tccaatagct aacaacccaa
   106681 tgacaaacga gaaagatctt tctcttccca atctttatcc gttacagcaa ctagtggtcg
   106741 acaaagtcgt tgcagcgatg aaaagaaaag aagaagaaca ccgaccaaag tacataacgt
   106801 tacatctaaa atgcggtttt ggaaaaacgg taaccgcgtg ttacttaatg gcaaaagaac
   106861 gcaagcgaac agtaatatgc gttcctaaca aaatgttaat cccacagtgg aaaactgctg
   106921 tagaattaac aaaagcaaat tatatgatat ccgtacacgg agttagcaaa ctcttattag
   106981 agaaaagcac tccggatgtt cttatagtag taagtagaca tttcgctaac gaagagtttt
   107041 gtaatttagt atactcaaac tacgacgttg taatagtaga cgaatctcat acttacaatt
   107101 taatgaataa ctcggcaatg actcgttatt tagcgttcta tcctcctcct atatgctatt
   107161 ttttaacagc gacacctaga cagtctaaca gaatttattg caacgatatt attaacgtag
   107221 aaaaagaatc atcactaaat aaaacaataa aaataataga ttgttatttt aaaccatttt
   107281 caaacgaaaa aatacgtaac ttatctacta aattaaactc tacgtataat aagtatcatg
   107341 tgtttactga aaaaattctt acagaagacg ttcatagaaa taaacttatt ataaaaacat
   107401 tagtcgaaga atacacctct agaaagataa atagaataat gattattaca aaattaagag
   107461 ctcatatgtt aatgttttac aatgaattag taaaaaaatt tagaaacgat gttgttttag
   107521 gagacgcgca aaatagaaaa actccagaaa tagtaaacgg attaagatca aaggataggt
   107581 ttatatttat ttcaacgctt tactacgctg gtacgggact agacctgccg agtttagatt
   107641 cgttgtttgt aggagtagcc gtaatgaata atatgcatat ggaacaatta ttgggaagag
   107701 tttgcagaga aactactcta acagacagaa ccgtatacgt gtttccaaca acttctataa
   107761 gagaaattaa atctgtagta gacaattacg tacagagatt aatatctcta gccttagact
   107821 tggggtttgt acagttaaat accgataaac cttgcaagga agaaactgct ttaaaattag
   107881 cgtttagtta actaactata aaattcattt aagggtctaa gagcggatcc gcacgcggcg
   107941 cattctagta cactacctga ccctgctaat tttaaaccgt ttagagaaac ctttgttata
   108001 tcagcaactt taaccaacaa agagtgacac gacgaacacg tagtacaaga atcttcgtct
   108061 tctacaacag tagttctagg aggacgacgc tttctctttt ttttataccc cgcgctttcg
   108121 tcgataatac caacttgttc acttgacatt taagaagtaa aaaataattt agaatatgct
   108181 tctaaacact cttttccgta gatgtttttt atgtcgtcgc taccacaact tacaaaatct
   108241 gatacggtta cgttgcttct atcgctacac ataaatggtt tgttgtcctt tttattaatt
   108301 gctattagag cagttactcc tcctattgga gcgaacgagt aagtaaacaa atagttatta
   108361 atacacaaca ttccgtctcc ttttatgttt gcaaactcta agtaagcttt gcgctctact
   108421 tcaagtttag atgaaatttt tggtactata acgttaaaaa tgataataaa atagcacaag
   108481 attaaaaaaa ctacaaacat gacggcgcta tctgatttaa ctagcttaaa agaactttta
   108541 agattaagaa attgtctaca tttagcagac gcagaaacta ttgacaggta caacacgatt
   108601 gttgattggg ctatgcaaac ttattggttt gttgatgtta caaaactatc aactccttgc
   108661 acgtcgttgg acagctacta cacaaaagcg gtgtcgccca tttacttaaa cgaaggaaca
   108721 tatactttta gtcgagtaca ctttggcaac acatttattt tttcaaaaag ctctatgcta
   108781 gagttagaaa ctggtattgc tcccaatata gacgatgact ttaaggaaaa atgtttaaac
   108841 gtattaaaat tagacccttg ttgtgtgtta aagttttcta tgctctgcga aagctggatt
   108901 ttagaagacg cgatatctac tatacacgaa ccagaactaa tatttaatgc agctaaggaa
   108961 aataatttat tagttacacc tatacttcga gtaaaggttt taaaaaaaac attatttgaa
   109021 gaattagatt ttaaagcagt gtatttggcg ttatctaata tagcaaaaaa agacaatgac
   109081 ctatctattc ataaagctga atctatttgc tgctccaacg acaacgacaa gtcatggaga
   109141 aaaattatcg actttaacaa aacacagtac attaaagtaa cggcgtttag taaaataaaa
   109201 attggagaca atttgtatat gccaatttta aaaacaaact cgggaaatag aataatgcca
   109261 aaagacgtaa atcatttagt agcgtctaga gtaaaggtag gatcgtttgt ttctattaaa
   109321 aaaacaccag aaggtttaat gttatcaaac actgtttatg atcaatcaga aactagagga
   109381 aacgcactaa gaagaatttt acagactttt ggttcaaata tattcgttaa cggaaaatat
   109441 ttatctagag catctaccgt agacactaaa ctcttatgcg aaaaacttaa attgccaata
   109501 tgtcatacaa aagaagatct aataaactcg ataaaaaata ataaaaaagt cagtaaacag
   109561 ctttttgata aatctccaat ggaaatgact agattatgtt tatcttatcc agaaaaagaa
   109621 ttaatagaac ttgtcaataa tattaatttt gaaacaagtg acggtattat aacaagatat
   109681 agtttagaag acacaacttg cttagaaaat cctacaattg aaactttgta ttgtaatttt
   109741 gctcaatttg taactgtatt taatattttt gcaactgttt ataatttaaa tagcgatgca
   109801 gactaaagat attaaaaaaa tagttatttc tgcgtacgac ataggggtta aaaatccggc
   109861 tagaactgta ttagaaattt ttaatgactc tattagagta gtagacatta caaagctgga
   109921 ctggagcaat aattgggaat ctaaaatttc agcagacgtt cgcaaatttg agtcaaatat
   109981 agttctgtta gaaagacaat ctaaaaaatc tccgtattct aagtttgtgt attttattaa
   110041 ggggttgtta tataatacta atactaaggt ttactgtgtt cctcctgtca tgaaaggatc
   110101 tacttacaaa tctagaaaac gcagatcaat aaaaattttt ttaaagtggt taacgttttt
   110161 tgacttaggt gattacgtac ctgttagaag aaaaatggac gacgtagctg atagttttaa
   110221 tatcgctatg cggtacgtaa tagaaaaata tattaaaatg aaatttaact aatagccatc
   110281 gctagatagt catggatgac cttctttgtt tcttgcacag tattgaaaat attttcgcta
   110341 gaacaatttt taattttcat ttaacaaaca cgcagttatt aaacgacatc tatggctata
   110401 tgcaacgtcg tataacaagt acaaattctt tttcaagcgt cgtagctgat atgcctgaaa
   110461 aaaatttgat taaaaaaatt gtatactgcg atatacaatt aactaaacac ttgcttaacc
   110521 acgaagcgta tccaaattac gaacaacaac ctgtatcaaa aagaacaggt aaatattttg
   110581 acgtgtcatc tgagcaagac gatcatagtc taattacagc ttctatattc gagcgcgata
   110641 ggtcatcgtt agtttcttat attaaaacta ctaacaaaaa acaaaagatt aactatggag
   110701 aaattaaaaa aactattaca aactcttctg gaaactcttt gggttatttt tcaggccgta
   110761 agggagacga ctacttaagt acagagatta aggctaacgc tgaaaaaccg tggattaaat
   110821 ctattttaaa gcatatgaaa atagaaataa actacgattc catcataact aaaggaaaga
   110881 gttctatttt acaaactatt gaaattattt ttactcatag aacttgcgta aaaatattta
   110941 aagattcaac aatacatatt attttatcta aggataaaaa tgaatgcgga tgtgtaggaa
   111001 tgatagataa actattttcc acttataaaa ttttatttat gctgtttaac gcagctagcg
   111061 ataaccctat gtttatgaat tgggtaaagg tagcgaatga tattgtaaca gctactaact
   111121 ttaacgataa aattaaaatt attacagaaa ataaagatat gtatggaatt ggaaatttta
   111181 gaattggaat gtttaactta acttacaagc caaagattac acatactgtc tttccgtcaa
   111241 tgttgagttc caacaataaa ataaagtttt tcaaaggtaa aaaattaaat ctagttgctc
   111301 tgcggtctct agaagactgc atggaaaacg tttcgcatgc tcaattggtt ttgtctgaga
   111361 tgaagagtaa agcagaaagg cttagttcaa taaacgtgga cacagaatta gttgaaatac
   111421 taaaagattt attgatataa aatgaaaaac gacactagtg taaaaatgga ccaacgtctc
   111481 ggatacaagt ttttattacc agatccaaaa gcagacgtgt tttatagacc tttgcatttt
   111541 caatatgaat catatgcaaa ttttatactc tatagactta aagagattct tacagttaaa
   111601 agaaaacttt tgtcatttaa gaacggaaca gaaaacataa tattagaaat aaacaatgtt
   111661 tgtgttaagc cgcctcctta ctcgcccatc atcgcaagta ttaaaggaaa aagctacgat
   111721 gctcttgtta catttacagt aaatatatta aaggaagtaa tgactaaaga taccgtaacg
   111781 actgtaaaaa taagcagcta cgaaggaaca gattctcatc ttataaaaat acctttgctg
   111841 ataggatacg gtaacaaaaa tgtgctagat cctgcaaaat ttgtagtacc gaatgttatc
   111901 ggcggtgttt tcattaacaa acagtccata gaaaaggtag gaataaactt gatagaaaaa
   111961 ataacaactt ggccaaagtt tagatcaatt aaagcaaata cgttttcgtt ctcgttttca
   112021 tctgtttcag cacctaacat tttaccaaca aagtacaggc attataaaat tattttagac
   112081 gtatcacagt tagaaaattg caacatctcg tccgctaaaa caatgattac ggttaatgtt
   112141 attttactgg ttcagtattt agcaaacgtg tcattagagt ttataataaa caacctaact
   112201 tttgatatgc cgacagaagc tggatacttg gcgcactctc tagtagaaag cacaaagtac
   112261 attactagca aagaagactt taacctcact aactatattt acgatttgat agaggcggaa
   112321 agactaaaac agaaatcgca gttaaaacct gaagaattta ggtacgacat gataagtaac
   112381 tttttgcctc acatggtaaa tagctcaaat caattaaaag gcctgtattt gttgtctcta
   112441 ttgaggagat ttatatactg tatattcttt ccttctagat atgtggacag ggactcaatg
   112501 gcgtgtcacc gcgttttgac ttacggaaaa tactttgaaa cactggcaaa cgatgaacta
   112561 gaaaattata tttcgaacat aaaaaacgat attatgaaca atcataaaaa cagaggtaca
   112621 tgttccgtaa acattcatgt tttgacaact ccaggattta accaagcgtt tgcttcactt
   112681 cttagcggaa agtttaaaaa gacagacgga agttatagaa ctcatcaaca ttattcatgg
   112741 atgcaaaacg tttcgatacc taggagcgta ggatactatc cggatcaagt taaaatatca
   112801 aaaatgtttt ctgtaagaaa gtatcaccct agccaaaacg ctttcttttg tccatctgat
   112861 gttccagaaa gaggaaccca cgtaggttta gtatctcagt tgtctgtgtt atcgtccata
   112921 agtaacataa aaacaacaga ttatgtttct ctagagaaaa agatttgcga gtatataaga
   112981 tcatacccta ctgaagaaat tagttatttt gaaacaggta ttcctattac attagaaaac
   113041 tcgctaatag catccatcaa tattgattta gctgaacaat ttgttattga ctttagacgc
   113101 agaaaaagaa tagggtactt taataactta gaaattggta taactttagt tcaagaccat
   113161 atgaacgaaa ttcgtattaa tattggaggt ggtaggatta tacggccatt tttagtagta
   113221 gacgatggta aacttattat ggacaccgta gctgatgaac tagattcaaa aataaactcg
   113281 atgacttttt cagacataca aaaagaattt cctcacgttt tagaaataat agacatagag
   113341 cagtttattt ttagcaacgt atgcgaatcc gtagagtact ttagaaagct ttctcctgaa
   113401 gaaaaacaaa aataccactt ttgtgagttt cctgcagaat tcagggacgg atacgtcgct
   113461 gcttcgttgg ttggcataaa tcacaactca ggtccaagag cgattttagg atgtgcgcaa
   113521 acaaaacaag caatatctat tttgagttca gatttacgaa acaaaatcga taacggaatt
   113581 catttaattt ttccagaacg cccaatagtt atcagcaagg ctttggaaac gtctaaaata
   113641 gcagcaaact gttttggtca gcatgttgta ttggctttaa tgtcttataa aggaataaac
   113701 caagaagacg gtattataat aaaaaagcaa tttatcgaac gaggagggtt agatatagtt
   113761 accgctaaaa agcatcaagt agaaataccg ttagaaaact ttaacaaccg agagagggtc
   113821 agatctacgg cttactcaaa actcgacagc aacggactag ttaaactaaa tgcgttttta
   113881 gagatgggag atgcaattgc cagaaacatt tcttccagaa cattggaaga tgagtttgta
   113941 acggacaatc aaataagctt tgacatagct gataagtata ctgacatata caattctaga
   114001 gttgagagag tgcaagttga tctaacagac aaagttaaag ttagagtgtt aacaattaaa
   114061 gagagaagac cagtattagg agataaattt accagcagaa ctagtcaaaa aggaacggtt
   114121 gcttacatag ctgacgagtc agagttaccg tacacagaag atggaattag accggacatt
   114181 atcgtaaact ctacagctat tttctctcgt aaaacagtat ctatgcttat cgaaataata
   114241 ttaactgctg cttatgcgtc taaaccgtac aacaacgatg gaaaaaatag accaatatgc
   114301 tttcctagca gcaacgaaac agacatcgat acctatttag aatttgctaa aaactgccat
   114361 actagagcgg cagaagattt gggattaaag tttgacattg acgaaaaagt tttttgcgaa
   114421 agtactttat acgatcccga aacggatact ccttataaat caaaagtgtt tatgggtcca
   114481 atatattatc ttagactcag acacttaaca aaagacaagg ctaccgtaag atgcagaggt
   114541 aaaaaaacaa agttaataag acaagccaac gaaggcagaa aaagaggtgg aggaattaag
   114601 tttggagaaa tggagcgaga ttgtataata gcacacggtg ccgcaaacac tattaacgaa
   114661 atacttaagg attcggaaga agattcccaa gatgtgtacg tatgtgacaa ctgcggtgat
   114721 attgctgcac atataggaac atcttattcg tgtataaggt gttctaaact taacctatct
   114781 actgttttgg taaaagtaga tacaacgcac gtatcaaagg tgtttttaac acaaatgaac
   114841 gcaagaggta taaaaataaa aatggagttt gagaaaaagg aaccagtgtt ttataaacct
   114901 ttagactcag ttagcttgag tcctaaaaca tcgctttggg gcgactctaa gtaaattttt
   114961 ttatttcttt tactggtcct ttctttatag aaaatacaga atttggaact ttgggaaatg
   115021 gcaatttagg cttttccgat tcgagagcgt cactgtctgg ttcgggttta ggaagctctg
   115081 gctttgaaac gtctggttta ggaggttcaa aatttgggag atttggaaaa cttggctttt
   115141 ctggttttgg aagttctgga agacttggtc tttctggttt ttctggcttc ttatcttctg
   115201 ttggtggctg atttggtttt tcttccggct tcatcatatc ttctgtagga ggcaatggtt
   115261 ttcgttcatt ttcaatatca gtaataacat gtggattagt tttaatgtta catgttggtg
   115321 cggtaatgca gcagataaat ctgtttcttt cgtattctag ttcatgtttg taaattcttg
   115381 caaactcttt atgcgcttct acttcttttt ctagaatttt aattctgttt ctaactctaa
   115441 ctagttcaag ctcacagtca gatcctccaa tttttcttga gtgctctcta tcaaggtctt
   115501 cttctagttc tttaatctta gctctagctc gttccaaatc ttctttcaac tctttaataa
   115561 ttttgctagt gttagggtat tttccgttat tgttattatg accgttgtcg tctcttcctc
   115621 gtcttgcgtc ttcaagctct ctttctagtt gcttaattct ttctttgcat tcaaactttt
   115681 cttcttctag tttattgagg agtttcttca tttcttcaag ttctctctta actctagagc
   115741 aactaccgga gctattgttg tctccgccgt cgccgtcttc atctttgtct ttgtctttat
   115801 cttctagttc cttttctaga cgccgaacac ggtccatcaa atccttttta tctttttctg
   115861 ttttgtgcaa catttctttt gttctctcta ggtctttctg aatttcttta cagtctttag
   115921 aagattcttc gtttctatgt ttctctagtt cagaaatttt ttcttctttt tctttaatgg
   115981 ttttgttaag ttctttgatg gtagattcgt gtttactatg ctcagattct agctccctaa
   116041 ttcgtttacg ctgagtcgtt gtctcagtct ctagatcttt aatctttcta gacgcttcat
   116101 ccagctttcc acaacattta cgcgcttcgt acaattcttc gtatagctta tctagttcat
   116161 tttctagcat cttaactttc tctctctgtc ttcctagttc ttgtttgtag tatcctcctt
   116221 ctgttgtgtc tgccttaact agacgatcga cttcttcttg aagctctttt acctttctct
   116281 ttgttctact gagttcttca gaacaatttt ctagatcaac atttctacta cctccattac
   116341 gtctgcattc ttgcaactgt ttttcaagct tttcaatttt atctttagct tcttctagtt
   116401 ctctcttagt agaagagttg ctaccgcctc cattgccatt atcgttttct tcaatttgac
   116461 gcttgagttt tttattttct tctgtcagtt cagaaactct tttatcacac gttgaagact
   116521 tttccttttc ctttttgagt tcatccttca actcgctaac cttattttct ttctctttaa
   116581 catctttttc tagttcgtca atcttcttat tattttctgt agtgtctccg tttttgattt
   116641 tatcaagttc ttcttttgtc ttctctagtt tatccttata ttccgtaact tctttctttg
   116701 ctttttctag ttcttcattt gcctttttaa gtttattgct acagtctgta gtgtcgttat
   116761 ctttgtgttt agcgagttcg atttctagat ttttgatttt atcatttgct tcttccaact
   116821 ttttcgttac gctactacag tctcctggaa tagagtcgtc tattttttcg tgccttagct
   116881 ttgcttgcaa aatagcaata tctctttctg actttgcaat ttgttttgca aaatagtcca
   116941 ctactttatt gttagggcat cccttattgc tcgccaactt agctagctct gtagcaacgt
   117001 atctaacttc tgtaagagcc ggacatccgt aaatgctgta gcctgtgttt tttgtccata
   117061 taggatcttt tactatctta tcaatatcaa tttctgaccc aagatcgaga tcttcgccgt
   117121 cgtcctttgg atcttccacc aagataggaa cattaatatc tttaacatag ctgtaatcag
   117181 gaaccgcgtt tctaagtgtt actctatttg aaacgtcatc tgacatcaac aaaacagctt
   117241 tattcctaaa ctcgtcatat gcgctagaac cattcaatac aagcaaagca aacgcttcat
   117301 tgtcgttcat tgtatctgta ctagtaacat gcctaactcc ggttggatag tttctactct
   117361 caagttgtgt gtattcgtaa atattttttt cgctatcaac aacatgtgta aacaaaaatg
   117421 cttcaacgtc gctacctaca aaaatactat cgtacgtagt aaatcccatg gcgtccataa
   117481 acatttctgg aagagaaacc gaactactta catgcaccga atcataacta atagtgacca
   117541 cgcttctgtc gtttggtttt gttaaaataa ctttagacaa aagcatataa aagtctttgt
   117601 acatatcaac aaactgcctg ttggaaaacg tagtcaatga acaaacatct tgcgccgtga
   117661 gttttgttgc tgcagaacca ggaaccccta caaatagatt cacgcatttg tatttttcgt
   117721 gaacactaaa cagcttgtta taatagtccg tcaaatactt aaacttatta ggtgaattca
   117781 acaagtctac catgtttaga atacaaaaca aagtataaag tcctacggta ttaatatttt
   117841 cactatactc tccttttacg tctgtttcta tcaacaaatc tagcatatct gatgtttctg
   117901 tgtttgagtt aagttcatta tacagttctc ttacgtaaac aggatcctct acgttcctaa
   117961 aaagaaactt tacaagctta cgagtttctc tatccaaaaa agaatcagcc gttagattaa
   118021 ctttgttaag atctctaatt tttttaacta gattactaat tgagctaaat ttaaattcat
   118081 tttgattatt gtctaccatc ttcttattta tttaataaaa aaaaatattt tcttaatgcg
   118141 caatcatcca tgctggtgga gttctaaaac acatggaatg cggttgaatg tagcacaatc
   118201 tgtttatttt ccaagcgtcg ctgtctttga tgctaggata agtcttatct atagagtgct
   118261 taggaacact cacggtaggt tttctgcaag tgtggtaatc tactttattt gacgccataa
   118321 ccatgtactg cctcatggtt tctatgtggt gctctagctt tttagcggcg tcattttctt
   118381 ttttacaagt atcttttagg tgctttataa gaggtatgta gcctgcaatt ttttctttta
   118441 gaatatttaa tcggtaatca actgggttta ttgtgtacgg atagatgtta ttgtggtaat
   118501 cacaatagta aatgcagtta ttctcgctgt ctaagataca tctacaatga ggaggaggtg
   118561 gaattagtcc tgtacactga ccgtcgtgac agtcacttct atcattatga ggagggtatg
   118621 gagggtatgg aaggtgtgga ggataataag gaggaacggg aggaacagga actactggac
   118681 agtttggatt aactggagga cagtgaggag gaactgggca agttggagga acggtatgac
   118741 acggtggaac ttgtggtccg catatatggt atggactaac tattgcgtta ctgttgtatc
   118801 tagtattaat gtttccgcac caattacaac ctctactagc tgttctgtta actccgtttt
   118861 tagtcaaaaa cacaggaggt ccagcgtagt aatcattttg gaaattatta tatttaacat
   118921 gtgaatcttc aaactgataa actttagtat cttctggcat aataagaagg cttttaaaac
   118981 agtatccgtt gcatttagcg tttatgtcgt tatcctgata tcttatagcc ccttgatcgt
   119041 ggtattcgtc aaacaattta cctgtacaag gcaacgacac tatagttcct tggtcattac
   119101 tacacaagta agtataagta tgtccgtctt tgcatccgtt aggcatcatg taaatttgaa
   119161 cgtggtcgtt tccgtatttt gtaattttat cgttaactgt gtaacatagt ccatctagta
   119221 caaactctgg aacgctggac acaaacgttg ctttgtatcc gttgtaatta atagtaatac
   119281 aatttgtttg atagtgattt agaatgtgat tgtctaaaat atattttgta aaatacaacg
   119341 gacctttaga ccacgtgttt ggtaatttgt taccatttcc tgtaaaaggt tttgtaattt
   119401 catcataaac agtttttaca tttacaccat accaataata cataggaagt cccaaaacta
   119461 tattagggtt ttctttgtag taacctatag aacacaattg ccaaagcata ctagagcacg
   119521 catatgtcat ttttgaagaa taatcttttt tggtagaaag tacttcgtta aactcgtata
   119581 aaggtacaaa tttggttact atattatttt cgtttgtttg ttctatctca acgcgcataa
   119641 ttgcaacaac aaaaaacaat aaaagctgtc ctaaagtttc tatgtctcta aaagtattaa
   119701 gattgttata atgacgttca aaaaaaccat ttttaaagta cataaagtta acatagtata
   119761 cgtttctaac aatatttgta ggcaacacca aacaaaatgg agcgtgtgga tctaaagtgt
   119821 ttggaaaatt atctatatct ctataatcgt cataattaga attatcacaa acaggagcgt
   119881 gtttaatata atctcgtaaa acgtttctaa atgccttttt agcagtacgt ggtattggtg
   119941 ttgttgaagt tattgtagtt ccccaagttc cttctactat tttataaaaa gctaatatag
   120001 atgtcatttt tggatcgtcg tagctccaaa gagataacgg atctatataa tattctagct
   120061 tatccattta ttaaattagt tttattgaaa tattattttt ttacaccatt aaacgataaa
   120121 aaacattatt tagatttaaa acctgtttga acatcaattt tatgagttag atgcaatata
   120181 gatgctcgta gagatgcagc gtgaccttct agccgtcgca ttcgctcttc tgctgctcca
   120241 gtacacttaa ttaagtcttt gtaagtatct aaaagatctg taactgtttt ctctaacagc
   120301 gaaagtctgt ccggtgcgcc accgataaac tctaatccgt ctgagctttt agatccaccg
   120361 taaaacgtat cgtctttaac agtgggatac atttcaggaa ttccgatatc ttcatctgcc
   120421 atcgtaaaac gactatttag aaagtataga ttttaaaaaa atacagtctt ctgatctttc
   120481 attaggcggc acacacggat tatagatgtt gttgtctatt tttggcataa acgtgtacaa
   120541 aatacattca tctaacgtat aaaactgttt tatagtttta gaattatcgg acaaaaaacc
   120601 aaatattgat gcagatacgt atacattttg tttaattaca catctccatt tttgtttaac
   120661 atcatgagtc gtgtcgttag gatctttaac tctataatca actctcattc caccggttga
   120721 ttttgcgtat tctagggacg cgttttctga gttaaattct ttgatgtttt cgtaattttc
   120781 atatattgag taagcctgta gcatcatgac gcacgctgct acagtgacaa ttacaatgca
   120841 cataatagta attgcatcca tttacactaa cgcacgaatg cgctcaaacg cttttgttat
   120901 ctcgtctata aaggcatcaa tgtttaaagc accaatatca attttgtgat aactatgtag
   120961 ccgcacatct cccccaaaaa agtttacaac acacatcgtt actaagtcag aaacgtacaa
   121021 cataccagac gttacgttgt acatagaaac tccttttact acttcttgat cgtccgtact
   121081 atgcgttttt agcttatgca atcttaccga ttgtataagc tcatcttcta aaatgtcaat
   121141 gatctcttta aagaatttag cagtatcgat ccacgaatac gtctctacgt aaaattttag
   121201 tttgccgttt ggagcaataa ctataaaagg caaatgccat actcgttcta acggaagaga
   121261 tggtttgatg ttgtcgtatt ccttgttaaa ctgttcaacg tcaacaaacg ttaagccgtt
   121321 aaccaagttt tcagaaataa cagtagaaga actaaaggca ataagttcaa tcgtctgtaa
   121381 attattttgc ctaaaatcct gaaaagaatg aagtaaagta ttttttaact cactaggttt
   121441 attaatttta gtaatcttat tatcttttat tatgtaataa tcaaaatcgt acattgttac
   121501 gatattaatt ttactttgct gaacgtactt aatatgaaca caaaagttta ctttgttagt
   121561 gattatgtct tttgtgtatt cataaaacac ttttttagta ggcatagctt caacagaagt
   121621 tagccactct tcgtttatag aagttgtagt gtttgataac acaactccta tacttaaact
   121681 cggccatctt attttattgc caaattcatg ttttataaaa gtagctaacg acttatttaa
   121741 gtcaattgct aaaactattt ctttcctgtg cattgttttt attagattta gttttttttg
   121801 cctttttatt tatgtctaaa agtttcaagt ttatagtatt aatcaactcg tggattatta
   121861 cggccgtaaa acctagttct gtatcgctgc actgagatat gcgctttagc agttgaccta
   121921 gagcagcttc gtttatatct tcatccattt aaatgtttgt aaagcatttt aaaaagcatc
   121981 gtagtaaata aaattgttag ttagttaatt ttttctttta caacaatcgg attagcctca
   122041 gaaacagttt cgtcgtcaga atccgaagag ttagattctt cttcaatagt ttttagaaaa
   122101 tggctgtctt tgactttaat gagccactcg atggtcttgt tcaacgatct gataatgaag
   122161 atgttaacgt gcaagctaaa gagcttacaa gcgattttaa catgatccca gaatccaccc
   122221 atttaataaa atatgacgtg ttcaatatac ttttgtttct tgaacaacgt cagtacgata
   122281 tgcacaaaaa actgttaaag actataacag acagtagtat aacgcttaaa aattatacta
   122341 taaacgtctg taagtattct aaaagtcaca taataaaaaa tatgtcaagt tgtggaataa
   122401 gacacagcga ctacgtcgtt attggaaacg taacaattaa tgactataaa atgatattat
   122461 tttatatgga tttattatac tggggtgtta ccgagcacgg aacagtatat aaactaggta
   122521 aagattttag gtcactgtct ctaaaaaaaa gagtttgttt tcctaactac gatagcccag
   122581 acatctcgta cgaaacagaa gacagcgaag aagatgtgga gtatagcttt tacaccgacg
   122641 aatcagaaga cgagtaccaa agcgacgact ctacgtttca gtgctttcct tagaaataat
   122701 ttctgatagc ttacttttca tgtgagaaaa ctgacttagc agaatagacg gattgagtgt
   122761 tttgtttaaa acgtcggcgt ctgctcggtc gtagcaaatt ctctgttctc cgttacaaaa
   122821 aacagaatct tctataatgt gaactcgtct gtccgttacg gcggatctca ttatgctcat
   122881 tgctcttagt agttcttttt tgctgccctt tatcgacatt gaccgtaaca tgttttctac
   122941 gtctgactct gaaacgttgc agcagcataa atgtgttatg ctagctcttc cgttaatggg
   123001 tacgtgtttg tacgtttggc acagcaaaat tatagaagta ttaatatgtc gtccgtaatt
   123061 tagcaatcct aaaagcgttt ttgattttgt ctgcatgtct cccatgtcgt ccaatattat
   123121 caaaaactta tttttgtgac tacctttagt agcgtacttt tctatcttca tctttgtgct
   123181 agacaaagca tactctaact cttctgcgct agtaaccttt tgtatatggt caggccacac
   123241 gtattggttg taagccggat tatacacagg caaaaacagt aagacgtgtt tgtacccttt
   123301 gaccaaagta gaaaaaagag ataacaggta agctgttttt ccagaacccg aaccgccaac
   123361 taaagccatt ctaaaaggcg cggataacaa acttgctcta ttaaaggttt tttctaacac
   123421 tctttccatt atttacagta actaaattac atttaacaaa aatatataaa tataagttcg
   123481 tagtattacg ttgtatcttt atcaacttcg tgaatatctt gcacgagtta taagaatgac
   123541 tgtaactgta gctgacgagc taccgtttta ttcaccaaat caacacaaac ctagacccat
   123601 gtctctgttt aagtctaaaa aacttgcgtc aatactttct atatgtttgc gagcaggttt
   123661 gattttgtgc ttaatagtgc ttatggcatt ggttgtttac ttgtcttatg aactaaacga
   123721 atgtagaaat agagaaacta aatgtaatat tacagctaaa ttattacaaa tgaatttaac
   123781 tactgaaaag tctataatgt gtatgcctgt tacaccatct attagtagcg catcatctac
   123841 tacagaacct agtacactgt ctgcttctgc atcactacca cctacaacta caactacacc
   123901 tacaactaca actacaacta cacctacaac tacaactaca actacaccta caactacaac
   123961 tacacctaca actacaccta caactacacc tacaactacc aaaaataaag aagacaaaga
   124021 aaaacaacaa caacaactag aaaatctaaa agaaaaaata aaatcaaact aactaactaa
   124081 ctatattaaa ctttaattat taaaaatcac tttacaaaac gacattaatt atgtaattag
   124141 attctaaact ttttttgcta ataaattcac ttactgtaaa cttatttact atttattaat
   124201 atggcgctgt ttagaaaact aaacagacaa agtaaaaaca aaattaaaaa atgttacaac
   124261 ccaactgccg tttttataac aattttatca ctactttcca gtattggtgc gatacttaag
   124321 tatactaata ttctcataac cgaagcttgt gagaacaatt ggatcgctgt agatggtttt
   124381 tgttattatt cggcaaacac gtcaagtaat cgaacacatg ctagcaattt atgtaaaaat
   124441 tacaacgcag atttactttc gtttcaatca tcgcatcatg tattagttgt ttatggatta
   124501 acaaacagta gtacatggat agatgttggt aattctttag aattgttaaa aaaaatagat
   124561 aatgatacaa tgacaccagt tgtacaaaat ttaacaatgt ttacaacaaa attaactgat
   124621 cagtgtgttg catttaacgg aactaatgtt attcttagta actgttcaac taatgctaat
   124681 gttatgtgtt ctaaaaaatt tttttctcac aaatggttta tactttaaaa ataaagtgaa
   124741 ataatagcgc tgttaaagta gttggtattg taaagatgcc aggttttaac aacgtgctga
   124801 caccgttagg tttaatctgc tgcgacagat atgattcttt ccagcagatg ctgcacgact
   124861 taggaatttc tagtatcact agctcaatcg gtgattattg gatagctcct atacacgcaa
   124921 caccaacaca catcagcgct attccttctt tggatatttc aagatgctat gtttcaattc
   124981 atggaaagtt gttgcacgcg tacgatgttt taagaagggg gtactccata gataagttgt
   125041 acttaattta tgaaaccaca acccgcgctc acatcttatg ctgcaataac tacgatcaaa
   125101 tttatattaa tgataggtca tttggtctca aattagaatc atttaaagat tacgttgaca
   125161 gtagagaaat tgacgtactg gaattatacg ataatggaaa ttatgatata attctttcac
   125221 cgtctctttc actgttgtct tctctaaaat ctaaatgcaa tatttgctta gcatctggaa
   125281 gttggattat cgcaagcacg aattcttaat tgtttttctc attcaaatta cagatttaat
   125341 aatattgaac tgtaaataca tctaaaggcg gctggtgcaa tggaggttac agtacttgcg
   125401 tacacatctg ttggcgtttc tgcatgcttg ttaatagtgt atatagtttt agaaataaaa
   125461 aattgttgta ataaaaataa gaaaaaaatt agagctaatt tggaagtgcc attagatact
   125521 tatagtatac agatttcaaa aacaaaaaac agctacgggt acgggagcag tagcgaaagc
   125581 agtacagaat gggaaacaga cagcgaagaa gaactttctg catcgagaat ttacgtaaat
   125641 cctaatagag gatccggcag acgagttact gctggaaata aaaaagttac aatacctcaa
   125701 cagttttctc ctgtagtaga taataataat tttaattcta ataataatta ctctgcgtct
   125761 gtttcagatg atcatgttgt aaatatccaa gaagaagaca attatttggt tccggacaat
   125821 gaaggtttaa acgaaaacac tagcgaagta caaaataacc aaaaagctgt agatgaagca
   125881 ttttctttcg tacagtgtat gtacgaagaa gacaatgaag gatactttta tgaaaattat
   125941 tgctgtacag acgcaacggc ttgtaaataa attgttttgt ctttaatata tgaaaaaata
   126001 atccatattt agtactcata agttagatat aggtagccat ggctctgttt ggtgcactaa
   126061 aaaagctgct atgtattaaa gttagtgacg atagagacca attaaacatt aacggtgaag
   126121 atcataactg tgaatataga ttagtaaata ataacaacaa atcagaaaaa gaaaataaaa
   126181 acatgaaagt aacttttgtt aactatagta tggcatcttc cactagttcg tgcagttctg
   126241 tgacaacgtc aacttttagt cttagttctt ttgatgaaga cgttgatgaa actacaccct
   126301 ttaacaacgc ttctctaaag ttttctagta atggttctag tggatctatg tcaaacatgt
   126361 taaataatga ttctgattaa gaaaaaataa cacaaacaaa aattgaaata ttattggttt
   126421 ttatagcaaa acggctaaaa acaaaaacat tatgtcgttt atctcttgtt tacggtcttg
   126481 ttctgacgat tatgaagaaa atcaagtggt tgttacaaat agcatcatat acactgacaa
   126541 aatgcccaaa aactttgttg agccaataga ttgtaaaaaa tataattatg tactctgtac
   126601 aacagtagat ggaaaatcta actcctctag gaatagaaga cgcagagtta ttaacaacgc
   126661 taatgtaaca aattccatca tattagcaaa acttagatta gtaaaataat acttttctta
   126721 aatctaatta aatacaaatt tgaaatatta aacacttttt tttagaaaaa aatagaaata
   126781 taaaggtata actttcaaaa ccaataaata ggactcaaca tgggtatcaa acaagttatt
   126841 ctgttgttgt ctctattctc tattgggtat tctcagtttc ttagtagtga ttttattaaa
   126901 tctccactat gtacaaaagc agttagacgt agaaactttg cagttcatgt atttgttgtt
   126961 aagaacaaaa ctgaagaata ttctccaggt tgtaatgtaa ctttgaacaa acacagagct
   127021 agtgtacacg gaggtggatt aaaaattaaa gttacatcaa acgattgctt taaagatttt
   127081 aaaaatgttt ctgaaaacat tgttaacaat acagtatccg ctctctttac aacaaataga
   127141 tatcctagtc ttgtgtactt acataattct gtttctaaat ttacatcacc ttctaaacta
   127201 tgtaatgtta gagtaacaat aatttgtgac agttttgtta gacctacaat tccaccaact
   127261 aacgaaacag aagatgattt taactttaca aacacagctc caacaaatgt aaaactttct
   127321 gacatgaatt ggcgtacaag tacagagtct aacataaaaa ctagactaaa agtaaacact
   127381 tacggtaatt gtatagaatc attttatgta tcattttctg tttttgaatt ttgtaaagca
   127441 gatgaaaaaa ctaacgggca tatggatgtg tttggaacga gacctacagt tactgagtac
   127501 aacatgccac agccaaatga caagtgctct gtagtagagt aatttttatt attaaaataa
   127561 attgaatttt tattaatagt tgttcgtatt agtctaaaat tatgactact gaatcactag
   127621 aaggttgttc ccctatggag tggattgatt atggtgaaat atttccagaa ttgaagaatg
   127681 aatcaacaac tattacagaa cataatcaag aagtaaactt agatttggat actataaata
   127741 tagttgatca gtccaagtct agagtagtcg tgcttaacaa aaatataaac gaacaaaaat
   127801 ctttaaggat tactatcgac attgaagaaa ttaacagagt caataactaa aaacatgtac
   127861 ttccctgaaa aagaaaacga cattattgag tttcctctta ttcctcctca aattccgcca
   127921 caagttgctc caagaacatc ggtacgaaat tcggttagag acagagcgtg tgctagaccc
   127981 tttaatcaat gtacttctat taatccgtgt aacagtacag gaattaccgt tacttactgc
   128041 gacgggtctc ctcgtactat agaagaggtt tatgtagtaa ccaatgatgt cacattaaga
   128101 gttttgttaa ataatgaaaa cattgaagtt ctaaaatgtg tatgcaaatt agcatgtgta
   128161 tcaatgggtt tacagcctaa gtttaagacg tacgaacaca ataaaaatct tttagaaatg
   128221 acggtaaccg gtaacggaat tagctggcca acaaagttgc tggctaaaat aagcaaagac
   128281 attgtttcag ttgacgaaac taagcagttg cgtgaaccgg tgattaagat taactagact
   128341 ttttttaaca aataaaaaat cataaatttt atcgacatta tttaatgctg ctttacaatc
   128401 atggaaagcg ttattagaaa cgactatttt tacaaagaaa caaagtacgt atttttaaat
   128461 tatctaaaca ctaatttgat tattttggaa gttacgggat acgtaaatat ttcaagattg
   128521 tgttcagaat ataataagtg tttttccgtt tggaaaaaaa taaacggtaa aaaaacaatt
   128581 agcaaaacag cagcatcact atgtttacct aaatctgcgt taatgtttaa ggtttataaa
   128641 acatcaaaaa ccgaactcat tcacggagtt tacatgcaca aagatttagt cggtcccttt
   128701 gcggaatgga tttctcctac tgccagcaaa atagtaaatc acatgttaat agagtattat
   128761 aattcttatg cactattttg gtcgttgaat acggatgaag actacattta cacagctatt
   128821 aagtttaaaa acaaagacag catcaagtac gaaaaatact ctgagatgtt gggtgatgtg
   128881 tttaccgaat acgaagaaaa atttaatagc tgtagagaaa taacttgtgg aatctgttta
   128941 gagtctccgt acgaccatga aaaattatcc aatcaatatt ttggagttct ttcttgttgc
   129001 aatcacccgt tttgtagaga atgtataaca gagtggtaca agaaaggaaa taaaacatgt
   129061 cccatgtgta gaagagagtt ctttaaaatt ttcataaaaa gatttttata acttaaaact
   129121 gaattggtaa tagatgtaat tataaaatct tgtaggtatg cattctaaat tatcagttgc
   129181 tgttgtatcg gtgtttttga tttacacgta cacttatgca acaacatttt tagtaggtcc
   129241 taacgaacaa ataaaaaacc aaacaattgg taaaagagtt tatcataata tttgcgttcc
   129301 tcccaacaat acatttccga ttaatgtaac gtgttattct aaagtagagt caacgagtaa
   129361 ttttgatagt atattttggt taaattgcga cgataccaat ttaacaacac gtggatgtac
   129421 ttttccgaac aaagaatgtt gcacgtctaa ctataaaaga attaatcaca ccatgtattt
   129481 gaatagtacc tgggatcacg aaataagaaa tactttaatt gttaggaacg acacaaatct
   129541 taaatcaata ttaaaatgtg tatatcaagg agtgaacgta ttcgtttcaa tgtttaatat
   129601 tacaaaattt ataaacgaag gagatcgtca aggtcacaaa gtatgcaaca ggtataataa
   129661 aacacaatac aactacatct acaacttttt ttaaccagta tgtttaaaaa aaatattttg
   129721 tatttttttt taaaattgaa ttggtaacga gtttagttag atctcggtag ttatgtattc
   129781 taaagcatta atagctgccg tatctgtatt ggtttatgcg tatgcgtatt caaatacaca
   129841 tgcaacttta caaaaaaata catataaaaa taaagattat gttatccgaa tgtgtgttcc
   129901 tcctaacgcg tcactgccga taaaaataac gtgttccgct aaagtaaaat caccaaatgt
   129961 ttttgataat ttgtattggt tagaatgtaa ccacactgaa tatcacttag gtgattgtag
   130021 ttttttaaga cccgcgtgct gtgacgaaca ttatagaaga attaaccgta ctagacttgt
   130081 tttaaaacag ccatgggatc atgaactacg aagtacttta attattaata atgatactaa
   130141 tattattgat ccaattttta aatgtgtata tagaacagaa ggtcttccta atattatgat
   130201 taacataaca aaattcataa acgaaagtga tcatcaaggt tataaagtat gtaaaagata
   130261 taataatact gattataata ttattagaac ggacgaagaa taattttttt taaactaaat
   130321 agtaataaaa aattgaagta gtattaaaca tttttaaaaa tggtagctat gaatactaaa
   130381 ttggttatag ctacactatc tgtgatcttg gtttatgaat acgtgagtac acaaactcca
   130441 ccagttaaaa acaaagatgt taaacttgat atttgcgttc cacctaacgc atcactgccg
   130501 ataaaaataa cgtgttccgc taaagtaaaa tcaaaaagta gttttgataa tttgtattgg
   130561 ttagaatgcg ataacaacat aagtaagtat gattatggtt cagatgacgg tcttgactat
   130621 gattatggaa gtggtagcgg tggagattta gaagaagatg atgaacccga taattgtata
   130681 tttccaaaaa gttcatgttg taatgaaaat tataaaagaa ttaaacctac taagtcaaga
   130741 agatggaatc atgaattaaa aaatactttg gttattagaa acattacaga aattaaacca
   130801 atttttaaat gtgtttatac tagttctaat ccttcattaa ttaaaagtat aaacgtaaca
   130861 aaattcataa acgaaggtga tcctcaaggc tatagagtat gtaaaagata tgacgatgat
   130921 catgcagatt ttgtatctaa actaaaacaa ctttttgagt aaaaaagagc tattattatt
   130981 agcttgtttt taaaaatgaa tttttatgct tagctaatac tataacacta accatggaca
   131041 caaagctttt tgccgtgtct gtgcttgtgc tgtggagctt tgctttttcc gaagattaca
   131101 cgattgactc tgttaagcag agtacttgtt tctctatcgg agctagtgat gttacgctta
   131161 gatgcttagc aaaggtaaaa gaacatacat cttttgacca aatgtactgg acagcttgtc
   131221 caactggaaa cccaaaacag tgctttttcc cagaagatga atgctgttct aaagtcacaa
   131281 aaagaataaa aaacaaaaaa cgcacaacta cgtcatacca ccacgttttg ttcagcgagc
   131341 taacaattag caacttggca aaatcatcag aagtttatag gtgtgtttat gaaagcaacg
   131401 gaggaacgtg gtctcgtctc ataaatgtta cagctgttct ctcaggaatg tctcctatta
   131461 tggaatgtga gagcactaga gaaaaagtag atgagttttg gactcactct actccgtacc
   131521 atgtattata aacaactaaa ttttttatta gctatataat taggcttgat actactattg
   131581 cattataaaa taaaaattga agatgtacaa caaaatgaca catctataca atggcgggcc
   131641 acttatcact tactcttata tcttgtgtgc tctttcattg tgtgacatat gtatcattag
   131701 taaaaacaga agaccggatg catagtagcg tctgtgtagt ttcttaccct tctgacatta
   131761 gcaattctct cactgttcgt gtgcaggcaa agctattggc agttaactct tttgacttta
   131821 tctactggaa ggaatgcgga tcgctaacca accctaaaga gtgcacgttt ccaaacgaca
   131881 acaagtgtgc gggaaaaatt ttcagagaga acaaccgtgg atactacact acagcattta
   131941 cgtaccacca ctctctaact agtgatctca ctattttcga tgttgacaat gcagctcctg
   132001 tttacgtagc taggtacatt gggtttgacg gaattgtaga acatgtaatc gacgtgttac
   132061 aaattctcaa cgaacgaggc agtgttgttg actgtgttga agaaactagt gaaactttct
   132121 ggttgtatga acacctaaag agggagaaac gcacagagct ataatattaa aatattttgc
   132181 tggagcgcga gctcgcgcgt aaaattgaaa cgttatatta gcatttttgt aacatttatt
   132241 atatctctcg agccagagat cctgaccttc ttccgcgcac tccagctaac cgaccagcga
   132301 tggcctgcga aaactccgga gcaaaatgga gcgagatcgt cgaggcggcc gacagcagca
   132361 tcggcaacga ggagcagcag cccggagcca gcgcgcccgc cactccgccc gtcagcgagc
   132421 gcgcggccgt ccccccggtg aacgccgacg agaggaagag gcgcaggagc cggagcaggt
   132481 gcggcggccg gtcagatgaa ggatgcacgc cgtgcagcaa gcacccggac tactccaagc
   132541 tccgcgtctc ggtccgcaac tacgggagct gcaagcagct gacgagcgtc ttcagcgcgg
   132601 aggcgcaccc caacgagctg acgagcctca acttctacaa cgagcctgcg atgttcgcgc
   132661 ccgactcgta cgacaagacg acgctgccga agctgacctg cgtccgcgaa ggaaacctgt
   132721 tcgcgggaag cgtgagactg actccgtgca ggttcctctt gcgcgggtcg ttcgtgtgct
   132781 ggatcgaaat ggggtacaac tgcgtacgca tggcggccgc taacgtcgga ctgaccgacg
   132841 tcaccatctc tcactcccag acgccagaac agatccggca cgggtcgcag acctgcagga
   132901 tcagcttcgc cgttcgggcc agcgggactt cttgggttct tccgtttctg cagacgctcg
   132961 agaccgtcgt ttccgaaagc gatcctcacc cgcgcatccc cggaaagttt aaggtcactt
   133021 tcatcgaccc tgtcgaatcc gagtaacgga gcagtcgacg agcagtcgta cgcgattgct
   133081 gtttttagca gtttagtttt tctatctcgt aaaaaacacg taaaataaag taagtgtttt
   133141 ttaaaaatct tttttttatc ctctataaat atttaaaatt atactatata gaaatcaaat
   133201 agttgattat atttatttgt actatgtcaa taaattaaca actttgtttc ttaatgtata
   133261 attttaaata tttatagagg ataaaaaaaa gatttttaaa aaacacttac tttattttac
   133321 gtgtttttta cgagatagaa aaactaaact gctaaaaaca gcaatcgcgt acgactgctc
   133381 gtcgactgct ccgttactcg gattcgacag ggtcgatgaa agtgacctta aactttccgg
   133441 ggatgcgcgg gtgaggatcg ctttcggaaa cgacggtctc gagcgtctgc ag
//
DBGET integrated database retrieval system