GenomeNet

Database: RefSeq
Entry: NC_032168
LinkDB: NC_032168
Original site: NC_032168 
LOCUS       NC_032168               3567 bp    RNA     linear   VRL 13-AUG-2018
DEFINITION  Hubei insect virus 2 strain arthropodmix13736 hypothetical protein
            2 gene, complete cds.
ACCESSION   NC_032168
VERSION     NC_032168.1
DBLINK      BioProject: PRJNA485481
KEYWORDS    RefSeq.
SOURCE      Hubei insect virus 2
  ORGANISM  Hubei insect virus 2
            Viruses; Riboviria.
REFERENCE   1  (bases 1 to 3567)
  AUTHORS   Shi,M., Lin,X.D., Tian,J.H., Chen,L.J., Chen,X., Li,C.X., Qin,X.C.,
            Li,J., Cao,J.P., Eden,J.S., Buchmann,J., Wang,W., Xu,J.,
            Holmes,E.C. and Zhang,Y.Z.
  TITLE     Redefining the invertebrate RNA virosphere
  JOURNAL   Nature (2016) In press
   PUBMED   27880757
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 3567)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-DEC-2016) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 3567)
  AUTHORS   Shi,M., Lin,X.D., Tian,J.H., Chen,L.J., Chen,X., Li,C.X., Qin,X.C.,
            Li,J., Cao,J.P., Eden,J.S., Buchmann,J.P., Wang,W., Xu,J.G.,
            Holmes,E.C. and Zhang,Y.Z.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-SEP-2016) Department of Zoonoses, National Institute
            for Communicable Disease Control and Prevention, Chinese Center for
            Disease Control and Prevention, Changping Liuzi 5, Beijing, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to KX884581.
            
            ##Assembly-Data-START##
            Assembly Method       :: Trinityrnaseq v. 2.0.6
            Sequencing Technology :: Illumina
            ##Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..3567
                     /organism="Hubei insect virus 2"
                     /mol_type="genomic RNA"
                     /strain="arthropodmix13736"
                     /host="arthropod"
                     /db_xref="taxon:1922898"
                     /segment="4"
                     /country="China"
                     /collection_date="2013"
     gene            243..3407
                     /locus_tag="BU150_s4gp1"
                     /db_xref="GeneID:30671519"
     CDS             243..3407
                     /locus_tag="BU150_s4gp1"
                     /codon_start=1
                     /product="hypothetical protein 2"
                     /protein_id="YP_009329905.1"
                     /db_xref="GeneID:30671519"
                     /translation="MGDTANKLGLGFAPPKRQFSLKNIVQASANAANVISSSKPIKTQ
                     PLGVGSPLVVTAPPPLICPSKPTNTIAKDIASHVPTQLESIPLNVQSSNTDLLKSKMH
                     QRLRIISFQCVSSNAIRQIDGQHGVRKVIFAHQVLQCGCNQIPSHNVKIRQLFDDSKS
                     TPNKTHVTIKKIKEYDAETVLNEIIQYCDQHSHHEKHFTPKSPTIMISGQLKYNDHNL
                     LRRRFALVTLIGNRPQDVVRLNEYIARYNLESYASSILETKPGECLIVDQSETYHIFA
                     QCMQSADELPQLSIIQQCLTSASYELLHLPCKAIIIPTICQLYGLNHFTQVNDILMRM
                     IDQTFDYHTIPVVCTLDGPNAHLSSHQHDAYSCVPSLYAHKWFERHEHKLIASLDIIC
                     NHLITGTSPNPNVTKPPLPTKPKAIKQDVKPKSDVHPDLDHITTYTSQQPIPPPTDTP
                     VVNKDSPEKVMSESEQNYLFRRWNTLHETNYNYIYPNNDYKEVLCIILPPGTGKSSIL
                     ANQPLLIEADEAFTKQDFVDLNTKNDGLVYSRIVQRCIKEGCYDNKIVMVHSRQHAQL
                     VGMTIIGSFSICANDLTNSDRFQPYMLACAHEATLNMLHCEFETYATFAIWFIDVVRP
                     ITDVNLLSNVIWEKCHTVSENLDKFRCANASNQQKLDWERLYHKFNAHVGYDRDEGST
                     APVTTAEVHPPPPPNDEVDSVNERQPIPADSKSDDPIASETDAPILTSPATVHSDVSD
                     LPITNENHSSIDLLSENQRLLDEIKELREMNANLSKTISEQKDAIASRDKLVRELTAQ
                     IWELTGTNNKHVAENNILRNSLRDCCSNVDDLKRELCTLNEQCQSNIQTSHAELSPIA
                     MQQAQQTPPPAMPPIAEEQSEDILARCLYSEIIQPHIADPTDHDAVDRFKERLRQCLT
                     KSAITKPKRAMTQTISTEATDGVMRRSFSVSCTHEHPKSADSGICSNDLRDTALFRIS
                     GLCRRLDQFSTQELSYFSMHLNYVQNLLLTIEKLLPEKAYMLPVYSPFFDSFLPTLGN
                     YWSGSFKRVLYTDSPLSTLCDGLY"
ORIGIN      
        1 ctcccgggac ataaaagatt tgtttgtttg agaattccat gtgtttactc gtgtgattgc
       61 taggtaccta tgcgcacatt ccctacgaac gctcttttat aactattgtg ccttactata
      121 ctatacgtac ttaacctaaa tatcttatac ctacctatac cattaattta gttgtatcag
      181 tagtcttaag ttgtatatta cgtacttact attaatattc atttgcttag ccctcatata
      241 ccatgggtga tactgctaat aagttaggat taggatttgc tcccccaaag agacaatttt
      301 cactcaagaa tattgtccaa gctagcgcta atgctgcaaa cgttatatca tcttccaaac
      361 ctattaaaac tcaacccctt ggggttggat ctccattagt tgttacggcg cctcctccct
      421 taatctgccc atctaagccc actaacacaa ttgccaaaga tatagctagt catgttccca
      481 ctcagcttga gtccattcca ctaaacgtac aatcatccaa cactgacttg cttaaatcta
      541 aaatgcacca aagactacga attatctcat tccaatgcgt gtcatctaac gctattagac
      601 agattgatgg tcaacatggt gttcgcaaag tgatttttgc ccatcaagta ctgcaatgtg
      661 gttgtaatca gattccctca cacaatgtaa aaatccgaca actcttcgat gatagcaaga
      721 gcaccccaaa taagacccat gtaaccatca agaaaatcaa agagtatgat gcagaaactg
      781 tcttgaatga aatcattcaa tattgtgatc aacatagcca tcatgaaaag cacttcacac
      841 caaagtctcc tactattatg atatcagggc aactgaaata caatgatcac aacttattgc
      901 ggcggagatt tgctctagtt acgttaattg gaaatcgccc ccaggatgtc gtcagattaa
      961 atgaatacat agcaagatac aatctagaat catacgcatc gtcgattctg gaaactaagc
     1021 cgggtgaatg tttgattgtt gaccaatctg aaacttacca tatctttgcg caatgtatgc
     1081 aaagtgcgga tgaacttcct cagctctcca taatacagca gtgtcttaca tccgctagtt
     1141 acgagcttct acacctacca tgtaaagcca tcatcattcc taccatttgc caattgtatg
     1201 gtctgaacca ttttactcag gttaatgaca tacttatgcg gatgattgat caaacgtttg
     1261 actatcacac tattcctgtt gtttgtacgt tagatggccc taacgcccac ttatcatccc
     1321 atcaacatga tgcttacagt tgtgtcccca gtttgtatgc ccataaatgg tttgaacgac
     1381 atgagcataa attaattgcg tcacttgata tcatatgtaa ccatcttatt actggcactt
     1441 ctcctaaccc caatgtgact aagcctcctc ttccaactaa gcctaaggca attaaacaag
     1501 atgtaaaacc caaatctgat gtacatcccg atcttgatca catcacaaca tataccagtc
     1561 aacagcctat tcctcctcct actgataccc ctgtcgttaa taaagacagt cctgagaagg
     1621 tgatgtctga gagtgaacaa aactatttgt ttcgccgttg gaatactctg cacgagacta
     1681 attacaacta catttatcct aacaatgatt ataaagaagt actgtgcatc atcttgcccc
     1741 caggtactgg taaaagctcc atcttagcaa atcaaccttt acttatagaa gccgacgagg
     1801 catttactaa gcaggatttt gttgacttaa acaccaaaaa cgacgggtta gtgtattcac
     1861 gcatcgtcca gcgatgtatt aaggaaggat gctatgacaa taaaatagta atggtccaca
     1921 gtcgtcaaca tgctcaattg gttggtatga caataattgg ttcctttagc atctgtgcca
     1981 atgacctcac taacagtgat agatttcaac cctatatgct agcatgtgct catgaggcaa
     2041 cactaaatat gttacattgt gagtttgaaa catatgctac ctttgcaata tggtttattg
     2101 atgtagtacg tcccatcacc gatgtaaatc tgttgagtaa tgtaatctgg gaaaaatgtc
     2161 atacggtgag tgagaatcta gacaaattcc gttgtgctaa cgcctccaat cagcagaaat
     2221 tagactggga gcgcctatat cataagttta atgcgcatgt aggatatgat agggatgagg
     2281 gttctaccgc tcctgtaact actgccgaag tccatcctcc acccccacct aatgatgaag
     2341 tagatagtgt caatgagcga cagccaattc cagctgactc caagagcgat gatcctatcg
     2401 caagtgaaac tgatgctcca attttaactt ctcctgctac agtacatagt gatgtgtcag
     2461 atttgccgat caccaatgag aaccactcat ccatcgactt gttatctgaa aaccaacggc
     2521 tgttagacga aattaaagaa ttgagagaaa tgaatgctaa cctaagtaaa accataagtg
     2581 aacaaaaaga tgctattgcc tctagggaca aactggtgcg tgagttaaca gcgcagattt
     2641 gggaacttac aggtactaat aataagcatg tagctgagaa caatatccta cgtaatagct
     2701 tgcgagattg ttgttcgaac gttgatgatc taaaacgtga gctgtgtacg ctgaatgaac
     2761 aatgtcagtc caacattcag acgtcacatg ctgaactttc acctattgcg atgcaacagg
     2821 cacaacagac gccacctcct gctatgccac ctatcgcaga ggaacagtct gaggatattt
     2881 tagctcgatg tctctattcg gaaatcattc aaccacatat tgctgaccct actgatcacg
     2941 atgctgttga ccggtttaaa gaaagactgc gtcagtgtct caccaaatcc gcaataacca
     3001 aacccaaaag agctatgacg caaactatct ccactgaggc tacggatggg gttatgcgca
     3061 gatctttttc ggtatcgtgc actcatgaac atcctaagag cgcggatagt ggaatttgtt
     3121 ccaatgattt gcgtgacaca gcactcttcc gcatttcagg tttgtgcaga cgattagatc
     3181 agttttcaac ccaggagtta tcttactttt caatgcattt aaattatgtc cagaacctcc
     3241 tcctaaccat tgagaaatta cttcctgaga aggcgtatat gttaccagtt tattcacctt
     3301 tctttgattc atttcttcct actcttggta actattggag tgggtcattt aaaagagtat
     3361 tatatacaga ctcacctctc tctactctct gtgatgggct gtactaacca atttgaatga
     3421 aacgatttac atatgtacca actatcaaca ttggggccaa cattctttta aattaacaat
     3481 cctataaaag ctaggtcaaa gatgcaatca gcaacgacta tatcacgcgg aggttatcaa
     3541 acaaggcagg ctctgggagg cacaccc
//
DBGET integrated database retrieval system