GenomeNet

Database: RefSeq
Entry: NC_050727
LinkDB: NC_050727
Original site: NC_050727 
LOCUS       NC_050727            1735737 bp    DNA     linear   CON 10-NOV-2020
DEFINITION  Torulaspora globosa chromosome 1, complete sequence.
ACCESSION   NC_050727
VERSION     NC_050727.1
DBLINK      BioProject: PRJNA670758
            BioSample: SAMN14605265
            Assembly: GCF_014133895.1
KEYWORDS    RefSeq.
SOURCE      Torulaspora globosa
  ORGANISM  Torulaspora globosa
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1  (bases 1 to 1735737)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1735737)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1735737)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP059246.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1735737
                     /organism="Torulaspora globosa"
                     /mol_type="genomic DNA"
                     /strain="CBS764"
                     /isolation_source="soil, St Thomas, West Indies (strain
                     received from Westerdijk Fungal Biodiversity Institute)"
                     /type_material="type material of Debaryomyces globosus"
                     /db_xref="taxon:48254"
                     /chromosome="1"
                     /country="USA: Saint Thomas, West Indies"
     gene            complement(<3952..>5793)
                     /locus_tag="HG536_0A00100"
                     /db_xref="GeneID:59323290"
     mRNA            complement(<3952..>5793)
                     /locus_tag="HG536_0A00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280973.1"
                     /db_xref="GeneID:59323290"
     CDS             complement(3952..5793)
                     /locus_tag="HG536_0A00100"
                     /inference="similar to AA sequence:RefSeq:NP_011813.1"
                     /note="similar to Saccharomyces cerevisiae YHL050C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136868.1"
                     /db_xref="GeneID:59323290"
                     /translation="MKLGYIIIDEFHNLLSETYRSSRFKRMRNLNFDAFEKTLFFSAT
                     APPDIAEGALHQIGFKGLERAPTSVEQVTDQVKITPKQPCANLVAEMPLGHIHKEFKS
                     SDDPKLEAVKMLRGLFKRRPNSKAIVVVNEISLVEALASEWAPLFNLVWVHGNLSSEQ
                     KAARARSFMNDGSKELLIGTKLVTEGISIASLKMVIIINFSPNILEFIQMIGRLRESG
                     LCFLLRGEGRYPSYNDPLLPAVKEACLAAQIRKFYNLELVPGSNPHSGCCEAFETLPV
                     ATQHLQGDVDIMADVVGTDGYVSRTSGGLTSANNNLPFRTADAKRFKSNYHGWEGFSE
                     IFYFLGFRGYALSNLFLYGIDIHFCPWGVFTAYGKCKDCGACLCPRPDGTAETQGKSY
                     RRIAIEVLAVRRMLLDDEQFEEHLKEIEPYYKDPFPYLTEFHKEVTLEMPIVWYLNLL
                     SSKKPIRALESERGVRLSGVFSKTAREIYETYRCLWHRLSEQQINVAQLFFNFEWTAL
                     RQIWEHKDHTEELVECPEIEQIFGRIRSQSSGRFQGAGYLKEQFGEQHLKRKRGYRCS
                     TSSFPDWKLYLLMQIGLFYNASLMKQVKLLVEQTYLHEEVQFPIWKK"
     gene            complement(<6882..>8156)
                     /locus_tag="HG536_0A00110"
                     /db_xref="GeneID:59323291"
     mRNA            complement(<6882..>8156)
                     /locus_tag="HG536_0A00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280974.1"
                     /db_xref="GeneID:59323291"
     CDS             complement(6882..8156)
                     /locus_tag="HG536_0A00110"
                     /inference="similar to AA sequence:RefSeq:NP_011814.1"
                     /note="similar to Saccharomyces cerevisiae YHL049C"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136869.1"
                     /db_xref="GeneID:59323291"
                     /translation="MTRCYDLASLTPKRCAMRSCFNSFVYKESLIKKFRRDTIKQYSV
                     RIAPILFLLLRVNRLSIFAAYKKPRGSAGYTEIDTGKLQTAFADKESRDIDVTYLSQV
                     CVDMMKGKDTLGHVLETLVMCCAIKFGSSVPSRFIPDDSDNEEDEDEDDETHKVGTPA
                     AGNDDMKGIRNPKSARGIRKTLDSLKAFLTFACMCSAADDDLFDDESGTPMWKWITTV
                     YHKTVEEEENLNRYQISLVPSAQGIMILGKLFDRSYIRDFYFECHSVFRENFEKLDKL
                     FFMPTVDQIAGAILRNRDVSFREAKRGTDKFWDGGSLLHLIPVEYRQVLMPKFRREKH
                     GRLSEAVNKQVAHAVDEIACTLMWMVYFAAGFPYRFPELQLLAFSGPQRNVYVEDVSR
                     RVQLFCDYNKTGATAPILKTTSPPLVLFHCRS"
     gene            <8944..>10389
                     /locus_tag="HG536_0A00120"
                     /db_xref="GeneID:59323292"
     mRNA            <8944..>10389
                     /locus_tag="HG536_0A00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280975.1"
                     /db_xref="GeneID:59323292"
     CDS             8944..10389
                     /locus_tag="HG536_0A00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136870.1"
                     /db_xref="GeneID:59323292"
                     /translation="MSPYSPQVQELLEWDKEHLWHPFSTLSNPFPVYPVRSAEGCQIT
                     LDTRDHQKVVEAMSSWWCVIHGYDNQELKDAMKQQIDQMSHVMFGGLTHKPAVELGKK
                     LLRVIDHPRLHSIFFADTGSVAVEVAMKLAIQYNYCKGSKKSKFLTIRNGYHGDTFGA
                     MSVGDPSNPMRTFFKEHLPQNIFVKAPTLLHTLPTSNICLENPELFKESAKWHPQDFA
                     EFQKAIDEHHDSICAVILEPLLQGAGGVRLYHPQFLIEARKACNKYGIPFIMDEVATG
                     FGRTGEIFAFKHCREYQRLSNVPPEDQVDVFPDILCVGKGLTGGSLSFSAVVTTAEIA
                     AGVSMSDGPTRGYFMHGPTFMANPLACSVASKSLDILLRGEWKIQVMAIEKQLFQELY
                     LDITRDERLMKSVVDHVRVAGAVGVVQLQDPINVPWFQEQCILRNVYLRPFKNICYVI
                     PPFTISREELKVVTKAIKEVLNVCLEKKYQA"
     gene            <10657..>11688
                     /locus_tag="HG536_0A00130"
                     /db_xref="GeneID:59323293"
     mRNA            <10657..>11688
                     /locus_tag="HG536_0A00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280976.1"
                     /db_xref="GeneID:59323293"
     CDS             10657..11688
                     /locus_tag="HG536_0A00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136871.1"
                     /db_xref="GeneID:59323293"
                     /translation="MSTKNLHLFDTFEKDGKKFARIPKHTINAGTSPKYSDLVVKDKS
                     DFKAIVEKLELYGLCVVKHYLEPETCEHIKKELEPHYFRHQEWNGSPFPKETTVVTRA
                     ALASPTCMDKIALDDTFYKVSYHFMSESNVFWIGDGKLRRSETDVQLYSSIIYRVGAG
                     AGDQMYHREDMALHNAHPRREKYHYGDDVQVGLAVALTPMNKTNGATRAIIGSHLWGP
                     LDGPYEFDPQRELYLELEEGDGTFMLGSTYHAASSNHSDADRIGAFFFMSKTYLRQEE
                     NYHADMEPAFFENMSFKALKILGLHTSLPFCGHIGYRSPAFVLNPKLKEASQAGKGNY
                     TEVIYPVFE"
     gene            complement(<11733..>13445)
                     /locus_tag="HG536_0A00140"
                     /db_xref="GeneID:59323294"
     mRNA            complement(<11733..>13445)
                     /locus_tag="HG536_0A00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280977.1"
                     /db_xref="GeneID:59323294"
     CDS             complement(11733..13445)
                     /locus_tag="HG536_0A00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136872.1"
                     /db_xref="GeneID:59323294"
                     /translation="MPPSPQYPFLRSEDKSSSTSHIELGEVPAKEVYEDPSNKKLDLE
                     EDAGGKVSEFLDTNLNLGQEIRALDDLGNSHKRERSFWGKLAALEFEVHFENKNHMVI
                     MLGAFAAFAGILSGIDQSIISGASIGMNKMLHLSTHQASLVSSLMPLGAVAGSILLTP
                     LSEYFGRKKALVISCVFYTIGAIICAAATNHHEMYAGRFLVGVGVGIEGGGIGVYISE
                     SVPSSVRGSLVSLYQFNIALGELFGYIIGVIFFDVKGGWRYMVGSSLVFSTILFVGLL
                     FLPESPRWLMHKDRVGESWNVWKRLRDVNVEANKVEFLELRQAADQDRQLRSSETHFQ
                     SLFNLVCVPRNRRALVHSSIMIALGQLTGINAIMYYMSTLMRQIGFSEKRAVAMSMVG
                     GAALLIGTIPAILWMDKFGRRTWSMTIVLFSIGLVLVGVGYLYQDSNLIAAEGVYLTG
                     QIIYNMAFGSYAALTWVLPSESFSLGTRSVGMTVCSALLYLFAFTVTYNFERMQSAFT
                     YTGLTLGFYGGIAIAIGIPYQLLFMPETKNRTLEEIDDIFEKPVRQIVRENIAYLRKG
                     KLTY"
     gene            <14169..>15197
                     /locus_tag="HG536_0A00150"
                     /db_xref="GeneID:59323295"
     mRNA            <14169..>15197
                     /locus_tag="HG536_0A00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280978.1"
                     /db_xref="GeneID:59323295"
     CDS             14169..15197
                     /locus_tag="HG536_0A00150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136873.1"
                     /db_xref="GeneID:59323295"
                     /translation="MSSAETNHSDENGFISIGEPGKFEATIARLGATLVDLKVNDQSV
                     VLGYPTANDYVSDRGNYIGATVGRYANRIYKGVYTLPDGPHKLAVNNCGNANHSSISS
                     FHLKTFEGQPKRLSTNVYTLELSLLDDHTRCNEFPGDLQVTVKYILDAAVMTLDFEYQ
                     AHLVSGEATPINMTNHTYFNLNKAKSEASISGTAIRLCSNRALEVSEGALIPTGKIIE
                     KEVATFVSPSPTVLGDGGPKFDTSFIVNANQDLKSTDSVSVNKLVPILKAYHPESKIS
                     LEVSTTEPTFVFYTGDNLFDNFQPRAGFCVEQGRYVNAINRDEWRDCVLLKKGELYTS
                     KTQYRFQT"
     gene            17809..17882
                     /locus_tag="HG536_0Atrna1V"
                     /db_xref="GeneID:59324259"
     tRNA            17809..17882
                     /locus_tag="HG536_0Atrna1V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59324259"
     gene            <19069..>20382
                     /locus_tag="HG536_0A00160"
                     /db_xref="GeneID:59323296"
     mRNA            <19069..>20382
                     /locus_tag="HG536_0A00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280979.1"
                     /db_xref="GeneID:59323296"
     CDS             19069..20382
                     /locus_tag="HG536_0A00160"
                     /note="HMRa2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136874.1"
                     /db_xref="GeneID:59323296"
                     /translation="MVSAVECTLPKTSDVDNGSKDFLFLRTEDKKQANSIKYKFVGQR
                     VCETSKLAEFSLSDEASTKAGSSTHAIGRPRNCFIIMRTLVHSVVLRCLKRCDISSLT
                     HVSAITSQLWGKNDGIFQLYFELLSQLEEHWHLNIYPEYRYHKVNKISRQLENKLVYQ
                     NMLNRMRFFTASSLSSKLEGILSSARASAADTAADAPAAPGVPLAADPVGSTYAYSSL
                     SSYQDGVNHQLPSRQQNRPVTSSVEPATNRQLGQQQDPANVPDRNPFKTHHDRCFRPK
                     SMKSDTKRVRKQRCTVKMQGNMCDRIKLGSEKKERRATAHPSKRLKVSGVTRTGGCRS
                     PKRDTKSLCPITIGQKEDPCEMALDPSLSVEKYGSFISQHNQATGSPLRGDPSRCDVS
                     STALASVHASAKNMSSLGFDSSSLHSKLRCMVGTKQHLEVQDLYV"
     gene            complement(<20949..>22355)
                     /locus_tag="HG536_0A00170"
                     /db_xref="GeneID:59323297"
     mRNA            complement(<20949..>22355)
                     /locus_tag="HG536_0A00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280980.1"
                     /db_xref="GeneID:59323297"
     CDS             complement(20949..22355)
                     /locus_tag="HG536_0A00170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136875.1"
                     /db_xref="GeneID:59323297"
                     /translation="MISSRRYPTITVLEGRFTIIDGFLVSLSSPRVDQLAIGQALSHE
                     TKEKVRRLVSLYKPDMLLKMERMSSNFYITGHSLLFELAKDKVYVNFVRTKGKYYCRK
                     TDPKSATHVALEIRVARRRGPRRPRYVVYEMPLEQSPAFAAVIQQQSKDLARIDSPKM
                     KGAFGLSATGNDTAKPDIKLLSEKELLQCVRNPVSPRIIEQVPGMSQETRRQTSDRFR
                     NILLKFCERQSMHKLEKMKKVLLEFPDRSDEISELYRDGARQIVKNLTLASERIFPAF
                     LDRIVDGDAGSEKISDRFVIVDRLLIDLRSRMVINPEGANFLNTATVEEKARLSKHRL
                     MSWAAVESAKEPMVIRTQRLFDVIDHTLKEFRAGAKNSSKETSADGLPNPFVWRQIML
                     HFENLGSKCVIMESVRETAGSTPEGKFLESSKLPPGTDGSISFVDLAERFKRFCSYEE
                     QLALYVETVGLLVGRKFM"
     gene            <23885..>24211
                     /locus_tag="HG536_0A00180"
                     /db_xref="GeneID:59323298"
     mRNA            <23885..>24211
                     /locus_tag="HG536_0A00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280981.1"
                     /db_xref="GeneID:59323298"
     CDS             23885..24211
                     /locus_tag="HG536_0A00180"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136876.1"
                     /db_xref="GeneID:59323298"
                     /translation="MKVDSKGKILLHFLNSRPCTVNALSSPDAELNDLSIDELAQKGY
                     FPNFRKQYIENKNGTPVARILKKGPYYWLSSKYLALPSPERNHGNMNINTMRYSLDYI
                     HRLFGM"
     gene            complement(<24907..>26493)
                     /locus_tag="HG536_0A00190"
                     /db_xref="GeneID:59323299"
     mRNA            complement(<24907..>26493)
                     /locus_tag="HG536_0A00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280982.1"
                     /db_xref="GeneID:59323299"
     CDS             complement(24907..26493)
                     /locus_tag="HG536_0A00190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136877.1"
                     /db_xref="GeneID:59323299"
                     /translation="MASTSPSSSEVDVIPITAKEKNSVSTSRIKDEYKVVNSRDADVT
                     LEFLEEHDSQVAPITEEQERRLRRKVAFIVVGLTFLVNITMYSDKATLSYASIFGLWE
                     DTGLTQSSYSNANTLFYVGYIIGQANLIFVQKFPIGRVVLAMCAIWTIIIFLHCVAYN
                     EQGVIALRFFLGFVESVALPSLNMTMNQFLTPDEKNSYGPIWYISSIGVTIPVGFIAY
                     GILHAKSSVPIWKLFFIIIGGCTFLLTILVALIYPNNPTDAKFLTTEEKVWVIRRVQQ
                     SSKSSIEQKVIKKYQVIEAFRDPITWLFGLFFLFQQLANNLAYQQNLLFEGIGNISNL
                     SSTLVSVAAGGFASVCAVIATVFLLYKRNYTAFSVVFWSVPSFAASIALVTIDWDKKI
                     ALLAMLCLACPLFGIPWILMFSWNTTSCGGYTKRLTRNAVVMFWYSVANIISPQIWRS
                     KDAPRYVPAWIVQIVLSFFLAPLIALVIWYLLRRRNDERLAHASEAQGMVEIDGQAIE
                     TNIAMLDLTDLENKAFIYPL"
     gene            <27549..>29435
                     /locus_tag="HG536_0A00200"
                     /db_xref="GeneID:59323300"
     mRNA            <27549..>29435
                     /locus_tag="HG536_0A00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280983.1"
                     /db_xref="GeneID:59323300"
     CDS             27549..29435
                     /locus_tag="HG536_0A00200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136878.1"
                     /db_xref="GeneID:59323300"
                     /translation="MLRRRFNFFLVLVLVAVVLFMKSPSEWLSSGRSSKRRWQRNPQV
                     VPRKSDLLHVDISQELNQRDWDLSPVNLRTIKQKYEDEEIVGFVSNLDVKKVLEKKAR
                     TAKNHDYDGVLKGTLSAKEYQDLITCPDLAYRSKIQHSANKKLLKDDLAALRYELITN
                     PSFLSKEVTGEDEQEMSVPDIIHKKWFQFGSSAVWLESEQCYVVYSRVIYSSVHVRNR
                     PHVSLVRAQAFDKDWNELKDKWIPYVDVPLGKDMDRVIKEIDDALGITDCSALKSNHA
                     AYDACMVENTKNSLEAKRRRESILSRYYMKYPTILNIPFKTDGDWKGPEDPKVVLRKT
                     DQSEEPVVLYNIHDDDLDRRIMVAYMPHRKIEPMVKLSVNGREQRGMEKNWTPFFHHE
                     TGESVMSRGFIHFIYSFSPLEILKCSLNDGICSLVFDADTLKVSDANKFDGIRGGTQY
                     IPLPAILPRVSEDQIWIGFPKQHIENCGCGDFYYRPMLGVLVERHGVYSQELMVPALG
                     FNMDVLSWDLQTTECKDTNILSPNSIGYWEVVRQDPQTKKYEDYLTLTVSEADSNTKV
                     ITLKGVLNFVLGVYQEKDIKEKFEIDDQSDSIVGHTLHCLVHSAFDQCKSYGEAHPGP
                     AEGE"
     gene            complement(<29635..>30336)
                     /locus_tag="HG536_0A00210"
                     /db_xref="GeneID:59323301"
     mRNA            complement(<29635..>30336)
                     /locus_tag="HG536_0A00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280984.1"
                     /db_xref="GeneID:59323301"
     CDS             complement(29635..30336)
                     /locus_tag="HG536_0A00210"
                     /inference="similar to AA sequence:RefSeq:NP_014045.1"
                     /note="ancestral locus Anc_5.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136879.1"
                     /db_xref="GeneID:59323301"
                     /translation="MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKRHA
                     VLVALKRNADELSSYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRK
                     LSVERAGHLLCDKAQKNTQSYGGRPYGVGLLIIGYDRSGAHLLEFQPSGNTLELYGSA
                     IGARSQGAKTYLERTLDEFLEIEDPQELIKQGVEALRQSLKDETLTINNLSIAIVGEN
                     MPFTQYDGDAVSPYL"
     gene            <30533..>32350
                     /locus_tag="HG536_0A00220"
                     /db_xref="GeneID:59323302"
     mRNA            <30533..>32350
                     /locus_tag="HG536_0A00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280985.1"
                     /db_xref="GeneID:59323302"
     CDS             30533..32350
                     /locus_tag="HG536_0A00220"
                     /inference="similar to AA sequence:RefSeq:NP_014044.1"
                     /note="ancestral locus Anc_5.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136880.1"
                     /db_xref="GeneID:59323302"
                     /translation="MAVGWNSVILKQDIRLVAEMLTNWILSIVYATLDRIPPVVWQVI
                     HVISDIYFFWIHKLLSYLRPNSRVLYYEASKELEQCTTYEDWYAKATIVDEITGANLW
                     RRNFFSVRYDFNAVLEQHSHLRRALEAGDIEAIKDKLLANGPCMLRNFGGIVDRRLFT
                     KSLIGTKLLIEQYLDRIIEGLDVLDRAGTSTYFFQRCKLSLGTTALILQGGSLFGMFH
                     LGVIKRLFFQNLIPNVISGSSMGSCMASLYACMSNQELRRLLHGENILNMIKLDVELL
                     RSCGYGNVDQHLNLGTLIQNLIHHGYSQDIYLFIQFVLKYIVKDLTFEEAFQNTGKIL
                     SIVIHPTDRSCPNLLNYVTAPNVLISSAINCSLGSGVISNDTKLLCRNLDNEIVSFLS
                     EEKTKITKFLAPENATVLANSESPYTRLTELFNVNNFIVSLARPYLAPLVVNDLKHEI
                     KTSRYYFYKHYPDTQATVDLSELGFPQLNFTEMEPLAFKFKYHLERKLKNIATMEFRH
                     RMEMLDNLGLLSSWIKRLTIDEKTPRSATEITIVPRMKSLSLTRIIEGQLDNIPYGIT
                     CGEQSTWPVLSLIRTRSSVEFKLDRIIRARRSRLTRYVN"
     gene            complement(<32355..>33143)
                     /locus_tag="HG536_0A00230"
                     /db_xref="GeneID:59323303"
     mRNA            complement(<32355..>33143)
                     /locus_tag="HG536_0A00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280986.1"
                     /db_xref="GeneID:59323303"
     CDS             complement(32355..33143)
                     /locus_tag="HG536_0A00230"
                     /inference="similar to AA sequence:RefSeq:NP_014043.1"
                     /note="ancestral locus Anc_5.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136881.1"
                     /db_xref="GeneID:59323303"
                     /translation="MGSVQTQELVIFSDNSVLSKELCSGGSHNLITITSSPSNSPFWL
                     INALVESKITGSPHSLSGASQPAPHGTSSDLPVTIGSFIHNGRQFTDVLKKLKIDANS
                     YRVVDLLTDFVAKNIGKPRAKVLSELLDAFTEAPSSMIVLEQPEILLTLLDGLTSDEL
                     HRKFILPLMTKCGILLISTNICYSLDGDNRDSVQFARFASGCLYKSIAVLSLRPLETG
                     RATDVTGSLRITRGGTSSTQISCHVVENEYLYLNQRDSTKLFYR"
     gene            <33318..>34619
                     /locus_tag="HG536_0A00240"
                     /db_xref="GeneID:59323304"
     mRNA            <33318..>34619
                     /locus_tag="HG536_0A00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280987.1"
                     /db_xref="GeneID:59323304"
     CDS             33318..34619
                     /locus_tag="HG536_0A00240"
                     /inference="similar to AA sequence:RefSeq:NP_011801.1"
                     /note="ancestral locus Anc_5.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136882.1"
                     /db_xref="GeneID:59323304"
                     /translation="MLTLPELKSDITVNVIADAKKSEAIRRPVEPVGKHFLHHAQRTL
                     RNHTWSEFEKIQAEQNVKRVDESNNDPDELLFDDELTDESLLEHDPRDWKTADLYAAM
                     GLSKLRYRATNTQIIKAHRKQVLKHHPDKKSASGAGLEQDGFFKIIQKAYETLTDPTK
                     RAQYDSCDFNADVEPPKKGTEYDFFEAWGPVFAAEARFSKKTPVPPLGDMDTPKKEVE
                     QFYSFWHRFDSWRTFEFLDEDVPDDSSNRDQKRYTERKNKAARDKKKTADNARLVKLV
                     ERAANEDPRIKKFKEEEKKEKERRKWEREAGARAEAEAAAKAAAEAKLKAEAEAAASA
                     AAKVDKKKAKEAAKAAKKKNKRTIRGAPKDADYFGDAANAATIDEQTGFIVDSLDDEQ
                     LVSVAEKIKSDPASTRQILQEISKSLSDAGKLPASVLSYYL"
     gene            <34807..>35736
                     /locus_tag="HG536_0A00250"
                     /db_xref="GeneID:59323305"
     mRNA            <34807..>35736
                     /locus_tag="HG536_0A00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280988.1"
                     /db_xref="GeneID:59323305"
     CDS             34807..35736
                     /locus_tag="HG536_0A00250"
                     /inference="similar to AA sequence:RefSeq:NP_011800.3"
                     /note="ancestral locus Anc_5.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136883.1"
                     /db_xref="GeneID:59323305"
                     /translation="MSYRGSLSNLNGAAAPSRQGNGYGAFAVRRDGSSGGFSLQNVMK
                     SVEAYSKQIENLTDHALAQKLRPYIPGIARFFITATFYEDSFRIVSQWSDQIFYLHKW
                     KHYPYFFVVLFLILVTVSMLIGATLLVLRKQTVYATGILCGCIILQALIYGLFTGSSF
                     VLRNISVIGGLLIAFSDSIVQNKTTFGMLPELNPKDGRTKGYLLFAGRLLIVLMFIAF
                     TFSKSWLTVFLTIVFTICFAIGYKTKLASIMLGLILTFYNVTLNNYWFYDQTKRDFLK
                     YEFYQNLSIIGGLLLVTNTGAGELSVDEKKKIY"
     gene            <35958..>36617
                     /locus_tag="HG536_0A00260"
                     /db_xref="GeneID:59323306"
     mRNA            <35958..>36617
                     /locus_tag="HG536_0A00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280989.1"
                     /db_xref="GeneID:59323306"
     CDS             35958..36617
                     /locus_tag="HG536_0A00260"
                     /inference="similar to AA sequence:RefSeq:NP_014042.1"
                     /note="ancestral locus Anc_5.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136884.1"
                     /db_xref="GeneID:59323306"
                     /translation="MGGILKNPLPANQAVSDNEESISEFRKQVLMNTQLNAKLTSKKR
                     EGLARAGGSHVLPKDTLSLKHQQDAEERLQWNQKNLAANELTKQQYQDIHIDEPKTPY
                     QGAIDPNGEYYKDDDEDEAELQNFSLDPSSGPVLETKTEAASSESVTDPQPDRDEHAR
                     RFEEMRKKHYNLKEALQSRRLRDDDDDEDDEDEDDEDDEDDEDDEEDDKREKPLNSDG
                     P"
     gene            <36764..>37855
                     /locus_tag="HG536_0A00270"
                     /db_xref="GeneID:59323307"
     mRNA            <36764..>37855
                     /locus_tag="HG536_0A00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280990.1"
                     /db_xref="GeneID:59323307"
     CDS             36764..37855
                     /locus_tag="HG536_0A00270"
                     /inference="similar to AA sequence:RefSeq:NP_011799.3"
                     /note="ancestral locus Anc_5.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136885.1"
                     /db_xref="GeneID:59323307"
                     /translation="MPPKRVSKPDADRTSKKARNAASQISKLKKTIKVLSKTVNYSLC
                     IPTTILANCRNLEQITSAVYQVAKAATIFNVGEIVILDLGQKGNRETKHQNSLSDAML
                     IASLLQYFVTPPYLVNTVFKKQYRRYFKEASKLPRLSSLPFMRHLGQDRGRYREGLAI
                     RMSKPGSGSTAKKGKEFKQTKYISIGKAEPLELKAQLVPVNVRVTVDTVEHRVVSPQE
                     AYGDFVGAQASYGYHVRVAKSFGSVFTECALPNGYSQAIWANSGDYYYSDQLTKHRKV
                     ETKLPYVARIVRPDDDRASAPPANVLLVCGRWDHINASFQQSKHQFDGCDGAHQFFDG
                     QLRLPGSAPQGLVPIQDCCMISLALVATL"
     gene            <38065..>38994
                     /locus_tag="HG536_0A00280"
                     /db_xref="GeneID:59323308"
     mRNA            <38065..>38994
                     /locus_tag="HG536_0A00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280991.1"
                     /db_xref="GeneID:59323308"
     CDS             38065..38994
                     /locus_tag="HG536_0A00280"
                     /inference="similar to AA sequence:RefSeq:NP_011798.1"
                     /note="ancestral locus Anc_5.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136886.1"
                     /db_xref="GeneID:59323308"
                     /translation="MRFSTLATGLLLAATQVAAVGDLGFNLGVKNNDGTCKSTSDFEA
                     DLDVLKPYGDVVKIYAVSDCNTLQNLGPAVENKGFRVFLGVWPNDDAHFEAEKNALKT
                     YLPELKTSTVAGILVGSEALYRGDLTAPELADKINDVKSTVAGIQGSDGKSYSGVQVG
                     TVDSWNVLVAGYNAPAIEASDIVMANAFSYWQGQAMNNASYSFFDDIMQALQTIQTVK
                     GTTDISFWVGETGWPTGGTNFGAAYPSVQNAQQFWQEGVCAMRGWGVNVIAFEAFDED
                     WKPDTSGISDVEKHWGIWTSDKSLKYNITCSFD"
     gene            <39745..>42207
                     /locus_tag="HG536_0A00290"
                     /db_xref="GeneID:59323309"
     mRNA            <39745..>42207
                     /locus_tag="HG536_0A00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280992.1"
                     /db_xref="GeneID:59323309"
     CDS             39745..42207
                     /locus_tag="HG536_0A00290"
                     /note="Rover element"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136887.1"
                     /db_xref="GeneID:59323309"
                     /translation="MSGASTHATPIVIQQDMPFTNTSSLSAPIPSRSCPATPAEMVRS
                     TPNTTLKVKKSPKKSPSRWMERSSFKIHFTLLNLNNKKRAKCIYCGKMFKEGESTGNL
                     SKHITAVHPSAIKSKKPKVSKEQTLDMLPRRSKSLRLSDSLVQECQKNPEILETLLLI
                     SEGFLPFNFVRLLSWGMINRRHAANAFIQSRTTLSTKINLFKRYLNETLHYNLKDTTM
                     VNIQLDIWTSPSNISFLAVMVSFAPNILNMESLELANDAKILLNNRGESRNCHLLEFV
                     SLGHKRHTGLNIYKVFKEILHRHDLVDKLGTITMDNATNNESFHKSLVYDYLNTIKPS
                     GHQMLGKVRFIRCANHVLNLIFGRIIKSLCEDLLFADAFSKVTKLAKIMRRSTAVNAS
                     LKEHGIPLIPYESQTRWIYTWRQVTVFLQNYAAYSKWFEALDTESHTHIINRVQSIIA
                     FEEKTIQMLTYFVECCDIFGELNFTFQNDEINNLPQGVPLYYLLGHYYKLCLSAFAGN
                     HIPKTPGMDFSYFNGPEYLSLDDKRIVLQAIKDSYGCYQDYLSHIQVNPLFYVAVILD
                     PTAKQDKLYEIMEDEEFTVRISEVNSFMRNYLKVQRFSCVTEQERKKIPKAPSHKNLL
                     SFNIRVAPDPSRHTGSAAMEAECNDGSLEEWVKYQREPVIAGNSRQEAIKWWYDYRHT
                     YPMLFKLAMSLFYTKFTSCDVERCFSLAGRVVRKDRARLSHNNIGTLMILRDRFSNFG
                     FYNGGLVSDAILDDDDFDINLDDTTYVDSLPDVPDHEREDSDDAIFEEWPQESWSPET
                     PTAPRTPEDSLRQATDSPTPVG"
     gene            <42581..>45007
                     /locus_tag="HG536_0A00300"
                     /db_xref="GeneID:59323310"
     mRNA            <42581..>45007
                     /locus_tag="HG536_0A00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280993.1"
                     /db_xref="GeneID:59323310"
     CDS             42581..45007
                     /locus_tag="HG536_0A00300"
                     /inference="similar to AA sequence:RefSeq:NP_014040.1"
                     /note="ancestral locus Anc_5.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136888.1"
                     /db_xref="GeneID:59323310"
                     /translation="MSRFFAANYDYDSASSSSEEDLLSSSDEESLNSSLSEGEEESDD
                     SFFNDSESESDIDSDDSEGRPYGPDWFKKAEFRKGGTNKFLKGANYSDSESEDEGKKV
                     VKSAKEKLLDEMQAVYSSIENAEMTQDWVTILAELDNISRLLIRAQQQNYGTPNIFIK
                     VLAQIEDAVTDAEQADIKNKAVARAYNTTKQRVRKVARENEGLLAKFRENPESFDKEN
                     TADLGAEDREATPIFGKKGINLSSLATASSEVGFFSALRIVLDTRGKKSVDQYGLIKT
                     MQELLEIAKTPYETIMAYLTLIPIRFDASANLSYQPIEQWKAAYSETLRLLEILNEHI
                     DTYQVSELAERNEFIEDEPQADANGVKKILGSVFSFVERLDDEFNKSLLNTDPHSSDY
                     LVRLRDEQLIYNLILRTQIYLEATLPEEERERLLARPLVKRLDHIYYKSTSLISIIES
                     NAWKSLPSNFTSSYVPFNGIADDKYVTNLVGTLADSLRKHKNGGLRKRAVLYQVYFTA
                     LNIDFSTAKDMLIESKVQTYINNSDPSLQILFNRVVVQLGLAAFKLCLIEDCHQVLNE
                     LLASSHLREILGQQTLQRISANVGSSTSADEREQLCLPYHQHINLDLIDLVFMTCSLL
                     IEVPQMTAFYSGIKVKRIPYSQKSIRRALEHYDKSAFQGPPETLRDYVLHAAKSMQKG
                     DWKKCNFYLRSIPTWKLLSNADTVLESLAERVQIGSLKTFFFTYKRFYDKISLSKLSE
                     LFNVPQEKVVEIMEFVIAEYDIDARLDGNKSTVIVEGDEITKLEEVALKLNKEVKIAK
                     ERLNPTAGRR"
     gene            complement(<45322..>49704)
                     /locus_tag="HG536_0A00310"
                     /db_xref="GeneID:59323311"
     mRNA            complement(<45322..>49704)
                     /locus_tag="HG536_0A00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280994.1"
                     /db_xref="GeneID:59323311"
     CDS             complement(45322..49704)
                     /locus_tag="HG536_0A00310"
                     /inference="similar to AA sequence:RefSeq:NP_011797.3"
                     /note="ancestral locus Anc_5.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136889.1"
                     /db_xref="GeneID:59323311"
                     /translation="MGKNALKGASTDSTGSSYRSTPEDKSGSRRSSVEAKLSYNDASQ
                     ENQELSGTGEYIVNRNRPETFLNSDDLEKVTQSDVYAQKRLFSFLHRKKLPLVPEKDD
                     ERRTFPMHRANYLSRVFLWWVIPIIRVGYKRTVQPNDLFKMDERMSIEKLFDSFDRNM
                     RYYFDKSRRQYLEKNPGATEEEVLANARLPRLTTLRALYFTFQRQYLWAVLCAILANC
                     TSGFNPMITKRLIEFVEKKALMPHLPVNSGVGYAIGACLMLLLNGIFFNHFFLASQTI
                     GVQAKSVLTKAALNKMFHASAYARHKYPNGKVTSFVTTDLSRIEFALSFQPFLAGFPA
                     IFAICIVLLIVNVGPIALVGIGVFILMFFLTLFAFKIVIELRMKSNKLTDSRVTIMRE
                     LLNNMKMVKYYAWEDAYEKNVRDIRSKEISKVRNMLYTRNFMIGLALSLPNIASLVTF
                     LAMYKVNRGGRSPGNIFASLSLFQVLSLQMFFLPISIATGIDMILGLGRLQDLLEAPE
                     ERTDNVESIRPTSDMPKNVVLRMTDASFEWEDFEVNDLAEEKKKLQNSSAKKSRKKNS
                     KSDEEPQSSKIDNSHQSEAKEKKSFHGFNCLNFEIEKGEFIMVTGPIGTGKTSLLNAM
                     AGFMRRISGNVEVNGDLLMCGYPWIQNATVRDNILFGSPFDEKRFKEVIRVCSLQADI
                     DMLPAGDMTEIGERGITLSGGQKARINLARSVYKQKDIFLFDDVLSAVDSRVGKHIMD
                     ECMLGLLQNKTRILATHQLSLIEKASRIIVLGADGSFEIGKLEDLKQTNLTLKNLLQF
                     AAQKSEAEETDEAEQEGLGDAETELNKERTKDWSELQKQLSKRSKEVEVSGRLTSKEE
                     RAVNSLKLNVYKKYIEAAVGKWGFLAIPGYLFLVVATTFCSLFSSVWLSYWTEQKFAN
                     RSASFYMGLYSFFVFGGFLFMTGQFTMLCYMGVRASKRLNLQAVGRILHTSMAYLDTT
                     PIGRILNRFTKDTDSLDNELMESLRLFMTQFANIVGVCVLCIVYLPWFAIAVPFLVLF
                     FVLIANHYQATGREVKRLEAVQRSFVYNNFNEVLGGMDTIKAYRNQERFLVKTDFLIN
                     KTNEAGYLVVALQRWVAIFLDMVAIAFALIITLLCVTRQFHISAASTGVLLTYVLQLP
                     GLLNTILRAFTQTENDMNSAERLVAYATDLPLEADYKIPESSPPENWPSEGEIIFEEV
                     SFAYRPGLPVVLHNLNLQIKRGEKIGICGRTGAGKSTIMSALYRINELADGRILIDGI
                     DISKIGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFQESSDDKLWEALVNGGIITAAEL
                     DVVQKQKPDESGSLSNLHKFHLDQKVEEEGSNFSLGERQLLALARALVRQSKILILDE
                     ATSSVDYETDNKIQSRISASFGNCTILCIAHRLKTILSYDRILVLDKGEIAELDTPKA
                     LYERTDGIFREMCNRSGLTEADFN"
     gene            <51399..>54677
                     /locus_tag="HG536_0A00320"
                     /db_xref="GeneID:59323312"
     mRNA            <51399..>54677
                     /locus_tag="HG536_0A00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280995.1"
                     /db_xref="GeneID:59323312"
     CDS             51399..54677
                     /locus_tag="HG536_0A00320"
                     /inference="similar to AA sequence:RefSeq:NP_014039.1"
                     /note="ancestral locus Anc_5.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136890.1"
                     /db_xref="GeneID:59323312"
                     /translation="MSALPEEVNNTLIKVLHGFASADNETRAAAEKTLNQDWITATNI
                     EVLLIFFSEQASFSQDLTSAALSAVLFRKLALRAPPSSKTVIIAKNITQISSNGLNQI
                     RATLLKGFVSERPGNIRHKLSDAIAECAQEDLPEWPELLQTLIEALKNEDPNFRESSF
                     RILSIVPHLINSVDVMNILPIFEAGFTDSNDDVKIAAVTAFVGYFKQLPKAHWSKIGV
                     LLPSLLNSLPKFLDDGKDDALASVFESLIELVELAPKLFKDMFDQLIQFASIVIKLTD
                     LETPARTTALELLTVFSENSPQMCKSNPNYAQSMIVATLLMMTEVSIDDDDATDWRES
                     DDAEDEEEEVAYDHARQALDRISLKLGGKYLAAPLFQYLQEMISSSQWRERFGALMAL
                     SSAAEGCRDVLIGEIPKILDMVLPLINDPHPRVQYGCCNVLGQISTDFAPLIQRTSHD
                     TILPALISKLTNESIDRVQTHAAAALVNFSEHANQAILEPYLDSLLTNLLTLLQSSKL
                     YVQEQALTTIAFIAEAAEKKFIKYYDTLMPQLINVLKMDVDGANRVLKGKCIECATLI
                     ALAVGKEKFSEHSQELVNLLILYQNNGIQDDDPIKTYLEHGWSRICRILREDFVPLLP
                     IVLPPLIETAKATQDVSLIEEEEAANFQQYVDWDVVQIQGKHIAIHTSILDDKVSAME
                     LLQVYSTVLKSQFAGFVSEIMNDIAIPSIDFYLHDGVRATGAGLIPVLLSCLISAVGL
                     QNDEVQQLWLSASSKLISGIMSEPMAEITQIYHSALVDAINTMGEGCLTEEAQERFTK
                     GVSANLTDVFERVRQRHTEDDEYNEEVDQEYEDFTDEDLLDEINKSIGAFFKSTKGQY
                     LSHFRSLWPIVSTYLQDTEIVLTLFALVAIGDMIQYSGENAAVYKDEIVTKLSTYLIS
                     PEPSIRQAAAYTIGVCAQYAPSTYGDFCVSSLEVLFQVIGIPDAKSDENQTATENASA
                     AIAKILHSFGSNIPDVNRYVENWLQSLPIVVDDEAAAFAYKFLNHLIDIQSPAVTGSP
                     NIPKLVGSVVQALQHKSISGKNAAAVVESTKRLLGTLPQEEAMGIFQNYPPDLMQTVQ
                     AWFS"
     gene            complement(<56013..>56198)
                     /locus_tag="HG536_0A00330"
                     /db_xref="GeneID:59323313"
     mRNA            complement(<56013..>56198)
                     /locus_tag="HG536_0A00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280996.1"
                     /db_xref="GeneID:59323313"
     CDS             complement(56013..56198)
                     /locus_tag="HG536_0A00330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136891.1"
                     /db_xref="GeneID:59323313"
                     /translation="MMVISIVSPTIGNDLGDISSNGFNNGDVQTAMHGEIYFNTYGGV
                     DGQCNDYYDCFTGDCGM"
     gene            complement(<57248..>60205)
                     /locus_tag="HG536_0A00340"
                     /db_xref="GeneID:59323314"
     mRNA            complement(<57248..>60205)
                     /locus_tag="HG536_0A00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280997.1"
                     /db_xref="GeneID:59323314"
     CDS             complement(57248..60205)
                     /locus_tag="HG536_0A00340"
                     /note="Rover element"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136892.1"
                     /db_xref="GeneID:59323314"
                     /translation="MYNLRTRKKHNYKQLNSGATSKGDKTRRNSLDEPSCSDTLVSDS
                     PGNALEDPLDGQNFFDSNQIDKISGNDQQDGNQFSDRSIDHIHSLPSGMQTEHSSETE
                     KGQIEMRQRLTSAADKEEPTEFNQRVSLPQESQENSIIVTQDLSGRPLQRLGTSTIRQ
                     IINFPTNNLAYGPGHHDMSLQPEQFYSHNSTDSTESSEEHGNQTSASESDEAGTLSLE
                     EAFKSKYKFGFDEFSMNPFDKPDIEHTTERNVPESDLAKLESWLKTSPYRIWVTKYAA
                     PEPHAICKYGDCRHVFTLKGNPTSFNIIVHLRRNHRQDFELFSTKLKKSQPQLSDIKG
                     VLSINKKPFGLRRELLNFMYANELRINQLNLFIETIIPFSTAEAPAFKKLLECSGARS
                     HNYISSRKGLVSTMEKYEEQFNLQMRDTLRKSLNYNIILDMWTSSNQKSYLAILVSFC
                     PNLRRGRDRLTIRDVTTNGTPNVHIIDFVDLSEERHTGSNLKEALLRSLRSFSIGSKI
                     SSVTVDSGSNNISMLSELDHDIKGAPGVNKEGGLVKVRCMNHLLNRVFQDVMAGFEKS
                     ESSLLSRIDRLTVILKRNVFIRNKLREFTPKTIPRYNCTRFVSRYRQLSVFLKLTGPL
                     KDFYFENRLDKRFQLTSDDLSLFCYEPSEIEVLKIFLRLTRIFDEYTMLLQDDMLDNL
                     PNGIEYYLQIDDFFKSCREVRNGSTKVDHLRILGLKKRHLSSVEPSVLTHLLAIIEDA
                     YPKFKKYMSLALAEPGYWVAHLLQPFCKTAILKSAFEEDFQQQILDLSERYVDYYLFN
                     FRNRVKENRSRQVQKDLTRAALDPRSRSYKVFKQLRRHRRKYVNAINSKNEWECYLEE
                     PIQTDISYLDYWIANQDRYPGLFELALSFYYTKLSSAHVERFFSISKTALENRFSLSS
                     TNLKRTMVLRNRLKCFGMGHGLQKIDDIPVEQWIQDEETEPEITDVCPAGTEDSPLYI
                     PIYSDSDSSEEEE"
     gene            <60552..>61382
                     /locus_tag="HG536_0A00350"
                     /db_xref="GeneID:59323315"
     mRNA            <60552..>61382
                     /locus_tag="HG536_0A00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280998.1"
                     /db_xref="GeneID:59323315"
     CDS             60552..61382
                     /locus_tag="HG536_0A00350"
                     /inference="similar to AA sequence:RefSeq:NP_011796.1"
                     /note="ancestral locus Anc_5.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136893.1"
                     /db_xref="GeneID:59323315"
                     /translation="MGLAATRTKQRFGLDPRNTAWSNDTSRFGHTMLEKFGWKPGMGL
                     GMVPAESHKSHIKVTIKDDTVGLGAKIKRKERKDEFDNGECAGLDVFQRILGRLNGKE
                     KAVTDELEKQRIDKVLNGKWGVHFIKGEVLASTWDPETKKLKSYSNEKSTVSEESASD
                     SDGSEEVKEVIKKAKRTKGSKLEDKSKARCSKESKKQRKEQKKMVKKAKKKEKKKHRE
                     ENKELSRRIAYLESSPTASNIPANVSTRLSIRAKHIRQKRAATMDSKALNEIFMVTDN
                     "
     gene            complement(<61543..>63198)
                     /locus_tag="HG536_0A00360"
                     /db_xref="GeneID:59323316"
     mRNA            complement(<61543..>63198)
                     /locus_tag="HG536_0A00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037280999.1"
                     /db_xref="GeneID:59323316"
     CDS             complement(61543..63198)
                     /locus_tag="HG536_0A00360"
                     /inference="similar to AA sequence:RefSeq:NP_014038.1"
                     /note="ancestral locus Anc_5.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136894.1"
                     /db_xref="GeneID:59323316"
                     /translation="MLFKSLAAATVASLFSSFVTAADLPAIEVVGNKFFFSNNGSQFY
                     VRGVAYQADTANGTQDETINDPLADFSKCSRDIPYLQKLNTNVVRVYAINTTLNHDQC
                     MNALNDAGIYVIADLSAPKESIDRMSPSWDLGLYERYTSVVDEFSKYPNVLGFFAGNE
                     VTNNSTNTDASPFVKAAIRDMKAYMKQKNYRSIPVGYSSNDDSDTRVPMADFFACGSS
                     DEKADFYGINMYEWCGDSTFEASGYADRTKDFANLSIPIFFSEYGCNAIPPRKFTEVQ
                     ALYGPNMTNVWSGGIVYMYFEEANNYGLVSIDGSGDVKTLDDFGYYSSEINNISPSSA
                     NTASYSASATSLDCPATNTYWMAATELPPTPSQDLCDCMSAALSCVVNDSVNETDYQD
                     LFDYVCAQISCDGIVANGTSGDYGSYSFCNAKDKLSFVLNLYYTKNGGSKSNCDFSGS
                     ATLQSASTQSACATVLSQIGSSGTNKPSSSVSFSGSKSVSSSGSGSSSKSGSSTSSGS
                     SGSSTSTGKKNAAISNAHINLSQVILSSIATISLVAGIGFALA"
     gene            complement(<63798..>69179)
                     /locus_tag="HG536_0A00370"
                     /db_xref="GeneID:59323317"
     mRNA            complement(<63798..>69179)
                     /locus_tag="HG536_0A00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281000.1"
                     /db_xref="GeneID:59323317"
     CDS             complement(63798..69179)
                     /locus_tag="HG536_0A00370"
                     /inference="similar to AA sequence:RefSeq:NP_014036.1"
                     /note="ancestral locus Anc_5.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136895.1"
                     /db_xref="GeneID:59323317"
                     /translation="MSGSPGSLTDVEYPAWCQDDEVPVTRQELSEIFDGLAAKFGFQQ
                     SSKENMLHHLLAQLDSRASRSGARNALLSLHVSYIGGEQANFRKWFFASQMDLDEEVG
                     FQNMKLRGKSRQRNLKLAKKRGISIKEQMEQWNQKEQEFINSHRKITLTHEQLRDREC
                     YETADYKWKLKMRQLSYHEMARQLALYLLCWGEANQIRFAPECLCFIFKCALDFDTAT
                     ECASTRIAANEDDEAAAPKSIPIVAPEFTFMNNTINPLYDFLRDQVYTKDSTGRWVRK
                     DKDHKDVIGYDDVNQLFWYPEGIERIVLRNGERLVDKQLQERYVHFKDIEWSRVFYKT
                     YRETRGWMHCVTNFNRFWIIHLAPFWFFTSFNAPTFYTKDYIQLLNNPPTPQSRLSAM
                     ALAGTVSCLIQIFATVFEWRFVPRDWPGAQHLKRRLCGLIVCLLINFGPSVYVFGFFD
                     LDVHSRSAYITSIIQLIIAIITTLFFAIRPLGGLFGSYLNIGKRKRKYVASQIFTASF
                     PSLSGRSRWFSYGLWFFVFLGKFIESYFFLTLSLRDPIRVLSILDMSRCAGDSLLGKW
                     FCTWQSKITLGLMILTDLGLFFLDTYLWYIICNCAFSIMLSFSLGTSILTPWKNIYAR
                     LPKRIYSKILATSEMDIKYKPKVLISQVWNAIIISMYREHLLSIEHVQKLLFQQVDAM
                     DQEKKTLKSPTFFIAQDDSTFKSVEFFPSNSEARRRISFFAQSLSTPITEPMPVECMP
                     TFTVLIPHYSEKILLTLREVIKEESNKSKITVLEYLKQLHEAEWDSFVRDTKLLSMEK
                     GATKALCDDSMNCSEMSLNQLSDRGNALNGDDNEGNDEVQKKINDLPYQVFGFSTSET
                     SYTSRTRIWASLRCQTLYRTVSGFMNYSKAIKLLYRIENPSLLQYYGYQTDALESGLE
                     IMANRKFRMLVAMQRYTKFNRDEREATELLLRLYPTMYISFLLEERCSDQEEPWYYSC
                     LTNGQAEIDQGTGLRKPIFKVRLSGNPILGDGKADNQNHSLIFYRGEYIQVIDANQDN
                     YLEECLKIRSVLSEFEEMSINQTVPYIPGIEYEDEPSPVAILGAREYIFSENIGVLGD
                     IAAGKEQTFGTLFARTMAEIGGKLHYGHPDFLNAIFMTTRGGLSKAQKSLHLNEDIYA
                     GMNAMCRGGRIKHSDYYQCGKGRDLGFGSILNFTTKIGAGMGEQLLSREYYYLGTQLP
                     IDRFLSFFYAHPGFHLNNVFISLSVQLFFLLLLNLGSLKHETILCYYDRNMPITALEE
                     PVGCYNIQPALHWVSIFVLSIFIVFFIAFAPLLIQELLEKGVWKAASRFLHHLFSMAP
                     LFEVFVCQVYSNSLLSDLTFGGAKYISTGRGFAITRIEFAILYSRFVNVAIYSGLQVF
                     LMLIFGMVSMWQPALLWFWITVISMCFAPFIFNPHQFAFTDFFIDYRSFIHWLSAGNT
                     KSKKESWSSFVKTSRARYTGYKKKTINDSSTNAIIDSRGAKLGNALFAELFLPFFVFL
                     FNFTSYTFINAQTGVKQTSPSQSVVRLLLVTMLPILMNVIMLLSLFGTSFVIAPLLAT
                     FCKRGGGAMAFIAHATSVVIYLIDFELMWLLEGWNFARTLLLLIATINLHILLFKVFT
                     ILVLTKELKNDSSHLAWWSGNWYNTGWGWTILLQPLREFSVKIMESSYFAGDFFLAHL
                     LLYVQTPFIFIPFIDHWHSMILFWLKPSRIAMTKKLYSKKQKKRRNAIVRKYFMLYFG
                     LLGTLLALLIAPFFADMLVSDPSQMVANSPLDGVIQPNHQNNNDTGPNAPSTILTTTP
                     PFPHFRTVP"
     gene            <69886..>71028
                     /locus_tag="HG536_0A00380"
                     /db_xref="GeneID:59323318"
     mRNA            <69886..>71028
                     /locus_tag="HG536_0A00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281001.1"
                     /db_xref="GeneID:59323318"
     CDS             69886..71028
                     /locus_tag="HG536_0A00380"
                     /inference="similar to AA sequence:RefSeq:NP_011795.1"
                     /note="ancestral locus Anc_5.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136896.1"
                     /db_xref="GeneID:59323318"
                     /translation="MRLTNIIVGATLLEAAIAAPAVHQHKRDVVTTTVQAKVTVVVGS
                     DGSAINQPPAADAPAGAVTTISTAPAVEATSSAPAQAAVASSEVSSSSTSASRSESAS
                     SVSSSNSASSSGSSSDSSVSIGAAGVKGITYSPYTSSGSCKSASEVKADLASLTDYPV
                     LRLYGVDCDQVANVLQAKSPSQKLFLGIFNVGQIQDGVQTIASAVEKYGSWNDIVTVS
                     VGNELVNGGQATPSQVGQYISTAKSALSAAGYTGSVVSVDTFIAVINNPELCKYSDYM
                     AVNAHAYFDKNTVASDAGTWLLQQIQRVYTACGGEKTVVVTESGWPSQGQTYGVAVPS
                     KQNQKAAVESIIKSCGSDTYLFTAFNDLWKADGPYGVEKYFGVLSN"
     gene            complement(<71412..>73046)
                     /locus_tag="HG536_0A00390"
                     /db_xref="GeneID:59323319"
     mRNA            complement(<71412..>73046)
                     /locus_tag="HG536_0A00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281002.1"
                     /db_xref="GeneID:59323319"
     CDS             complement(71412..73046)
                     /locus_tag="HG536_0A00390"
                     /inference="similar to AA sequence:RefSeq:NP_011794.3"
                     /note="ancestral locus Anc_5.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136897.1"
                     /db_xref="GeneID:59323319"
                     /translation="MVPDEEQQRSNWTVMESYLRCKIEELNESSLEKTFKDILGVNIL
                     LGHRNLVRLILERPDLSKQPDLYAALAAKLNSVAPEIGATLSREAAAIFIEAYNNFDD
                     AKAYSMVSLLAELFNYEVLHEIVILQVIHLLSKDLTEPSVRIIVQLLWQCGKHLSEVS
                     LTAHNMIFEKLRQVLQAGKLSNNAKSFLQELFDLRSRDYIPCSAGQLLKIEDLEHNTH
                     TFMIDSDEFKPLKNLGEFEYHEDFIALERRYEILRAEALAAYETEEVQKPTVATDMTG
                     EQEVEFKKRFYLILKSSLSSDEAAHKILKLRVPDADKHRVVDVIIKSSIQEATYSKFY
                     GTLAERLCSSHKSWKPAFELVFKSNYQNSEEFEPAQLRTLGKLWGHILASDYVGLEVF
                     ENVHMSEDGTTAPGRIFLKFIFQEMVASLGIDELANRFKEEYIQPFLVNLFPKEDTDN
                     IRYSINYFTAIGLGVLTEDMRQRLDILQAEVQKIRKDRDGEQTQVSQQVDSRYRSSER
                     RSRRDRSVTPPRRQRRASVTPPKRRYRSRSPISRHR"
     gene            <73250..>74125
                     /locus_tag="HG536_0A00400"
                     /db_xref="GeneID:59323320"
     mRNA            <73250..>74125
                     /locus_tag="HG536_0A00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281003.1"
                     /db_xref="GeneID:59323320"
     CDS             73250..74125
                     /locus_tag="HG536_0A00400"
                     /inference="similar to AA sequence:RefSeq:NP_011793.3"
                     /note="ancestral locus Anc_5.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136898.1"
                     /db_xref="GeneID:59323320"
                     /translation="MRAAIVFHNIEALDFSKLESLFGDCLRDITFDDMSVLDIILLGQ
                     FESSVYLDNVLGRIYSSAREIFLSRKLFVTAINVLFDYSSTQSLDFDWLYVPDEELLK
                     RYQHKNAGLFEQPRIQGSNVFGGSYVEDTDRYKVSALGGTFDHIHDGHKILLTVAAFL
                     TSERLIVGVTDEELLVKKKYREYLESFDKRAKNVQQFLHLLKPNLDTQIVPIKDVCGP
                     TGTVPEIECLVVSRETVAGGEFVNKTRLAKGLSKLDISVVNVLGGNEQDGWKEKLSST
                     ELRKMLMQIKNSARN"
     gene            complement(<74295..>77855)
                     /locus_tag="HG536_0A00410"
                     /db_xref="GeneID:59323321"
     mRNA            complement(<74295..>77855)
                     /locus_tag="HG536_0A00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281004.1"
                     /db_xref="GeneID:59323321"
     CDS             complement(74295..77855)
                     /locus_tag="HG536_0A00410"
                     /inference="similar to AA sequence:RefSeq:NP_014033.1"
                     /note="ancestral locus Anc_5.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136899.1"
                     /db_xref="GeneID:59323321"
                     /translation="MSEAGGVTGSVGKPVDLGKSIEQILPLLGDEVEAGTVAEGGFTW
                     HIEDWSQLTNDKYISPRFKVGDYEWDVLLFPQGNQNKSLAVYLEPHAEERKNAETGEL
                     EYVDPDWYCCAQFAIVLSRPEEDNKVQLANTSHHRFNRIDTDWGFANFIDLTYLKYPA
                     KGRVSGLLNKGMLNITVYVRIVEDTTGVLWHNFINYDSKKATGYVGFRNQGATCYLNS
                     LLQSYFFTKYFRKLVYQIPTEGKNDNVTLALQRAFYQLQVSNLPLDTTELTKSFGWDN
                     AEAFTQHDVQELNRILMDRLETRMKGTAVEGELNHLFVGKMKSYIRCINVDYQSVRTE
                     DFWDIQLNVKDMKDLQTSFQNYIEVELMDGENQYAAQDYGLQDARKGVVFESFPPVLH
                     LQLKRFEYDFNYDQLVKVNDRYEFPDKIDLAPYMDSDVIKNKPGPRIYKLHGVLVHTG
                     DISTGHYYALIKPGVEDEWYRFDDERVWKATRRQVFDENFGFDRLPDDKIRCMTREQY
                     QDYLIQRHTNAYMLVYIAEDKEEEILQPVTEADVPESIVASVQELNRERELREKEIRE
                     AHLYTSIRITSLKNFIHYQGFDTAPNVRSTLYSPELNSDDTLPITLKVSCKSYMKDVY
                     KNVIEQLNIPRGRNVRLWKMGYRRNGTLRLEEPLPSDIEEMTLEETFGDEQTGKVPSL
                     DIFVEEPYLELRFLQTLKKAGKLPSSEVDDKLIDALRSDVSSFITSDNVPTILDDENY
                     QVIFLKKFDISEQRLNGFGYCVVNQLDEISTLSKLVSDFIDSSEPVQLYEELQPGSID
                     LLSLKDKFFTAELSSGDILTFQDPKSKAPDTFPVYHDLKSFYDYLRHRIKLKFNKAEE
                     SSEEYVLKSSTPDQFEFWISAHATYSDVARVVSQLTGVQPEYLKIFALYSNGKFPLKS
                     DSLLSDYIIRDYNSDLKPVFEYEVLSMPLRELEHLRSLKFYWLKNSYIHYQSFEFKVT
                     NNCTVKEFLDKIQAKIGFSDDDKGKILLWTNYNFQFQGILSENSTLKSIGKSVLLFGR
                     ILPEELALVKQLDSLSNTEDESMDDDEEDLGLTESNPKAVLQGCLIIVSQYFKDIENR
                     HGISFLFKLIPNEPFPQTRARLHEKFGLGQREFSKINLAISFSTPSGTSFRSLQGYTE
                     EELDSLVLFNVMSNLDCLYMDHPDRLRSQSSHDRPMVIKN"
     gene            <78111..>80618
                     /locus_tag="HG536_0A00420"
                     /db_xref="GeneID:59323322"
     mRNA            <78111..>80618
                     /locus_tag="HG536_0A00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281005.1"
                     /db_xref="GeneID:59323322"
     CDS             78111..80618
                     /locus_tag="HG536_0A00420"
                     /inference="similar to AA sequence:RefSeq:NP_014031.1"
                     /note="ancestral locus Anc_5.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136900.1"
                     /db_xref="GeneID:59323322"
                     /translation="MPFVDQRTAWRAMLGTKIGFLEKVAARSVCRGRSRLALGWAALG
                     RRHVSSEIQQKDEQAGESTTATDTGIIHKTEQETLLYFDNVYPRATSLWSPAQWYNLL
                     LTNQSREAVREKIRNFASPPDNPIHGLELRSSIPVKRDGGVFATFLVPPQYSKAQVNT
                     LIQQNTLKESSKSFLSYFTRAAVFPVKGSPWIEDLRRLPNTTILVKFQGPALTEEEIY
                     SLFRRYGTISDIYPPTGSDNTARVKYRSFRGAICAKNCVSGIEIHNTVLHIQYERIAQ
                     GHLISNFFVNHTRIAIPVMIALLSIIAVLIFEPIREFSIEQKITHRYSISWDNHWLKQ
                     IRKLTSSTVSQFRNYWGSEDTSQSQKHLWEERIEKVNDLKMWLEENNNTFVVIRGPRG
                     SGKHELVMQHTLHNRDNVLYLDCDKFIKSRTDAKFLRNAASQLGYFPIFPWFNSVTNV
                     IDLMVQGLTGQKSGLSETKEAQFRNMLTTAMMSIRHIALRGYRTTLKSGDETITVKEE
                     DYLQQHPEEKPVIVIDRFSGKSEINGFIYKELSDWAAMLIQMNIAHVIFLTETVAPNQ
                     LLSESLPTQVFKTLILSDASKENAKKYVLAQLHDLHSPSTMIVADPEDENDPRKPLVD
                     EKVTQEIDDVLDPLGGRMLDLQAFVRRVKSGEQPKEALDKMVEQSSEQITQIFLSDKV
                     DSVKSAQAWELIELLSEHSNVLFEQIVFRPLFKAAPEIAITELENNGLITVSRERGVL
                     KEIQPAKPLFRAAFQYLVHDSDLSTILKTRYLLKVVGFETGRIKKWEEELRPLGKSGD
                     PKLFKSRLAYLSKKIEASSAAIDECEEQIKELSQKRS"
     gene            <80884..>82950
                     /locus_tag="HG536_0A00430"
                     /db_xref="GeneID:59323323"
     mRNA            <80884..>82950
                     /locus_tag="HG536_0A00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281006.1"
                     /db_xref="GeneID:59323323"
     CDS             80884..82950
                     /locus_tag="HG536_0A00430"
                     /inference="similar to AA sequence:RefSeq:NP_014030.1"
                     /note="ancestral locus Anc_5.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136901.1"
                     /db_xref="GeneID:59323323"
                     /translation="MLRIAVGNAGRSGLLPGRIAIGKSFALGSKRLPYTSLQIGNSGS
                     QIWKRAIGNTNKNAATQRKVEPPKAGEVAKSGTPSMSELKILKTLVQYIWPKGNTKVK
                     IRVMIALALLIGAKLLNVQVPFFFKETVDKMNVDWSDTTVALPASIALTVVCYGAARF
                     GSVLFGELRNAVFSRVAQNAIRTVSLETFKHLMRLDLGWHLSRQTGGLTRAMDRGTKG
                     ISYVLSAMVFHILPITFEISVVCGILTYQFGASFAGITFATMLLYSIFTIKVTAWRTE
                     FRREANRADNKAASVALDSLINFEAVKHFNNENYLAGKYHESLMKYRDSQVKIAQSLA
                     FLNAGQNFIFTSALASMMYMGCTGIIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRE
                     LKQSLIDMEALFKLRTNEVKIQNVERPLMLPENSGPFEIKFENVTFGYDPRRKILRNA
                     SFTVPAGLKTAVVGPSGSGKSTILKLVFRFYDPESGRVLVNGHDVRDYDLDSLRRAIG
                     VVPQDTPLFNDTIWENVKFGRIDASENEITQAIEKAHLAPLIHKLPAGSATIVGERGL
                     MISGGEKQRLAIARVLLKSPPIMFFDEATSALDTHTEQSLLKTIRENFDRGSKTSVYI
                     AHRLRTIADADKIMVLEDGSVREEGTHSELLSRKDSLYKQLWNIQENLDVIESEINSE
                     QNLEIR"
     gene            <83242..>84774
                     /locus_tag="HG536_0A00440"
                     /db_xref="GeneID:59323324"
     mRNA            <83242..>84774
                     /locus_tag="HG536_0A00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281007.1"
                     /db_xref="GeneID:59323324"
     CDS             83242..84774
                     /locus_tag="HG536_0A00440"
                     /inference="similar to AA sequence:RefSeq:NP_014029.1"
                     /note="ancestral locus Anc_5.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136902.1"
                     /db_xref="GeneID:59323324"
                     /translation="MCGILGIALADETCPVAPELCDGSIFLQHRGQDAAGIATCGARG
                     RIYQCKGNGMARDVFTQQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGVML
                     AHNGNLVNTVSLQRYMDEEVHRHINTDSDSELLLNIFAAELEKHNKYRVNNEDVFRAL
                     EGVYRLVRGGYACVGMLAGFALFGFRDPNGIRPLLFGERVNENGTKDYMLASESVVLK
                     AHNFTTYRDLKPGEAVIIPKNCEKGEPEFKQVVPMNSHRPDLFEYVYFARPDSVLDGI
                     SVYHTRLRMGTKLAENILKSLGPDEVDVVVPVPDTARTCALQCANVLGKPYREGFVKN
                     RYVGRTFIMPNQKERVSSVRRKLNPMESEFHGKKVLIVDDSIVRGTTSKEIVNMAKES
                     GATKVYFASAAPAIRYNHIYGIDLTDNKNLIAYNKTEEEVAEAIGCDKVIYQSLEDLI
                     DCCKTESIDKFEVGVFTGNYVTGVEDGYLHELERVRALNQSNKTDVKSEVDIGLYNAA
                     DY"
     gene            <84962..>85897
                     /locus_tag="HG536_0A00450"
                     /db_xref="GeneID:59323325"
     mRNA            <84962..>85897
                     /locus_tag="HG536_0A00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281008.1"
                     /db_xref="GeneID:59323325"
     CDS             84962..85897
                     /locus_tag="HG536_0A00450"
                     /inference="similar to AA sequence:RefSeq:NP_014028.2"
                     /note="ancestral locus Anc_5.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136903.1"
                     /db_xref="GeneID:59323325"
                     /translation="MSGSWKLLAKTLGSKAETRSRKTAIVCAPTVESLKQFEARCLPN
                     GCNFANTTMSVLGFSSAEVDIGTTNKRRREILELDAYAISFPITAFALDYLTAFVDLK
                     NADDYSISWFFVLDWAMPNQRFWLQELISSVDVLSSSGACIPAGSMTICCVNTDHIYT
                     WQKNTTQWLPEHVEHIQQALRSFCLLKKCSLLYYPTLLPSSALSDSDKEAALNVLLGK
                     LDLISADLVSTSDLRVPWGSDSIDLIKRAPKSFEPSQVFTNEFKENFEAFIPRVVAPS
                     ARSDEMPMEQESIAPLKIDVQQELQKIYDQVQKHK"
     gene            <86435..>88423
                     /locus_tag="HG536_0A00460"
                     /db_xref="GeneID:59323326"
     mRNA            <86435..>88423
                     /locus_tag="HG536_0A00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281009.1"
                     /db_xref="GeneID:59323326"
     CDS             86435..88423
                     /locus_tag="HG536_0A00460"
                     /inference="similar to AA sequence:RefSeq:NP_011792.1"
                     /note="ancestral locus Anc_5.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136904.1"
                     /db_xref="GeneID:59323326"
                     /translation="MGHATPSELLNVSPSEEHPSSQRLTPENKNKRDAEPSGQEDNSF
                     VNSRVARLSICEDSTTASEIMAGLKDSEKVEMVQDSNNGNSDQQNGKRGKRSKRRRSS
                     AVSGPGSAKVRQSVKQAASTQAPVTKKKKKVLKALLEVREIPAGRKINIKDLRDLVVF
                     ILGGTNNCPKWINIENRQAIRKVVVFLVPGLQVEDFGFSSDWRFSNSQQALGESCLKD
                     LSDSGAKKDLQVFPVSAPGSNTSLFSAYNSFINVGLSKKEKKIRREELDSKKITISDL
                     ILSLDDLIENNYPIHRDTPGITDTMRQQLIQHYEQDPIEYVSTAKFDHEGSHIFALDC
                     EMCLAKDGLVLTRVSMVDFNLTVIYDKLVKPDVPIIDYLTKYSGITEEKLLNVDTKLQ
                     DVQQDILKIVSADDILIGHSLQSDLDALQMKHPKIVDTAVIFDHKAGPPFRPALRYLA
                     STYLEDDIQNNDAVGHDSIEDSIACMKLVKMKIANGMGFGITANTEDLFRLLGKVGVK
                     SIRLSDSGPKLSVSTAVGCESAIRCRSDAEIISGLHENLNKNDLLVCRLRGLEFARGY
                     ATPPIIRSCEVPNAEDALAFFSDSLQKTYNDAPSGTLIMVMSGSGNTKKWSEIMTAIN
                     KLDKAERTEERQRREKDIEEALAVARDGVGMMLLKQSE"
     gene            complement(<88487..>89044)
                     /locus_tag="HG536_0A00470"
                     /db_xref="GeneID:59323327"
     mRNA            complement(<88487..>89044)
                     /locus_tag="HG536_0A00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281010.1"
                     /db_xref="GeneID:59323327"
     CDS             complement(88487..89044)
                     /locus_tag="HG536_0A00470"
                     /inference="similar to AA sequence:RefSeq:NP_011791.4"
                     /note="ancestral locus Anc_5.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136905.1"
                     /db_xref="GeneID:59323327"
                     /translation="MESLIQRANNTNYLSASEKKSHWRYDWYAASRPETVSGGHGNSS
                     GEGGRSETDSHKNSFKYKTWLKSEMPASNASAEIEEGDLFDLANYSLDRVNGTSSGAP
                     RATGEGARNNSLTVEDIRGAVGGAESMIALSSAGTSAPKAGEKDKASSVQEKPEAAEP
                     ANASEETELQDQIADKDAEGDVTMQ"
     gene            <89299..>92313
                     /locus_tag="HG536_0A00480"
                     /db_xref="GeneID:59323328"
     mRNA            <89299..>92313
                     /locus_tag="HG536_0A00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281011.1"
                     /db_xref="GeneID:59323328"
     CDS             89299..92313
                     /locus_tag="HG536_0A00480"
                     /inference="similar to AA sequence:RefSeq:NP_011790.1"
                     /note="ancestral locus Anc_5.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136906.1"
                     /db_xref="GeneID:59323328"
                     /translation="MPAGEKGRKNRPADLSNEDDAYEAIFGGEFGSLEIGGYIGRDDE
                     SETKHLSDAIDFEDEDELADEELPDEEMREDESEAARRLEGGAGHMGGHVGDFMGHEG
                     SGGDYDGGNNALFMGMDGNNGVLMERNHSFAVYRVPPNQEEQRKAYQQQQLLKEAERK
                     TREDKLLLKSYFPNFKKGKVLKWNSLLYKRPGKYHWAAEYSPARKNLEPLMPLNLRLQ
                     VQPDGKKLFNTKESTWTSSSLPSLASMQNKRHSHGIIVVTLDELDPEEVHEHEENRHT
                     RKISEELLIATDDWDQERIINEGAVSSKNQSDFARNSLKEDEKDWDWNEDDLVDAKLD
                     NNQARLDMNDEQLLLIKGSGYRKSEEHVADLLPLNEKGIMQKFNNSNDDEYNVLGRNH
                     QTKVRATISNLNIDHSQPAIRLQSPYYKVNMPKKELRYFHRPNFGKSIRPGTNIVFSK
                     LKVRKRKRDKGKEVKESFASTQDLTIGDTAPVFLMEYSEQNPIALSKFGMANKLINYY
                     RKMNEQDASRPKLPVGETYVLGIQDKSPFWNFGFVEPGHIVPTLYNNMIRAPVFKHDV
                     SGTDFLLVRSSGNGVSNRFYLRSINHLFVVGQTFPVEEIPGPNSRRVTSMRTTRLRMV
                     VYRILNRTPSQAISIEPIARHFPDQDYGQNRQKIKEFMKYQREGADKGLWKLKEGEPL
                     LDNESAKKLITPEQVSEVESMNQGLQFQEDNEFFNFDEKLLKLEENLLPWNAAKNFVN
                     ATQMRAMIQIHGAGDPTGCGEGFSFLKTSMKGGFLKSGMDNGKSQSSSGHSYNVAEQQ
                     KAYEEEISKTWYTHAKSLSIINPFEEMDDPDEVNSTNRHVLTSRTDGKVLRIVRKKRD
                     ENGIIQRQTLVVRDPRVIKGYLKSKEKRREANLNVEKLLEEETTVQNVEDIEMQKKLL
                     QSELASLEKSQQRRAARQVSKTKSQDNKVTKTKNTTRRCARCGQVGHIRTKKSCPMYD
                     GSLGTSQGSGVGESGAANLSAAEAPAASPITN"
     gene            complement(<92400..>92825)
                     /locus_tag="HG536_0A00490"
                     /db_xref="GeneID:59323329"
     mRNA            complement(<92400..>92825)
                     /locus_tag="HG536_0A00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281012.1"
                     /db_xref="GeneID:59323329"
     CDS             complement(92400..92825)
                     /locus_tag="HG536_0A00490"
                     /inference="similar to AA sequence:RefSeq:NP_014027.1"
                     /note="ancestral locus Anc_5.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136907.1"
                     /db_xref="GeneID:59323329"
                     /translation="MARRKAQVNSLFQCTAVCLMLIAAVEYFKYATRIHYEWFHCTPT
                     VEKIGTSDSSVIMLSSRGGPSCDKRGEFKTIVKRISRDFEPNSEHLSFCIKENADVPA
                     VHYPIDENKGAPGYIAYAGYDSDLQLVKEMCADSPIYHF"
     gene            complement(<92995..>94599)
                     /locus_tag="HG536_0A00500"
                     /db_xref="GeneID:59323330"
     mRNA            complement(<92995..>94599)
                     /locus_tag="HG536_0A00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281013.1"
                     /db_xref="GeneID:59323330"
     CDS             complement(92995..94599)
                     /locus_tag="HG536_0A00500"
                     /inference="similar to AA sequence:RefSeq:NP_014026.1"
                     /note="ancestral locus Anc_5.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136908.1"
                     /db_xref="GeneID:59323330"
                     /translation="MKGAGTLALALSAAVVNGMSFQQPFAFNQNHEGSSLLEKAIEAL
                     KMDHKEVLGSLSADIKQSWEEMPFKFPVEVSQMQFVTKPKDPSAIFSRKNWDITVQSE
                     DVQNYQLRINKLKDPQVLGIDPDVKQYTGYLDVEDEDKHFFFWSFESRNDPKKDPVVL
                     WLNGGPGCSSLTGLFFELGPSSIGSDIKPIYNPQSWNSNATVIFLDQPVNVGFSYSGS
                     AGVSDTVAAGKDVYAFLQLFFKQFPEYVKHGQDFHIAGESYAGHYIPVFATEILSHPV
                     SKRNFNLTSVLIGNGLTDPLNQYPLYEPMACGEGGEPAVLSPDECQAMEDSLGRCLSL
                     IEACYESESIWSCVPASIYCNNAQINPYARTGRNVYDIRKECKGTLCYEDLQYIDDYL
                     NLDYVKEAVGAEVDKYESCNFDINRNFLFAGDWMKPYHKAVTELLNQNIPVLIYAGDK
                     DFICNWLGNRAWTDVLPWKSADGFAKQPVRNWVAKLTKEKAGEVKSFENLTFLRIFGG
                     GHMVPYDVPENALSMLNEWIHGNFSL"
     gene            <95311..>96990
                     /locus_tag="HG536_0A00510"
                     /db_xref="GeneID:59323331"
     mRNA            <95311..>96990
                     /locus_tag="HG536_0A00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281014.1"
                     /db_xref="GeneID:59323331"
     CDS             95311..96990
                     /locus_tag="HG536_0A00510"
                     /inference="similar to AA sequence:RefSeq:NP_014025.1"
                     /note="ancestral locus Anc_5.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136909.1"
                     /db_xref="GeneID:59323331"
                     /translation="MAHIPQVLPNSIPIPSFIVDSFSYVWYYLYASLLKVPGGRYIIS
                     YVKKSHQDDPYRTAVEVVLILYGIVYYLSKPQQKKGLQGSKPNLTAQEVEALIEEWQP
                     EPIVDESVMEAQRWRLEKIPVIEVLKKGDRVRVKRNDGRECFDNVLNLASNNFLQLAS
                     RPDVVEVAKKTIKNYGVGACGPAGFYGNQDVHYILEYALANFFGTEDAVLYGQDFCVA
                     PSVLPAFTKRGDLIVADNQVSLSLQNALQLSRSTVYYFEHNNMESLESLLKELTEAEK
                     KERLPAISRKFIVTEGLFHNSGDIAPLPVLLSLKNKYKFRLFIDETFSLGVLGRTGRG
                     LAEHFNMERASSIDVTIGSMATAFGSSGAFVLGDRVMSHHQHIGSNAYCFSASLPAYT
                     TATVTKVLQIMEKDNSAVTALQRLSKLLHGFFTNDAALKRWVLVTSHQMSPVLHLQLT
                     PEARFQRFNYTGEQLFETITRLQKRCATTKFVEEYEQEEKFLQAIADQLLSQHGILIT
                     RNTIVLRQETLPVVPSLKICVNAHISDQDLLAACAAIKAVIIGSCSNNCSD"
     gene            <97092..>97844
                     /locus_tag="HG536_0A00520"
                     /db_xref="GeneID:59323332"
     mRNA            <97092..>97844
                     /locus_tag="HG536_0A00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281015.1"
                     /db_xref="GeneID:59323332"
     CDS             97092..97844
                     /locus_tag="HG536_0A00520"
                     /inference="similar to AA sequence:RefSeq:NP_011789.1"
                     /note="ancestral locus Anc_5.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136910.1"
                     /db_xref="GeneID:59323332"
                     /translation="MTLWRNRITLYSRLGVVAACENSFFPCKNSKYKQQVLDLERQEV
                     VRVCHSLVNSSRMMHFRKKSSSSAGSDGSNGGHGRTPSVKLSKEDQEKFKIRTASVAD
                     PILEAVQEAQPFEQAAETFQDNMNRKSYFSTDGSGVLRDVFGQPIHQPDVSNPTRARD
                     ERPLDTIRGFEYAVSGDPSWGQQLETPQYGFRVRPDFPLFASNPYGAQGMAPQQPTYA
                     EQAVYQAPVGEAVSGQKKKKRGLFGRKKKSKD"
     gene            <98203..>98880
                     /locus_tag="HG536_0A00530"
                     /db_xref="GeneID:59323333"
     mRNA            <98203..>98880
                     /locus_tag="HG536_0A00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281016.1"
                     /db_xref="GeneID:59323333"
     CDS             98203..98880
                     /locus_tag="HG536_0A00530"
                     /note="ancestral locus Anc_5.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136911.1"
                     /db_xref="GeneID:59323333"
                     /translation="MAQTQQKRKRARNTANSLEMAQFIDAGSNKIKKRIRDLERLLTR
                     KRDSLPDTIIVEKERTLEALKLELQNAQLRTTIKRNAKKYHMVRFFERKKALRRYKKA
                     LKAVEESDGDEKCKQDLIQKSIDLCYVVNFPKAEKYIALYPSDDGANGNKDDTSSMKT
                     EAKRAAFRDLVSKQLKEGTLPVSLDDILSGKKLDKEGAGMTLEAADADKKTDIVETAP
                     EEDEFFE"
     gene            complement(<98950..>104829)
                     /locus_tag="HG536_0A00540"
                     /db_xref="GeneID:59323334"
     mRNA            complement(<98950..>104829)
                     /locus_tag="HG536_0A00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281017.1"
                     /db_xref="GeneID:59323334"
     CDS             complement(98950..104829)
                     /locus_tag="HG536_0A00540"
                     /inference="similar to AA sequence:RefSeq:NP_011787.4"
                     /note="ancestral locus Anc_5.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136912.1"
                     /db_xref="GeneID:59323334"
                     /translation="MSTTYSAESASSYMKAMQVMANAADSFSSEIDGSVVARSLNTGN
                     RTTDRASGYKAPLTVLAQDKNEWDAIFEQFDDVSFEKLKNVLKSYKKTNTMATYKKLL
                     RLIKSSSSPLPQDELLKWILELINTYDKTQLEKELLNFLGAENVDLISFLLQARKQLT
                     AHPREYIEQMVKESENTPHLMTEKEIKEQVAENAFLAKNQRLDAARKAIKYPHVFRKY
                     EQGGSSILSVSGQKFTLPIGTTRSSYQTHEEIIIPAADQTVHSKSLYTKLLKVEELDY
                     YCRAVFNYETLNQIQSLVYPVAYQTNENMLICAPTGAGKTDVALLTVLNLIKQFSIID
                     EEEDFDIQYDDFKIVYVAPLKALAAEIVEKFQRKLSFFDIKVRELTGDMQLTKSEIVE
                     TQVIVTTPEKWDVVTRKANGDNSLVSKVKLLIVDEVHLLHEDRGSVIETLVARTLRQV
                     ESSQSMIRIVGLSATLPNFMDVADFLGVNRQVGMFYFDQSFRPKPLEQQLLGCRGKEG
                     SKQCKENIDKTAYEKLAEMIEKGFQVMVFVHSRKETVKTARTFISMAQSNGTLDMFAP
                     DSVDSAKYSKELAKNRDKDIKEIFQFGFGVHHAGLARTDRNLTERMFKDRAIKVLCCT
                     ATLAWGVNLPADCVIIKGTQVYDSKKGGFTNLGISDVIQIFGRAGRPGFGSANGTGIL
                     CTSSDALDDYVSLLTQQHPIESKFGSKLVDNLNAEISLGSVTNVEEAVQWLGYTYMFV
                     RMRKNPFTYGIDWEEVANDPQLYDRRKSMIINAARRLHSLQMIVFDDESFNFIPKDLG
                     RVSSDFYLLNESVEIFNQMCDPRATEADVLSMISYSSEFDGIKFREEEATELARLSEI
                     AAECQIAGNLDTPQGKTNLLLQAYISQSRIMDSALASDSNYVAQNSARICRALFLIGM
                     NRRWGQFSRVMLDICKSIEKRIWAFDHPLCQFELPDTIVRQIRSKNPSMEQLLQLEPE
                     ELGELVHNRKMGSKLFSVLKKFPKIEIHADIFPITSNVMRIHVTLEPDFLWDYRIHGD
                     AQFFWITIEESDKSQILHFEKFILKKRLLKSSHEMDFMIPLSDPLPPQIVVKAISDSW
                     IGCESVHIISFQHLIRPHNETLQTKLQRLRPLRIKALHNPLVESIYPFKYFNPMQTMV
                     FHTLYNTNENVFVGSPTGSGKTVVAELAIWHAFRDYPGKKIVYIAPMKALVRERVDDW
                     RKRITPVTGDKVVELTGDSIPDSRDIKDSTIVITTPEKFDGISRNWQTRQFVQDVSLV
                     IMDEIHLLASDRGPILEMIVSRMNYIASHTGQQIRLLGMSTAVSNAYDMAGWLGVKSN
                     GLYNFPSSVRPVPLKMYIDGFPDNLSFCPLMKTMNKPAFMAIKQHSPQKPALIFVASR
                     RQTRLTALDLIHFCGMEDNPRRFLNISDDEELRYYLSEVTDDTLRLSLQFGIGLHHAG
                     LVEKDRTISHQLFQKNKIQILIATSTLAWGVNLPAHLVIIKGTQFFDSKIEGYRDMDL
                     TDILQMMGRAGRPAYDTTGTAIVYTREAKKMFYKYFLNVGFPVESSLHKVLDDHIGAE
                     IASGAIANRQEAMDFLKWTFLFRRAHHNPTYYGIEDDTTTAGVNKALSAQIDATINSL
                     VESQCVITSGKEIEATPFLSIASYYYISHKTVRTLLRQIHDKASFQEVLKWLSLAEEF
                     NELPVRGGEMIMNVEMSAQSRYSVESTFGDEELNMFDPHIKAFLLLQAHLSRVDLPIA
                     DYIQDTISVLDQSLRILQAYVDVASELGFFSTVLTLIKCMQCIKQGYWYEDDPVGILP
                     GCVLKRRNIENFSAQGLLEKHFDDKSTLSLQKIGEMPHGKLVSTMRRLDVPEDEQKRF
                     LSVSSRLPALVNIQTEEQKSADGLTISAKHAKSKWNKGFEVYCEKFPKVQKELWFFIA
                     YKGDELMMIKRCQPREHGREVRVTCDFIVPEELMGQKLAFKVISDALDLEYDFDYQLR
                     S"
     gene            complement(<104964..>106082)
                     /locus_tag="HG536_0A00550"
                     /db_xref="GeneID:59323335"
     mRNA            complement(<104964..>106082)
                     /locus_tag="HG536_0A00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281018.1"
                     /db_xref="GeneID:59323335"
     CDS             complement(104964..106082)
                     /locus_tag="HG536_0A00550"
                     /inference="similar to AA sequence:RefSeq:NP_014022.1"
                     /note="ancestral locus Anc_5.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136913.1"
                     /db_xref="GeneID:59323335"
                     /translation="MDIIDLSITNESAIVDELAALDVSGQEIFECTGIQEVDDAVAPQ
                     EVITRQFSGLNDVTNDRTPPVGHTKKQVEGSGHSGLARHMVISNMPQVRAAAPESVEE
                     RLERIGRELQELSDLECRKLGPRNSEELERTRNLHLKLTKMSTERLKEMKRSLFEEQE
                     AVNEPLDVTLPRVRFDAGDMQKLLELEGKLTQLERVVGPVASLRKPLVTQLEDLRSRS
                     ALLGRDSELLNKFHERLHEIEEDYENSLLGRKSRNAPSLYQDTKSKMFSYESRINDLH
                     RFNDTLQVYGPILPQLADRVRQLSGIEGKLSECVGVAKAIDTCIAELQELAMKWERTN
                     NRLEQKLSAQEIELAHNRQRFDELVANLEAKLKPSRDL"
     gene            <106530..>107921
                     /locus_tag="HG536_0A00560"
                     /db_xref="GeneID:59323336"
     mRNA            <106530..>107921
                     /locus_tag="HG536_0A00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281019.1"
                     /db_xref="GeneID:59323336"
     CDS             106530..107921
                     /locus_tag="HG536_0A00560"
                     /inference="similar to AA sequence:RefSeq:NP_014021.1"
                     /note="ancestral locus Anc_5.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136914.1"
                     /db_xref="GeneID:59323336"
                     /translation="MSLKTALSRIKSIPEIQKRFNIFINVNQAAERQLQESSPELPLS
                     NLVAGVKDNIVTKGLPTTCGSRMLADYESPYDASCVQALRDAGAVIAGKTNLDEFGMG
                     SGGVHSYFGPVFNPMYPDLKVSAGGSSSGSAAAVAAGAVDFALGTDTGGSVRLPASYC
                     AVLGFKPSYGRISRFGVVAYAQSLDTVGIIAKDISVIRRVFKVLDKYDPKDPTSLSVG
                     FRKKASTIFRKRNKLRIGVPQEFLQQSVCDKYKNLLRQFIETLMRVGHEIYPVSIPSI
                     KDSLPIYYTLSPAEAVSNLSRFDGIRYGTRDDTSDIENGVLFAPTRNNFGREVQDRII
                     LGNYNLCSEAFKNNYVKAQKLRLQMMNQFDGIFRDSNILSNSKENEAGVDLIIGLTAT
                     SAPPTIDSFLRGESSSPTNEYLNDVFTMPMSLVGLPTLSMPIAKGIPVGIQITAQYAN
                     DDTVLEFVDGILH"
     gene            complement(<107945..>111961)
                     /locus_tag="HG536_0A00570"
                     /db_xref="GeneID:59323337"
     mRNA            complement(<107945..>111961)
                     /locus_tag="HG536_0A00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281020.1"
                     /db_xref="GeneID:59323337"
     CDS             complement(107945..111961)
                     /locus_tag="HG536_0A00570"
                     /inference="similar to AA sequence:RefSeq:NP_011786.1"
                     /note="ancestral locus Anc_5.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136915.1"
                     /db_xref="GeneID:59323337"
                     /translation="MERAVDWCRVNQKRGFNGGMSRHLRGHRDASAGRSNGDDLGEIK
                     DGNGIIHTTSRSLRKINYAEVESGLDYLESEGGAGEDVPGEDAAAGYEVEDESPDQEI
                     QRSGRASRRRPHDAEEEDESFHEDEDEDEDVEDDDDDSGGAEDQYYARNDSKRRRRMA
                     DRSFVVPDPDEGEDEDEEDGFEQFSRRRRRSARRRQRSATPPPRVSRRLRSRTRHSLH
                     FNDEEDRRRHSENDEEALSLEEEIRELQEDSPIREKRSLRERTKPVNYALPPPLSEAN
                     VGEAFSRQAASSFSNASPRRGRGWNAGQNTGPTRRLFPTGGPFGGNDVTAIFGKNTNF
                     YNQHPSAENNKLLLDSDSSEDEILPIGASAKPKTSKKKKKKMEIADLDPLGVDMDIKF
                     SDIGGLDNFIDQLKEMVALPLLYPELYQNFSITPPRGVLFHGPPGTGKTLMARALAAS
                     CSSEGRKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPAIIFFDEIDGLAPVRS
                     SKQEQIHASIVSTLLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDREFYFPLP
                     DLKARAQILRIHTKKWKIPLSKDFIEQLALLTKGYGGADLRALCTEAALLSIQRKYPQ
                     IYRSDEKLLVDPNEVKVSTGDFMLALKKIVPSSARSTGNTSQPLPDTVKPLLLEQFEE
                     IKSMVTTILPEEENPITSSTSLIQHYIDYEDSNQLNDRSGTDSSKFMVHAIIEQISNS
                     RVCNPKLLLTGPPGNGQQYIGAAILNFFERYNVQKLDLASLVSDSGRTIESAIVQSFL
                     EARKRQPSVIYIPNLEIWSMAIPESVILTLSSLLRSLQGEERILLLAVSESSKATTAD
                     SPIKFLEFGNNVIHIRKPSASQRTNYFNSLPELLKMKPTFFITTRKRRKPLPKLPLAK
                     DYDASGGPIDSERKLGSDEILRKKLKSFQHQDMRLKNLLKIKLSGLMDLFKSRYKRFR
                     KPPIEDSMLIHLFEPPTDPNWQPAYVKDDNMILEVATGRKFYNMDLDLVEERLWNGYY
                     SEPKQYLKDIELIYRDAATTGDRERIIKASEMFANAQMGVEEMSTSDFIQECKATRQR
                     DLERQELYLRDEEAKIEREKRKMQESEVAKEDGQPEKTTQVGVASGNQLQAQLQAVAP
                     AADASSYHQYEDQNQDQDEDQDEDQYEDQDQDKEDKIKELAEDSTSAGAEDEETPERF
                     SVSDQDTEEKGVIDEDIQNNPQLEDQKFTHSNNSPTKGKDSEDMGDEKPEDRHDEQQG
                     VQESEEESDDEQQRELLIDEEKLTKIVTILVKKTNGFTVRQLEQLYSEIVRIVWPDRF
                     LWEKSKTMEKIMSCITDV"
     gene            complement(<112374..>112848)
                     /locus_tag="HG536_0A00580"
                     /db_xref="GeneID:59323338"
     mRNA            complement(join(<112374..112768,112827..>112848))
                     /locus_tag="HG536_0A00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281021.1"
                     /db_xref="GeneID:59323338"
     CDS             complement(join(112374..112768,112827..112848))
                     /locus_tag="HG536_0A00580"
                     /inference="similar to AA sequence:RefSeq:NP_014020.1"
                     /note="ancestral locus Anc_5.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136916.1"
                     /db_xref="GeneID:59323338"
                     /translation="MWLSESQKFGVAFTFGGFLFFTFGVFTFFDRALLALGNILFLAG
                     VLLIIGPQKTYVFFTRPTKRRGSVFLVFGVVLILMKWTFVGFLVESLGIVGLFGDFFG
                     VIVQFLRSLPLVGPVLSHPAVAPIVDRLAGIRVLPV"
     gene            <113288..>113881
                     /locus_tag="HG536_0A00590"
                     /db_xref="GeneID:59323339"
     mRNA            <113288..>113881
                     /locus_tag="HG536_0A00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281022.1"
                     /db_xref="GeneID:59323339"
     CDS             113288..113881
                     /locus_tag="HG536_0A00590"
                     /inference="similar to AA sequence:RefSeq:NP_011784.3"
                     /note="ancestral locus Anc_5.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136917.1"
                     /db_xref="GeneID:59323339"
                     /translation="MAPEAPVALAGDEDAMPELPSYEDVLKEDAQRMQGSQSAPPPRP
                     PRPSPSSRPQPPPGPQYRPRPQSSAPARPGLPWRYPSGFYCHKCNNTGYKIKNGRSCK
                     SCWRRFAPPNSAAATPSLTYGSNMWMSPFAARPMYMGAPSPAAPVSPGGRPLVVQPGD
                     PRLGGVVCGECRGTGRISFLLDEDICPLCRGIGRIIA"
     gene            <114038..>114772
                     /locus_tag="HG536_0A00600"
                     /db_xref="GeneID:59323340"
     mRNA            <114038..>114772
                     /locus_tag="HG536_0A00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281023.1"
                     /db_xref="GeneID:59323340"
     CDS             114038..114772
                     /locus_tag="HG536_0A00600"
                     /inference="similar to AA sequence:RefSeq:NP_011783.1"
                     /note="ancestral locus Anc_5.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136918.1"
                     /db_xref="GeneID:59323340"
                     /translation="MYHHPQVEALQARQGTPLNTRPVSPYTLRLPVDEDGFSWPSVGT
                     RARAKESEEQEKGRVERISGAIRTILEELGEDVTREGLLDTPERYAKAMLYFTKGYQT
                     NIMDDVIKNAVFQEDHDEMVIVRDIEIYSLCEHHLVPFFGKVHIGYIPNKNVLGLSKL
                     ARLAEMYARRLQVQERLTKQIAMALSEILKPLGVAVVIEATHMCMVSRGIQKTGSATV
                     TSCMLGCFRAHRTREEFLSLLGKRSL"
     gene            complement(<114939..>116591)
                     /locus_tag="HG536_0A00610"
                     /db_xref="GeneID:59323341"
     mRNA            complement(<114939..>116591)
                     /locus_tag="HG536_0A00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281024.1"
                     /db_xref="GeneID:59323341"
     CDS             complement(114939..116591)
                     /locus_tag="HG536_0A00610"
                     /inference="similar to AA sequence:RefSeq:NP_014019.1"
                     /note="ancestral locus Anc_5.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136919.1"
                     /db_xref="GeneID:59323341"
                     /translation="MTTIHLPSVPAAKLVLTPPQSALSSSEDPSIESYAPWPVLDRAA
                     GTAKCKYVTRGSMLGDGHFSVVKECMNVYTKDMYALKMVHKSMIKGKLQLIQREVKLL
                     RLVSDKIRQLEKKNFRTLDVFEGHHHVLQLFDYFETSESIALVTQLCDKGDLYERIIE
                     NSSLDLNLQVKPYCACLLSVLDFLHSNGVAHRDLKAENVLFRLRVNKNEPEEHHGNFK
                     YDLKAHDVILADFGLATQIDTPDASTNLKEFVGTTSYIAPEIVRCKGVGSMSLQEIQK
                     LEKYGCPVDIWALGVLTYFMALGYTPFDCDTDEETLECIKKVDYYVDEEMRADPKMKE
                     FWSFLECCFIENPAERPTATSLKHHPFVKDFFVTSASDDSSFILPQVMKKSGSTSSLH
                     SLRQPSRSASSSTLAFLSLNFNNTSPSPTAQASKPTTPPYREARISSRERSLKQVRDT
                     LKKTLSMTSLNSANHSISTVQSKLNSTFVLEPKPPVNSLMNGCFSTTPESRSNFSTPR
                     SLSRQSSASSIYVVSQPPAASNFISSPENEDLDDDEDMGIVI"
     gene            complement(<117136..>119295)
                     /locus_tag="HG536_0A00620"
                     /db_xref="GeneID:59323342"
     mRNA            complement(<117136..>119295)
                     /locus_tag="HG536_0A00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281025.1"
                     /db_xref="GeneID:59323342"
     CDS             complement(117136..119295)
                     /locus_tag="HG536_0A00620"
                     /inference="similar to AA sequence:RefSeq:NP_011782.1"
                     /note="ancestral locus Anc_5.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136920.1"
                     /db_xref="GeneID:59323342"
                     /translation="MSDAAKLGDNWFDEWKTESLYRGAVENCNDCIDGSPIAGSGIIV
                     GPILRLRNVDYESFAYKGSILVVTRSAGQGAAPRITYQTGYSYASDCGSKDPQISEGE
                     FKSELFHEEESGGSVFHFFRYDVEIPLADAEQMVKYKLDGEWRPHFRFFIPSKTANFN
                     MISYSCNGFSLSVDTTHFEGSLWFDILNKHAKIHYNVMLGGGDQIYSDSIKIYCEKVK
                     QWTQTTNPVKKFSTVVDDEFRRQLNEFYLTEYLEWYGYGHWKGSTPKSKCTQKCFPIA
                     MASIPSINIWDDHDIIDGFGSYSHTFMKTDAFSSIGKAAYKYYMLFQHHVSVTERKAY
                     LEDPMWIIGPNSSPYIREPSHSIFTRVGPNIGLLGLDCRTERKLKEIVSEATYDVVFE
                     KLVAEANNAKMDHLFVMLGVPIAYPRLVLLEWLFSSSLLAPVRALAKRGILGSGLINE
                     FNGDIELLDDLNDHWCARHHKKERNGLVARLQDYGAKYGIRITILSGDVHLASIGRFM
                     TKRHRRHIFSNSEQAERESAKVANEPENDMRLMFNVISSAVVNTPPPNGMVSLLQSKA
                     EIHHFDYETDEDAVPIFNVEVSGSGHRKEKCFLNKRNWSDIIPVENAMKNEYLSKLLK
                     AKVGDLILPGVVSDSAGLNKINGHDEHTKEIIKNGPDKGFFTYPITEKGVIVSLNMET
                     DMKNPDSKTTKYCLPIPELRMTCDSLSHSGLKHWNFH"
     gene            <119605..>121077
                     /locus_tag="HG536_0A00630"
                     /db_xref="GeneID:59323343"
     mRNA            <119605..>121077
                     /locus_tag="HG536_0A00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281026.1"
                     /db_xref="GeneID:59323343"
     CDS             119605..121077
                     /locus_tag="HG536_0A00630"
                     /inference="similar to AA sequence:RefSeq:NP_014017.1"
                     /note="ancestral locus Anc_5.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136921.1"
                     /db_xref="GeneID:59323343"
                     /translation="MSESKKRTAAESEVEAGSETQDGTVEEFAGLNLSGATLKAVEKM
                     GFTKMTPVQGRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIERLHSLKFKPRNGTGVI
                     VITPTRELALQIFGVARELMEFHSQTYGIVIGGANRRQEADKLVKGVNLLIATPGRLL
                     DHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTK
                     VEDLARISLRPGPLFINVVSEKDHSTADGLEQGYVVCESDKRFLLLFSFLKRNQKKKT
                     IVFLSSCNSVKYYAELLNYIDLPVLDLHGKQKQQKRTNTFFEFCNAERGILICTDVAA
                     RGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTKGKGKSLMFLTPNELGFLRYLKAA
                     KVPLNEYEFPTNKIANVQSQLEKLIKSNYYLHQTAKDGYRSYLQAYASHSLKTVYQID
                     KLDLAKVAKSYGFPVPPKVNITIGASGKTPPAKKRRIHKN"
     gene            <121373..>123622
                     /locus_tag="HG536_0A00640"
                     /db_xref="GeneID:59323344"
     mRNA            <121373..>123622
                     /locus_tag="HG536_0A00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281027.1"
                     /db_xref="GeneID:59323344"
     CDS             121373..123622
                     /locus_tag="HG536_0A00640"
                     /inference="similar to AA sequence:RefSeq:NP_011780.3"
                     /note="ancestral locus Anc_5.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136922.1"
                     /db_xref="GeneID:59323344"
                     /translation="MALQISFDKSKGNPRALSLCNNLKIALALEYASKDLKIDINELT
                     QGPQLIQGDSFRLFTADAILRYAMDDFEGQESEEYHYALSSLEALLEKKEIPKQHVEE
                     CVSKALGNYLTSLSEPVSATKLITFANSYALSQSLVTEKFPTLPRQIANAIKSAERLA
                     PRNIAAERTGAINIVDGLKVKELGKEILPKENERNILITSALPYVNNVPHLGNIVGSV
                     LSADIFARYCKARNYNTVFICGTDEYGTATETKALEEGVTPRELCDKYHEIHSNVYKW
                     FQIGFDYFGRTTTQQQTEIAQDIFTKLNNNDYLEEQTMKQLYCPVHKSFLADRYVEGE
                     CPKCHYDDARGDQCDKCGALLDPFELINPRCKLDNATPEVRFSDHIFLSLDKLEGRIK
                     EWVDRSSNEGNWSKNSKTITNSWLKDGLKPRCITRDLVWGTPVPLEKYNDKVLYVWFD
                     ATIGYVSITANYTKGWEKWWKNPENVKLYQFMGKDNVPFHTVIFPGSQLGTGDVWTML
                     HHLNTTEYLQYEGGKFSKSRGVGVFGNNAQDSGVSASVWRYYLASVRPESSDSHFSWD
                     DFVARNNSELLANLGNFVNRLIKFVNAKYNGVVPNYYIKNLPSFETVKQDINEILSNY
                     INEMEQAHERRGLEIAMSLSARGNQFLQENKLDNTLFSEQPDKADAVVGVGLNIIYAV
                     ASVILPFIPETAETIFRMLNAPALKIDNEFHLAILNGHNINKAEYLFQRIDEKQIQQW
                     REKYGGKQA"
     gene            <123907..>124698
                     /locus_tag="HG536_0A00650"
                     /db_xref="GeneID:59323345"
     mRNA            <123907..>124698
                     /locus_tag="HG536_0A00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281028.1"
                     /db_xref="GeneID:59323345"
     CDS             123907..124698
                     /locus_tag="HG536_0A00650"
                     /inference="similar to AA sequence:RefSeq:NP_011778.1"
                     /note="ancestral locus Anc_5.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136923.1"
                     /db_xref="GeneID:59323345"
                     /translation="MSKEIVDKASAVLGPRIELKTIAQGAEAVVFSTRVHPYLPSGHE
                     DKKYIVKYRPPKRYRHPSIDQALTKRRTLGESRLLAKLYLLEGLNVPKIIACDAYNGF
                     IWEEFLGEELPEGYGFSNLKNFLWMYSAKDRNPHDDVVKRTLIRVGQQIGLLHWNGYC
                     HGDLTSSNIVLENVEGSWQPYLIDFGLGSISDSVEDKGVDLYVLERAILSTHSSYADQ
                     YNAWLLKGFSDIYKGHGKIGQAKLKEVLSRFNEVRLRGRKRSMIG"
     gene            complement(<124720..>125937)
                     /locus_tag="HG536_0A00660"
                     /db_xref="GeneID:59323346"
     mRNA            complement(<124720..>125937)
                     /locus_tag="HG536_0A00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281029.1"
                     /db_xref="GeneID:59323346"
     CDS             complement(124720..125937)
                     /locus_tag="HG536_0A00660"
                     /inference="similar to AA sequence:RefSeq:NP_014016.1"
                     /note="ancestral locus Anc_5.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136924.1"
                     /db_xref="GeneID:59323346"
                     /translation="MGVKRKKSTRQLTATQQKVYDILQREIIERYFEPAVSDEQFELL
                     STLRYDPSFTNVFGGLRSGAEGFQLSEIDSRLRLLDYDQYDMFLNGQESTDGSNEGLH
                     NLFDSIVEPTSSAEDYNDSLMSLLDGSEVTVGSSPPNISPNAADLYPVFYNRFLLLGE
                     HYKRLNFTLQFFKWGTHVPLQLLLDKLIEALPEHSEVSDTEQKMSLLLNESACYKMRV
                     LVSKSGRMRVEAHPLTRSTDVGTFPNPSSYFINTILSAFLPESSTVWNVFIDTETLTV
                     SPFTTFKTTYRDHYNAARKRLAEMASRYGQSTQNEILVFNDAYQLMEGSITNVAVIRH
                     KDDDPSQIRFVTPPLSSGCLCGTMRYYLLKKRLLDEYPIDVRDLREGDKVILFNGVMG
                     CVKGVIRQSYKQN"
     gene            <126086..>128455
                     /locus_tag="HG536_0A00670"
                     /db_xref="GeneID:59323347"
     mRNA            <126086..>128455
                     /locus_tag="HG536_0A00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281030.1"
                     /db_xref="GeneID:59323347"
     CDS             126086..128455
                     /locus_tag="HG536_0A00670"
                     /inference="similar to AA sequence:RefSeq:NP_011777.3"
                     /note="ancestral locus Anc_5.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136925.1"
                     /db_xref="GeneID:59323347"
                     /translation="MVDSISRIASALESAKVITREAAAVASSKLGESSYTHYSEGIAP
                     EQLRELLNSRNSREVKDGLRRIIAIMASGDGSIDVETYFSDVVKNITFGDAKIKTLVC
                     IYLQRFAEGDSNLALLSINSLQKTLTDGDPEIRALSIKALADIKVPSLHPIVVHSLKK
                     AVSDSSASVRSEVSFAILKLFIARSDEFADELLQLLEQLLSDADPLVLSSAVVVLHEC
                     FPERLDLLHSHFRYFCSVLHRMDPFSQAVLITLLIRYCKTFLPRPKVVDTSSEAGESI
                     PLPNKYNEISFPVYDAEIHPDLGLFLKSLERLVFSSNATVLLASSNAFLQLATPMQFK
                     KSRLPQALVRAVSSSSNLGVQITLLQSCCLLSMIDPTLFLPYVKKFFVLPSDDAMVGS
                     LKVRILSILTNESNVKVIVKELKYIISNSKSPALVIAATNSLAVCAMLSPGWEAFIIK
                     GLISNMEIEKLPAAVLGSYVDVIRILVQRNPKRHISSIMKLVKVLDARKALSDNARAS
                     IVSIVGEIAAFEYKICPDILRKLVGTFAYEGPETRCQILLLSAKLLSYEIERFKAEQP
                     EETYNFSQSRVAQICQYVVHLAGFDEEFDIRDRARAISSLYDTGKYEIAALLFQAPKP
                     SPKMTLISDDVELGDHSIQHFGGSGLDKCVTAYYKMIPWNDEEPNAADDLRNPATLKD
                     YSRYTSSLSGSFISASKSSGTNLTQDSSASISHTSLASHQGKKYRLQTLDEFFSDIPS
                     TRTTKKKIVIQEESSSDESGETDSADDSEEDSTDQSSSSSSSVPVHNND"
     gene            complement(<128469..>131438)
                     /locus_tag="HG536_0A00680"
                     /db_xref="GeneID:59323348"
     mRNA            complement(<128469..>131438)
                     /locus_tag="HG536_0A00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281031.1"
                     /db_xref="GeneID:59323348"
     CDS             complement(128469..131438)
                     /locus_tag="HG536_0A00680"
                     /inference="similar to AA sequence:RefSeq:NP_014015.1"
                     /note="ancestral locus Anc_5.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136926.1"
                     /db_xref="GeneID:59323348"
                     /translation="MTYTLEIPQRPQSKGWKSSSETTLALMSVGNDGSRQLGGQYSIS
                     RELQQSFRLEASTAEPEDVLVRKMNSKNVSWREDEYHRQRFDRKLDSEVQKGGKRPLE
                     VQQTDTGDQQLIKKARWDVEAYQMPDQSRQAEVELRDKLLTADSAGISGLRFLKPSDH
                     RYFGEALQVQPLNELSSDQQKERLVVSLLLKIKNGTASVRKQAMRSLQDKCNYFGPKV
                     IFDRLLPVLLDSELEDQERNLMIKVVGRVLYALGGNVGPYTQRILLVVSPLLIDEDPI
                     ARETGREVIGTLAHSAGLANILTAMRPDVDNEDEYVRNITSRAMAVVAKALSVASLIP
                     FLDALCHSKKSWRARHTGIKIIQQTAILLRRGVLPHLQGLIECIKDGLTDEYTPIRNL
                     TANTVATLAQVSYPYGIESFNVILEPLWRGIRTQRGKVLACFLRALGSLIPLMDTEYA
                     AYYTREAMRVVKREFSSPDDEMKKAVLTVLQQCCKTEGITPKYLRQQVMPDFFKCFWV
                     RRTALDRQLNKLVTHTTTVMSEKVGTSCIIENLLKPLRDEAEPFRTMAVHAASKVVTL
                     LGTVDLDERLETRLIDALLIAFQEQTNNDSGIFKGFAAVAASFDRRMKPYLSPIISTI
                     LSHLKHKSPLVRQHAADLCALLAPVIKNCDELDTLNKLSIILYESLGEVYPEVLGSIL
                     SAMSNVILCSDLSKLQPPVNQIVPTLTPILRNKDRKVQFSIVELIGRIANSAAEFVAP
                     KEWMRICFELLELLKSPNKATRKIANETFGFIAQAIGPQDVLVALLNNLKVQERQLRV
                     CSAIAIGIVAKSCGPYTTLPALMNEYKTPETNVQNGVLKAMAFMFEYIGEMAQDYIYL
                     IAPLIEDALTDRDLVHRQTAANVIKHIALNCAGSGCEDAFIHFLNLLIPNIFETSPHV
                     ISRILEGLEALSHAVGPGIIMNYVWAGIFHPAKNVRTAFWKLHNNVYIQHQDSLVPYY
                     PSLGEAYIDIPEMDLVL"
     gene            <131550..>133544
                     /locus_tag="HG536_0A00690"
                     /db_xref="GeneID:59323349"
     mRNA            <131550..>133544
                     /locus_tag="HG536_0A00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281032.1"
                     /db_xref="GeneID:59323349"
     CDS             131550..133544
                     /locus_tag="HG536_0A00690"
                     /inference="similar to AA sequence:RefSeq:NP_012058.1"
                     /note="ancestral locus Anc_5.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136927.1"
                     /db_xref="GeneID:59323349"
                     /translation="MKGRNILVVLSCLLSWVVCEAEVVESSATLEIDQDIELPKDKGR
                     SAGTYEESCVVSGPYSSATESSLVDDVLPREDRVAQTEEMKPTSIVVEGRVSYPYEED
                     LVITPLANNYLLSSFTFNMQSEDFSPGKSALDYDEYGHYTVFPKAFKPIMDLTSTRQL
                     HLRFTRGFWDAESWGRLPHDGFRSGGSGVELWAAIEADTKDEAYRQWKTLANSLSGLF
                     CASINFIDRSKTTFPVKSFQPDGSLPLFNSTKRLHLVRAALANEPVCTENLTPFVKLF
                     PTKGKSGLSSLLDGHKVFDSSWHSLSIDVTTECDDASDHCRYALEAHVDVVINVLDVL
                     ARYERPIPRPAASDSLRCDTSKPFDAFQCFPLSDETEVSFNLSKIFGKPIMGSNLISS
                     RPSRVCVDIANDWNAYIEVDGVFYSTDDNCFDLKDLVKQNVYIESANSLNVVKSGEPP
                     LYISRSLTGYGQDRGGLRTVFKNPSSHAVRAIYFESLPWFMRVYLSTLKLEPGANFHE
                     NLTLENVMNSTYYLPAVDRARPTHLEYTITVPANTSFAISYQFDKSLLQYAEYPPDAN
                     HGFEIEAAVITVIEPSRYQMRTAPLLLLLSTPDFSMPYNVIILTSTVIGLIFGTLFNL
                     LVKRLVPVEVADKIEATSGLKHKVRNLRAILLAKLKRPTS"
     gene            complement(<133589..>134491)
                     /locus_tag="HG536_0A00700"
                     /db_xref="GeneID:59323350"
     mRNA            complement(<133589..>134491)
                     /locus_tag="HG536_0A00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281033.1"
                     /db_xref="GeneID:59323350"
     CDS             complement(133589..134491)
                     /locus_tag="HG536_0A00700"
                     /inference="similar to AA sequence:RefSeq:NP_012057.3"
                     /note="ancestral locus Anc_5.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136928.1"
                     /db_xref="GeneID:59323350"
                     /translation="MITSGHNPITLLKRILSLAEISPFVLIADSLAQSSRKLLEEVHY
                     NVKEDSKISIIYVSFETVDKPSYADVFIAAGSLSLDKLTQTVRTFLPSTNVPDGSKTM
                     VLIDSMNYISSNHVGQFVSGISSRNSTLLGVYHTDVPEYRESVSHYPKSIELLHFMAT
                     TVMEVQPVLPQNATEEQMKDDLSRFLIPRGLNNHTFQLVLTTRRKSGRSLSYKFLINS
                     ETHSYDNIVTSDLIEDRDNETPEMLQDLTTFNLTTSAKQKLAKEQVELPFLEAQSFNT
                     GGAIVYQFEKDDDYDEEDPFEDPF"
     gene            <134844..>139424
                     /locus_tag="HG536_0A00710"
                     /db_xref="GeneID:59323351"
     mRNA            <134844..>139424
                     /locus_tag="HG536_0A00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281034.1"
                     /db_xref="GeneID:59323351"
     CDS             134844..139424
                     /locus_tag="HG536_0A00710"
                     /inference="similar to AA sequence:RefSeq:NP_012056.1"
                     /note="ancestral locus Anc_5.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136929.1"
                     /db_xref="GeneID:59323351"
                     /translation="MPVVYGPQPLKPLNSETRHGFEEQYNSEQFLQSLANDFIFYFDD
                     KRHRTNGNPTPEEEKQEDANHYYQPIQDWKIMKDRQKTVSAALLLCLNLGVDPPDVIK
                     THPCARTEAWVDPLNFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFC
                     NSLRRTSKDDRILFHYNGHGVPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIY
                     VYDCNSAGNIVTNFQKFVQKRIRDEEEGIPNAAAPSRASAYAECFQLASCRSNELLLL
                     SPELPADLFTCCLTCPIEISVRVFLMQSPLKDSKYRIFFESSTGDSPDDSQQPYVCNT
                     PSVNIPGVLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMVAALFRNFL
                     LAKRIMPWYNCHPVSDPELPDSIADHPMWKSWDLALDEVLNKLVDDLKNAPATSDLES
                     KMILQQQESLQNQQPNQQQELKSGSIQGHSRFAVANLSTMSLASHPAIASTPKKSSAN
                     LQLTQPQPAPQQQFTGFFEQNLTAFELWLKYASNTRHPPEQLPIVLQVLLSQVHRIRA
                     LVLLSRFLDLGPWAVYLSLSIGIFPYVLKLLQSPAPELKPILVFIWARIMSIDYKNTQ
                     AELMKEKGYMYFVSVLVPDFGLHMSPTSGASLNSGSPLTMTASPNVNAPRGDAYHQQQ
                     QANAALTGLYHSSDTTDEQKAMSVFVLSSFVRDFPLGQKNCFSLELINKLCFYIDNSE
                     VPLLRQWCIIFIGQCCSQNPLNRFICMTAGIIDALIRSLKDPVPEVRAATLLALKHFI
                     SDIDDADHILKLQQGLEQQYQQLQTQLQQLRGSGHQQQSQPPDHPLLKIEQQIQHCQA
                     MQLQVQNIDSRKLKMQEISNLVSVLGLINDGSPLVRKEAIIFFSQVVYRYINFFIVVA
                     FNGLTEEIIQMEGSDADTQHYTDKFSVSHGSVFATVWEALLILAEDPFPENRALAGHV
                     VEYIILELSSHKDLGEPFSKIEQYLIKKSSSGAHSGKTGFTTSKVRVLKPTVPFSMES
                     DPSRREELKQQNGGSYITNNLGKIFRAFGLNDRNNHNSAPDGTAHGQEPKSSGISLLS
                     HHHGAAPTAKTAGASRSKPSFKLPLESTFLDYCREYFQEPQMRKHEADELGSVEYSTR
                     LWRRNRNEAVIQETQAQKSLALYGDWSSRLVTLDNKTHPKVIEFAQFENYLVAADERD
                     TITVFDWEQKVSLTKFSNGNPFGTKVTDLKFVNEDDAALLLAASSEGIIKIYKNIGCP
                     DDLEMISSWRGLTDMLLTPRSSGLLTEWQQIRGSLLTTGDVKIIRIWDAHTETVQVDI
                     PAKTSSLVTSITSDQLAGNIFVAGFADGSLRVYDRRMDPRDAMFRLWRSGNGRHRSCI
                     NNVHMQRGGYRELVSGATNGLVELWDIRSQNPVESFKDESFQQHGTEKRQTTMTTMEV
                     HEHAPIIVTGTKQIKIWTTSGDLLNSFKNHHSSGGVAGTLAATGIRSTVPSSSFLSAM
                     KFHPHKMMLAATSSHDSNINIFQCEDRRTEFY"
     gene            complement(<139484..>141040)
                     /locus_tag="HG536_0A00720"
                     /db_xref="GeneID:59323352"
     mRNA            complement(<139484..>141040)
                     /locus_tag="HG536_0A00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281035.1"
                     /db_xref="GeneID:59323352"
     CDS             complement(139484..141040)
                     /locus_tag="HG536_0A00720"
                     /inference="similar to AA sequence:RefSeq:NP_011776.1"
                     /note="ancestral locus Anc_5.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136930.1"
                     /db_xref="GeneID:59323352"
                     /translation="MTELSNKQIELVDRVIFDDTIQENSGQTDDNSLKEKTGGTFEYD
                     QDVTATTTDDDGMPASSHPMEAKILRKMDMFLIPLMGLLYFLSNLDKSNIGNAAVAGM
                     REDLKLVGNQYNTCVTVFFATYVLFDPIGTNLLKIMGPPTMMSCCLLAFGVISLCTAW
                     VKNYRHLIAVRLLLGAFEGMIYPSINMYLSMCYRREQYAKRFAYVFAAACLSSSFGGL
                     IGYACSKINGSLAAWQYIYIVEGAISIGFVPLYYFGLSKNLEDSWYFNGEEKEYIIQR
                     FKTMSTSNPNEKFEWFQAWLAIKDIKTWVSAVALFGIDLTTFGLTVFLPIIIESMGFT
                     SVRVNLMTVPVYFLTAIVFFICARWSDHIRLRSPFIIGACVTTSIGISIVLGSQVHGV
                     RYFGVYILCMGIYVNAAVNCLWLSGNNGNYFKRATALGINLFFGSGSGLVSGQIFLAS
                     DKPRYTKGLSISLAFQILSIIMTFVQFLLYRRENKKKEAIIERCHELNEPIPFDPRLS
                     DLNPEFRYMY"
     gene            142541..142613
                     /locus_tag="HG536_0Atrna2V"
                     /db_xref="GeneID:59324266"
     tRNA            142541..142613
                     /locus_tag="HG536_0Atrna2V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUG"
                     /db_xref="GeneID:59324266"
     gene            <142722..>145745
                     /locus_tag="HG536_0A00730"
                     /db_xref="GeneID:59323353"
     mRNA            <142722..>145745
                     /locus_tag="HG536_0A00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281036.1"
                     /db_xref="GeneID:59323353"
     CDS             142722..145745
                     /locus_tag="HG536_0A00730"
                     /inference="similar to AA sequence:RefSeq:NP_011774.1"
                     /note="ancestral locus Anc_5.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136931.1"
                     /db_xref="GeneID:59323353"
                     /translation="MGVHSLWDIVGPTAKPVRLESLQDRRMAVDASIWIYQFLKAVRD
                     QEGNALKHSHIVGFFRRICKLLYFGIKPVFIFDGGVPTLKRRTIQQRKERRQGKRDNA
                     EITARKLLAIQLQKKEGLVAEKSGTAEANRETTSQELFKPQDEWHLPVIPGFQYDEDD
                     QRVVSAETFEKMVHSMDEELDNIDLDSINPASAEFDELPKSTQYLILSTLRLKSRLRM
                     GYTKEQLEKLFPNSMDFSKFQIDMVKRRNFFTQKLMGVTGMHDGGSSKLTEEVAKRVS
                     GQLNKEYKLTKSDSGWTLGLGDFDGSETQKAIVLDDKEVEAFNYIRSHGNVDNTAQSP
                     KTDNKKGEGETDEEDGEDLEWEDVDVQPQNVQEREDYSIKAARLPNLEREPSSAGSQS
                     FLDKRYDYVSPMKRPYTKVVRHVEDDIEEGEDEQEDEYKRQLDEIELIEATQRSKNAL
                     KQLTEQQQQGSKRQRADIDSSLSGFKQPKLKTPDQEKRDENGSGDRTPTFAFTSEQTL
                     NDQAASTDSNDSSKDIVSSAATGFPLSENQQNLNHIISKIPDFNFGSEDSFLFQGTSK
                     NDIRNAKEDEQAKEKKPIQKPPAWFENNQAPSNPFSASHFVQDRAYSTSHDPQTNGPF
                     KLVSGADVLDLVQGAENHDDDVEELIDVGANVDVEEDHNLAAVEPGQPKNARKEERQA
                     LAFDYDFSEEEEDSLTENMKKEAEEFAMFQSSLSNKVVDKAFIEDELFEQQMKDKRDS
                     DEVTGDMILEIQDLLSRFGIPFLTAPMEAEAQCAELLKLKLVDGIITDDSDVFLFGGT
                     KIYKNMFQEKNYVEFYDEQSIMQNLGLDRERMIELAQLLGSDYTNGIKGMGPVSSMEV
                     LAEFGTLIKFRDWYNQGQFDKEKQKTENSFEKNLRKKLIKNEVVLTAEFPSDLVREAY
                     LRPEVDHDTTAFSWGTPDLDMLRDFMKVRIGWPQEKADEILVPLIRDINKRKKQARQM
                     KLNEFFPSTYMEDKKLHLGKRITSATAKLKQRKIK"
     gene            <145953..>146807
                     /locus_tag="HG536_0A00740"
                     /db_xref="GeneID:59323354"
     mRNA            <145953..>146807
                     /locus_tag="HG536_0A00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281037.1"
                     /db_xref="GeneID:59323354"
     CDS             145953..146807
                     /locus_tag="HG536_0A00740"
                     /inference="similar to AA sequence:RefSeq:NP_012055.3"
                     /note="ancestral locus Anc_5.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136932.1"
                     /db_xref="GeneID:59323354"
                     /translation="MPQRRPNANTKLPTASSPRMNTESCPNSFLVSNDAEERDVLRNR
                     RNRRFESSPIGETQQAEKSTSAAALNGPKIQASSNTPEFYLKLKAAPQSSSERMKSYC
                     QPNDSVFRQYTLMTYSSGAMASSLYPNYNVSVPYVQPRYSTYSLQSSVGPSAGQLQAQ
                     DKKAHSTAYQAQSFPSFFNPRTASNMPHKEKVNNWIENIPIFEVENGIWRSDCYDTNY
                     SVNWEESEFDDAAKADTISFVTHDELLYLQAKKFDSLVRKSYGSESEPKSSQRDILLD
                     NPTLTDYI"
     gene            <147007..>148074
                     /locus_tag="HG536_0A00750"
                     /db_xref="GeneID:59323355"
     mRNA            <147007..>148074
                     /locus_tag="HG536_0A00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281038.1"
                     /db_xref="GeneID:59323355"
     CDS             147007..148074
                     /locus_tag="HG536_0A00750"
                     /inference="similar to AA sequence:RefSeq:NP_011773.3"
                     /note="ancestral locus Anc_5.53"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136933.1"
                     /db_xref="GeneID:59323355"
                     /translation="MDRGSSESLTVKERMLSAGVGSLLTSLILTPMDVVRIRLQQQEM
                     LPDCSCDVPVPKGKVSMVPASEAVFWQDSCFKELNCKSSPHRFKGTIEAFGKIAQNEG
                     IFTLWRGISVTLLMAIPANVVYFTGYEYMRDISPIEHYFPAFNPLVCGALARILAATT
                     VAPFELIRTRLQSIPKSSKSTSTRAIMRDLLLETKKEVASSGYKVLFKGLQITLWRDV
                     PFSAIYWGSYEFSKKHLWQPSSPSSSSADSLSNWNFFTKSFISGCLSGAIAAVFTHPF
                     DVGKTRWQISYVNPQATSVTSPAPGTAVNKNMFRFIDGIRRREGIRSLYTGLSVRVAK
                     IAPSCAIMISSYEISKRIFSS"
     gene            complement(<148166..>149914)
                     /locus_tag="HG536_0A00760"
                     /db_xref="GeneID:59323356"
     mRNA            complement(<148166..>149914)
                     /locus_tag="HG536_0A00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281039.1"
                     /db_xref="GeneID:59323356"
     CDS             complement(148166..149914)
                     /locus_tag="HG536_0A00760"
                     /inference="similar to AA sequence:RefSeq:NP_012054.1"
                     /note="ancestral locus Anc_5.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136934.1"
                     /db_xref="GeneID:59323356"
                     /translation="MDRWSNMQVHGYGQIIDPPPDLPLHPLAAFPQSRELHRKKLVNK
                     LKGWFSGQRNDELSFFPEHYPHGWHGLKGDNADRHAEVSSEEGSDYTEPSTSSAQSQH
                     DNPYPAHDSAKTFLTGNNINANNIPQFPTKEGEKQLTRKGSMPELRPQLSLATTLKRR
                     PMSLVVSEPPKLSSFTGAALQSGNITVRKIIKRLNSIGNKKQECSKLIHKFLKDLAIW
                     GQKTSVENIESQALVEELEELFQQDMLLEQKIAEKIKVLTRELEFVGRRERQLSDEKK
                     TLLAALKKYENSKEIKGEFDEETNLFKERVMAHQKSFETYHSNYQYAVSVGARQLFKE
                     VAIEYYERASDLKEHSGNYLQTALKTLETTHQNEIFLKDLERLRMLRAERNWVKLKPE
                     QKSDPQSWINLVSGKQDFDDTLMKKVYEGLPVAYTPMPKASPKKAPQLDFKTGLEESF
                     SDIQSDRFNPITSNEFFSGKLTVKNNGAENESLYETVKVDRAEENNEDTVPRSLNPNV
                     LNRASNINVTAGPTLKRNSRHSTLGNLEAADKEPKKNEVERPDDGFILNFGQFSRQFL
                     DAERHLEENRWTEASG"
     gene            complement(<150136..>151611)
                     /locus_tag="HG536_0A00770"
                     /db_xref="GeneID:59323357"
     mRNA            complement(<150136..>151611)
                     /locus_tag="HG536_0A00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281040.1"
                     /db_xref="GeneID:59323357"
     CDS             complement(150136..151611)
                     /locus_tag="HG536_0A00770"
                     /inference="similar to AA sequence:RefSeq:NP_011772.3"
                     /note="ancestral locus Anc_5.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136935.1"
                     /db_xref="GeneID:59323357"
                     /translation="MSEVADFGLIGLAVMGQNLILNVADHGFTVVAYNRTTSKVDHFL
                     EHEAKGKSIVGAHSLQEFVSKLKKPRKIMLLVKAGAAVDYLINDLVPLLDQGDIIIDG
                     GNSHFPDSNRRFEELSKKGILFVGSGVSGGEDGARFGPSLMPGGAEEAWPHIKPIFQA
                     IAAKSEGEPCCDWVGPAGAGHYVKMVHNGIEYGDMQLICEVYDILKRVGGFADSEISE
                     VFGKWNTGVLDSFLIEITRDILKKNDTDGVPIVEKILDTAGQKGTGKWTAINALDLGQ
                     PVTLIGEAVFSRCLSALKAERTRASKILPGPEIPKGAITDKKQFVDDLEQALYAAKII
                     SYAQGFMLIREAGKTYGWKLNNPAIALMWRGGCIIRSAFLGEITKAYRENPELENLLF
                     HKFFADAVTKAQAGWRKTAALATQYGIPAPAISTALAFYDGYRCKRLPANLLQAQRDY
                     FGAHTFKVLPEFVSETYPEGKDIHVNWTGHGGNISASTYDA"
     gene            complement(<152105..>154069)
                     /locus_tag="HG536_0A00780"
                     /db_xref="GeneID:59323358"
     mRNA            complement(<152105..>154069)
                     /locus_tag="HG536_0A00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281041.1"
                     /db_xref="GeneID:59323358"
     CDS             complement(152105..154069)
                     /locus_tag="HG536_0A00780"
                     /inference="similar to AA sequence:RefSeq:NP_012052.1"
                     /note="ancestral locus Anc_5.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136936.1"
                     /db_xref="GeneID:59323358"
                     /translation="MLGAGRWDISKFWSEDYITGITAFIAQVNDDIVCIEREERFYRW
                     FIDDWASVLIQGLGRKAHDTDLLEHEALCHLLANFKRSLDVEQLDIACLRPLQSMLKQ
                     AKRRRDEMEKLLRRLYSDYSRYFKAMREALDMYNRKAALSVMEEAKECNVDKFPIELD
                     ECLKFNSEIALGQFLEKVKQSMPRQKKGFMNYLGMEGNSSFQGKQLMDAIKKNSEKLD
                     TSPYNLDRLGQKLLDLNLLREDALAVTSRRLFDQEAYYRWIETANDPSGRNSISGWVK
                     GFSATAVGDLPLEPLKTRYFETCCKLELSRFELEKAIYENFENYSHFATLEIDRTLRK
                     NRQIFNKLYGHDKGEAAVPHSPFLCYLRSSRAPIIKWEPAQDSLTQRTLMLGRDEIDD
                     DALRAISLILTHVQGFADEADLRKRVSKAWRAGSAVEMQRAINLKIELIKTFRDTPDA
                     TNLKSVEALIRANRHAVANDWTGLIKLWLLELPNSLIPPRCIETISKHHDDSWLAGMP
                     ANNLLVLAEMCQHFRWLGQEFAAFQGPISHYFMRRVDCIHDFPGDCRKLEPWLAAFLT
                     ASDSPERLQQASKDNNSRATTPASPSPPAIQVLEPEPTMTPPPADPDHSFKPRPFRTA
                     SAASSAPGSPLPSRDSRRISGLVIEAPESN"
     gene            complement(<154201..>154881)
                     /locus_tag="HG536_0A00790"
                     /db_xref="GeneID:59323359"
     mRNA            complement(<154201..>154881)
                     /locus_tag="HG536_0A00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281042.1"
                     /db_xref="GeneID:59323359"
     CDS             complement(154201..154881)
                     /locus_tag="HG536_0A00790"
                     /inference="similar to AA sequence:RefSeq:NP_012051.3"
                     /note="ancestral locus Anc_5.57"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136937.1"
                     /db_xref="GeneID:59323359"
                     /translation="MFLQLISYVGAVLGFLFLTLSIASGLYYISEIVEEHTEATRRFI
                     TRAIYTIIATFVLLLLFDSFPFKLSIFSIISNAIYLQNLKTFPFISLTSPVFLLSSCC
                     VVLNHYFWFKYFNDNEIPPQFRFDPNYIPRRRASFSEVASFFGICVWFIPFALFVSLS
                     AGDYVLPTTTTGSSKKTDEQTGEAPRLRKRAVGLARVVINSLRQYVYSIARVFGYEID
                     PNRGSLIM"
     gene            complement(155105..155176)
                     /locus_tag="HG536_0Atrna1T"
                     /db_xref="GeneID:59324258"
     tRNA            complement(155105..155176)
                     /locus_tag="HG536_0Atrna1T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /db_xref="GeneID:59324258"
     gene            complement(<156222..>157415)
                     /locus_tag="HG536_0A00800"
                     /db_xref="GeneID:59323360"
     mRNA            complement(<156222..>157415)
                     /locus_tag="HG536_0A00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281043.1"
                     /db_xref="GeneID:59323360"
     CDS             complement(156222..157415)
                     /locus_tag="HG536_0A00800"
                     /inference="similar to AA sequence:RefSeq:NP_012049.1"
                     /note="ancestral locus Anc_5.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136938.1"
                     /db_xref="GeneID:59323360"
                     /translation="MSFVKDFQPIALGDTNLFKPIKIGNNELKHRVVMPPLTRMRAHY
                     PGNVPNDWAIEYYDQRSKRPGTLIITEGTFPSAQSGGYDNAPGIWSESQLEQWKKIFA
                     KIHENKSFVWVQLCFLGRQAFPDTLARDGFPYVSASDEVYMDETQREKAVKSNNPQHG
                     LTKDEIKQYIKEYVQSAKNSIEAGADGVEIHSANGYLLNQFLDPISNKRTDEYGGSIE
                     NRARFTLEVVDAVTEAIGCDKVGIRFSPYGTFGTMSGGQEPLIVAQYAYVLGELEKRA
                     KAGKRLAFVHLVEPRVTDPLYTEDEGEYKDGTNDFAYSIWKGPIIRAGNLALHPEDVK
                     KMVADDRTLIGYGRFFISNPDIVDRVEKGLPLTKYVRETFYTMTKEGYTDYPTYDEAV
                     KLGYK"
     gene            complement(<158001..>160049)
                     /locus_tag="HG536_0A00810"
                     /db_xref="GeneID:59323361"
     mRNA            complement(<158001..>160049)
                     /locus_tag="HG536_0A00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281044.1"
                     /db_xref="GeneID:59323361"
     CDS             complement(158001..160049)
                     /locus_tag="HG536_0A00810"
                     /inference="similar to AA sequence:RefSeq:NP_012048.3"
                     /note="ancestral locus Anc_5.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136939.1"
                     /db_xref="GeneID:59323361"
                     /translation="MYNGELGGSISCGTKSYSCSRCRRLKKRCSKQVPSCNNCLKAGE
                     TCLYLGRAPRRTKKELEEAKLRGEFAPAKRRRCNSATQGSNSENGSYNSENHPNVNAL
                     THKLQPETETKALDRTALDRTSSLASVLGLIAESSQTAASPDLSFNSRNASFRITQSE
                     EAKAFSAGGLSRGGFRTADRDAGEAQMLPASRHEQSKGQLENRELESTPVDAPSIQFE
                     AITGIFKGGRVTPWKTENGQFKPIERSLYDRFLAAYFQHNHKSFYMMDKVAFLNKVST
                     IRDFNTMDGVVEGHFIFQLYMTMAIGCTTLQRAGMLTGDGEGLSEHFAFLAMKRFRAV
                     IRCQDIETIKCLLLLGIFALFEPKGVSSWTISGIIMRIAIGLGFNRALPNARLKKMSP
                     VDVELRYRVFWSAYCFERLVCTSLGRMSAIDDDEITMPLPRPLHPEEEEDLEVTNMMI
                     SVRKMSGRIYKKVHLVSVGRKNYTDEQKEEIVTSLAQEIDHIYNRERAKIQEKSALKN
                     CNDPISFHCSDVWLSMRYAQLNIMLYRPSALIPKPSMESLSKLGDFCLKALKHTYTLY
                     KRKMLPLNWITLFRTLTICNTILYCLCHWSIDFVESKIEMQQCAEILQHFGEKWVFAK
                     KCAVVFQNISTTILDICLSSGQVPNMEKLTRELFGASDEYQEILDENNVDVSWMDKRA
                     "
     gene            complement(<160199..>161533)
                     /locus_tag="HG536_0A00820"
                     /db_xref="GeneID:59323362"
     mRNA            complement(<160199..>161533)
                     /locus_tag="HG536_0A00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281045.1"
                     /db_xref="GeneID:59323362"
     CDS             complement(160199..161533)
                     /locus_tag="HG536_0A00820"
                     /inference="similar to AA sequence:RefSeq:NP_012046.4"
                     /note="ancestral locus Anc_5.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136940.1"
                     /db_xref="GeneID:59323362"
                     /translation="MTVQIMKRLAIIGGGPGGLATARVFLKNSTDYQIDLFEADATVG
                     GLWHYPDTGRDGRPMYEHLETNITKHIMQFSGFPFPSEVPTYPWRKNVFEYLKSYYAA
                     FIENEERVKVHLNTRVLQLSKKASMWNLTARNAEDDSLLEANFDYVVVANGHHLEPRM
                     PDDVAGLDEWVKNGAAIPARDFENCLFARGKNVVVVGNGSSGSDILNQVSTVADKVYH
                     SVRNVESVVSTTGYPKFEGLKTVPTIARVNWPTRTVEFSDGTQIGDIDYLIYATGYLY
                     SLPFADSSLRAQLLGDPDRTSACRIFNLWKQIFYVRDPTLAFSLLPQLIVPFPLAELQ
                     AALMVKAFNGDLTVPPQPDDVLDPELLQKQPAYHPIPDFKDVDYYRELQAILDGAGGS
                     NDPLQPVKWNEEYKQMRIASTGDKQKRNIILTQHASNLRAQNKPYELINFSL"
     gene            complement(<161911..>162390)
                     /locus_tag="HG536_0A00830"
                     /db_xref="GeneID:59323363"
     mRNA            complement(<161911..>162390)
                     /locus_tag="HG536_0A00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281046.1"
                     /db_xref="GeneID:59323363"
     CDS             complement(161911..162390)
                     /locus_tag="HG536_0A00830"
                     /inference="similar to AA sequence:RefSeq:NP_012045.3"
                     /note="ancestral locus Anc_5.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136941.1"
                     /db_xref="GeneID:59323363"
                     /translation="MQHHDLTSTAGMSHGHGDMDMGDSDSCSMNMLFTWSYKNTCVIF
                     RWWHIKTIYDLFLSFLAILFLSYLYEYLRYYIYKSQQNHGVLPGNSSSPERRRNKLYQ
                     SCWYGLQVGFSFMLMLVFMTYNGWLMIAVVLGATWGHYSWGARVKSATDEIPSMACH"
     gene            complement(<162573..>163886)
                     /locus_tag="HG536_0A00840"
                     /db_xref="GeneID:59323364"
     mRNA            complement(<162573..>163886)
                     /locus_tag="HG536_0A00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281047.1"
                     /db_xref="GeneID:59323364"
     CDS             complement(162573..163886)
                     /locus_tag="HG536_0A00840"
                     /inference="similar to AA sequence:RefSeq:NP_011770.3"
                     /note="ancestral locus Anc_5.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136942.1"
                     /db_xref="GeneID:59323364"
                     /translation="MAVSKIYARSIYDSRGNPTVEVEITTQDGTFRSIVPSGASTGVH
                     EALELRDGDKAKWMGKGVTQAVANVNNVIAPAFVKANIDVKNQEAVDEFLNSLDGTPN
                     KGKLGANAILGVSMAAARAAAAEKKVPLYKHLADLAQAKPSPYVLPVPFLNVLNGGSH
                     AGGALALQEFMIAPTGASSFAEAMRIGSEVYHNLKSLTKKRYGASAGNVGDEGGVAPN
                     IQTAEEALDLIVDAIKAAGHEGKVKIGLDCASSEFYRDGKYDLDFKNPQSDSSKWLTG
                     PQLADLYHSLTKKYPIISIEDPFAEDDWEAWSHFFKTAGVQIVADDLTVTNPLRIKTA
                     IEKKAADALLLKVNQIGTLSESIKAARDSFAANWGVMVSHRSGETEDTFIADLVVGLR
                     TGQIKTGAPARSERLAKLNQLLRIEEELGDKAVYAGEKFHHGFQL"
     gene            complement(<164563..>166968)
                     /locus_tag="HG536_0A00850"
                     /db_xref="GeneID:59323365"
     mRNA            complement(<164563..>166968)
                     /locus_tag="HG536_0A00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281048.1"
                     /db_xref="GeneID:59323365"
     CDS             complement(164563..166968)
                     /locus_tag="HG536_0A00850"
                     /inference="similar to AA sequence:RefSeq:NP_012042.1"
                     /note="ancestral locus Anc_5.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136943.1"
                     /db_xref="GeneID:59323365"
                     /translation="METRVVEDHVQLANATGNVPLLARLVNYQPLFSTQPKLKSYPLS
                     ELSSPEQRGIQEALVVRDLLNVLVGLEGVYIRYNNSYDPHSGAVPDFKIAKMMDPSFK
                     SFSKRIARLGKYYVVLTKTAEKWSEPSFGSILHRLGFEIKQFLRFTYLSFISGRLERD
                     FRESTTFSISELEQSLNDAEITKQMEILFTMVERIDREDRARRHMDHVKEDFDNFIND
                     LKDQSDRGYILATDTRMLPIAKGAVILRIIQTMVHENLGDRYSVSFLQKILNSVAGNY
                     CDMLFLWLTEGRLNDPYDEFMVVDTMNSVNDVTSYLQYGDRLWDTQYVIRKDGILEQF
                     EPNDDNELLFMVLTTGKLVNLIKTSLGKVDFTLATSATDEITNFSDLMEGSNLELYVD
                     KWYKEANRLCLKMYFEGYDLMAFFKMLEKHYLGYHNIAGITKFLQKNMVELTRRFKKN
                     GYDQEKLQRTFQNELKSNLSSNEDLVKQLLNLQLDDQSFEEVIMEYVGQDYSTNGGRT
                     MSNQDDGDRLLSANNFQNLKDILLQELKPLSSGADGLKAAKSTIYHLNFEIIVPFPLS
                     IIVTRTCIVQYQIISRYSFLLQYNSKLLDDTWIEINKNASWRYTGFSKQVRLLIIRKS
                     RVVHNRMNQFIKLILEYFTQVVVEREIKITSKTSQKRATITDWQLSLQESLTNIMTNC
                     CLSQLIEIQLQIFEIIHKFCKFITSMRREFCQLDPHLFQLYLESHSRRQNKPSRLYSS
                     EESTKIISEYTRFVDLAANGFNQHIAAFKEGLMHHYSANGSKDTSSDDNHNTARLLAC
                     LPG"
     gene            <167572..>168354
                     /locus_tag="HG536_0A00860"
                     /db_xref="GeneID:59323366"
     mRNA            <167572..>168354
                     /locus_tag="HG536_0A00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281049.1"
                     /db_xref="GeneID:59323366"
     CDS             167572..168354
                     /locus_tag="HG536_0A00860"
                     /inference="similar to AA sequence:RefSeq:NP_011769.1"
                     /note="ancestral locus Anc_5.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136944.1"
                     /db_xref="GeneID:59323366"
                     /translation="MFLTRSEYDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSE
                     GVVLGVEKRATSPLLEADSIEKIVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLY
                     YDEDISVESLTQSVCDLALRFGEGASGEERLMSRPFGVALLIAGYNKDTGYQLFHAEP
                     SGTFYRYNAKAIGSGSEGAQSELQNEWHSSLTLKEAELLVLKILKQVMEEKLDENNAQ
                     LSSITKEDGFKIYDDSKTAEIIAKLKEQEAQHATDDQDVEMS"
     gene            complement(<168432..>169958)
                     /locus_tag="HG536_0A00870"
                     /db_xref="GeneID:59323367"
     mRNA            complement(<168432..>169958)
                     /locus_tag="HG536_0A00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281050.1"
                     /db_xref="GeneID:59323367"
     CDS             complement(168432..169958)
                     /locus_tag="HG536_0A00870"
                     /inference="similar to AA sequence:RefSeq:NP_011768.1"
                     /note="ancestral locus Anc_5.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136945.1"
                     /db_xref="GeneID:59323367"
                     /translation="MVAKRRKVRNRNEEKAEEPDLKKQKPTNDDSKKELEKAEQQIKD
                     EVKLTDVEEQSKERREAEKNAELASEAGAKDILEEDREVGGQSEGLEGSNESEGPKLP
                     DLDEKAEQKGNTKTGPDNEANQAPEPTAVTHQVIEDEENGIAKFEFDGVEYKFKERAS
                     VIEEREGRIEFRVVNNDNTKENLMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMA
                     VVRKPLTVVGGITYRPFEKRQFAEIVFCAISSTEQVRGYGAHLMNHLKDYVRNTMNIK
                     HFLTYADNYAIGYFKKQGFTKEITLEKSIWMGYIKDYEGGTLMQCTMLPRIRYLDAAK
                     ILLLQEAALRRKIRTISKSHVIRPGLKVFRDLKNIKPIDPMSIPGLKEAGWTPEMDEL
                     AQRPKRGPHYAAMQNILTELQNHAAAWPFLQPVNKEEVPDYYEFIKEPMDLSTMEVKL
                     ENNRYEKMENFIYDARLIFNNCRLYNGENTSYFKYANRLEKFFNSKVKEIPEYSHLVD
                     "
     gene            complement(<170104..>171990)
                     /locus_tag="HG536_0A00880"
                     /db_xref="GeneID:59323368"
     mRNA            complement(<170104..>171990)
                     /locus_tag="HG536_0A00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281051.1"
                     /db_xref="GeneID:59323368"
     CDS             complement(170104..171990)
                     /locus_tag="HG536_0A00880"
                     /inference="similar to AA sequence:RefSeq:NP_012041.1"
                     /note="ancestral locus Anc_5.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136946.1"
                     /db_xref="GeneID:59323368"
                     /translation="MSDATLKYGSPLQSFLDASFFQELCRLKLDVLKLDSRGQPLFAC
                     LDTSYTFKSRNSVPLSLNERTFQRESLRTSSGVRIYGVLHNFNRFEEFKSLDKQEFVK
                     RRATEVYHAGLININDSVSFHVISFADLKEYRFYYWVCVPCFQKKTLSIKVLETRPLK
                     VAERYQKWFEERVGDWVALLSDQNELIPYNRQDAGTCKALIVRDTCRLDNIPSALTKN
                     FLTIFNHDSPDRDTLEVLFIRPADSSFVLTLSLHDLQTGGNEHLQFSGWERNTQNKLG
                     PRGVDLSSLIDPLKIADQTVDLNLKLMKWRLVPELDLEKVKGAKALLLGSGTLGCYVA
                     RALMAWGVRKITFVDNGNVSSSNPVRQPLFEFHDIGKNKALAAAEAVKKVFPLLDAEG
                     VELSVPMIGHPVTNEEVEHASYERLCDLFDEHDVVFLLMDSRETRWLPTVMGNAKGKI
                     VINAALGFDSYLVMRHGNYSGVQGPRLGCYFCHDVFAPKDSMKDRTLDEMCTVTRPGV
                     ALMAASQAVELFVSLLQPRTGGDNEETILGELPHQIRGFLNNFSTLKLRTPAYDHCSA
                     CCPSVVDSYKSLDWDFVRSALNDHTYIEELSGLAKVQLEAERASEQWKIDDVEIDDEM
                     YALN"
     gene            complement(<172171..>173736)
                     /locus_tag="HG536_0A00890"
                     /db_xref="GeneID:59323369"
     mRNA            complement(<172171..>173736)
                     /locus_tag="HG536_0A00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281052.1"
                     /db_xref="GeneID:59323369"
     CDS             complement(172171..173736)
                     /locus_tag="HG536_0A00890"
                     /inference="similar to AA sequence:RefSeq:NP_012040.1"
                     /note="ancestral locus Anc_5.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136947.1"
                     /db_xref="GeneID:59323369"
                     /translation="MMDYTHMNHEQVQQQQQLQAATVLCCNCGVPIDGSGGLVMCYDC
                     IKMTVDITEGIPREANISFCRNCERFLQPPGQWVRAELESRELLAICLRRLKGLTKVR
                     LVDASFIWTEPHSRRIRVKLTVQGEAIANTIIQQTFEVEYVVVAMQCPDCARSYTTNT
                     WRATVQIRQKVPHKRTFLYLEQLILKHNAHVDTISISETKDGLDFFYGQKNHAVKMID
                     FLNSAVPIKHKKSEELISQDVHTGSSTYKFSYSVEIVPICRDDLVVLPSKLAKSLGNI
                     SQFVVCSRVTNTVQFLDPNTLQTADLSAQVYWRTPFSSLADVSQLVEFIVLDVEPTGV
                     SRGKNVLADITVARAADLGVNDQEYYVRSHLGALCHAGDSVMGYFIANSNYNSDLFDG
                     LNIDQVPDVVLVKKLYRRKTKKNRNWKLKRMAREHKDIDASQDYSSRTQKQEMERAER
                     DYEVFLQELEEDSELRQSINLYKNVQQTYPSQEHEMDEDDDEDAPQIDIDELLDELDD
                     MTLEDGKHDEAVA"
     gene            complement(<173878..>174441)
                     /locus_tag="HG536_0A00900"
                     /db_xref="GeneID:59323370"
     mRNA            complement(<173878..>174441)
                     /locus_tag="HG536_0A00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281053.1"
                     /db_xref="GeneID:59323370"
     CDS             complement(173878..174441)
                     /locus_tag="HG536_0A00900"
                     /inference="similar to AA sequence:RefSeq:NP_011767.3"
                     /note="ancestral locus Anc_5.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136948.1"
                     /db_xref="GeneID:59323370"
                     /translation="MSRSKEIQEKLDLQAKLQRSFGRNTKRVLSWLAIKDTEEPVDTT
                     ELNNSKATFFTLPVMQTGSGLNLNPVASTSENRDDIHTVGEFIQSEKKVSSLSKKRRP
                     HHSTQSSGIHRISKDDTRAMVALKRKMRQNQREAARRKTQPAAASANERNGHDGESED
                     EDDDRPVQKASKKSFGLLFSGGKKAKR"
     gene            complement(<174575..>175888)
                     /locus_tag="HG536_0A00910"
                     /db_xref="GeneID:59323371"
     mRNA            complement(<174575..>175888)
                     /locus_tag="HG536_0A00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281054.1"
                     /db_xref="GeneID:59323371"
     CDS             complement(174575..175888)
                     /locus_tag="HG536_0A00910"
                     /inference="similar to AA sequence:RefSeq:NP_012039.1"
                     /note="ancestral locus Anc_5.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136949.1"
                     /db_xref="GeneID:59323371"
                     /translation="MSELSKNNFKSLGLPRWLVDSLMAMKITQPTQIQKACIPPILKG
                     GDCIGGAKTGSGKTIAFAAPMLTKWSEDPSGMFGVVLTPTRELAMQIAEQFTALGSSM
                     NIRVSIVVGGESIVSQALELQRRPHFIIATPGRLAHHILNSGEDTVSGLKRAKFLVLD
                     EADSLLTKTFANDLNVCVGALPPKNRRQTLLFTATITDQVRALQDAPDQENKPPLYCY
                     EVESVDKVAVPSTLRTEYILVPEHVKEAYLYQLLTCEEYKDSSAIVFVNRTMAAEIMR
                     RTLRALDIRVASLHSQMPQQERTNSLQRFRANAARVLIATDVASRGLDIPVVELVVNY
                     DIPSDPDVYIHRSGRTARAGRRGDAISFITQRDISRIEAIESRINKKMQECTKVHDTA
                     VIRKSLNKVTKAKREALMAMEKENFGERRKIQRKKNNTDQKSLRA"
     gene            complement(<176143..>177783)
                     /locus_tag="HG536_0A00920"
                     /db_xref="GeneID:59323372"
     mRNA            complement(<176143..>177783)
                     /locus_tag="HG536_0A00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281055.1"
                     /db_xref="GeneID:59323372"
     CDS             complement(176143..177783)
                     /locus_tag="HG536_0A00920"
                     /inference="similar to AA sequence:RefSeq:NP_012038.2"
                     /note="ancestral locus Anc_5.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136950.1"
                     /db_xref="GeneID:59323372"
                     /translation="MRAAFRSSVVRLDLRFFSQESLKAPDNAPRAAANEQWLDHLKKS
                     KRDPRIASNLSESREELTDDTHQSNEFPINILSIPPETHYINVESSLANFTSMKYLGT
                     FNKHKHRQGNFADVRIIKCRSGGGGDGAVSFFRDAGRSIGPPDGGDGGDGGSIYVQAV
                     EGLNSLSKLRTTYIAEDGSNGGADQLDGARGKDMLITVPVGTVIRWCMDPKSTRDFIQ
                     KQRPSSGNGSSVRSVLHKSMVKLQCRGRFELDPIPRCIQLFRNSYRPGEGWIFKGKDE
                     VYHNDKEWFIDLNKKVESYDMSLYDTELEEDTFPLFGLDLGKPTKKPICLLKGGKGGL
                     GNMHFLTNLIRNPRFAKSGRAGLEQYFMLELKSIADLGLVGLPNAGKSTILNRISNAR
                     PRIGHWEFTTLTPTIGTIDLGLGEACFTVADIPGIVKDASNDKGLGLEFLRHIERSRG
                     WVFVISIANDDPMADLQTLINELGGIEKAKSKNVLVVCNKADIDFDKEHPINKFNEIA
                     EFCKEHSWDILPMSALKGENVDILVKKMAKCAQATGHF"
     gene            complement(<177948..>178724)
                     /locus_tag="HG536_0A00930"
                     /db_xref="GeneID:59323373"
     mRNA            complement(<177948..>178724)
                     /locus_tag="HG536_0A00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281056.1"
                     /db_xref="GeneID:59323373"
     CDS             complement(177948..178724)
                     /locus_tag="HG536_0A00930"
                     /inference="similar to AA sequence:RefSeq:NP_012037.1"
                     /note="ancestral locus Anc_5.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136951.1"
                     /db_xref="GeneID:59323373"
                     /translation="MDNSCFERLCEQEQALHENYRHLNSVFRVLHELTDTSKDESAQM
                     DTLESLSDEYSSLVASSVDLRFSKYQARESQVAALQRTRRNSNYARLQSVENLAEFIT
                     LLENISRNYLTYVNLLKRLSIDLVKEIEIADPSVTEFVVDKWNPPKSLQPILEDLGDC
                     NTDPQAAVARLDGYLDQIKMERAKYTIENRHSLQGILRDLNKEVSDWRKEWDSIENWM
                     FGDSAHSMKKMLQNIDSLKSKLQRQERLENGTDSQVANAS"
     gene            <178889..>180742
                     /locus_tag="HG536_0A00940"
                     /db_xref="GeneID:59323374"
     mRNA            <178889..>180742
                     /locus_tag="HG536_0A00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281057.1"
                     /db_xref="GeneID:59323374"
     CDS             178889..180742
                     /locus_tag="HG536_0A00940"
                     /inference="similar to AA sequence:RefSeq:NP_012036.1"
                     /note="ancestral locus Anc_5.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136952.1"
                     /db_xref="GeneID:59323374"
                     /translation="MNLEDQIQVVQDIRLSLRRSATKLSKLKLYKSSKWAAEALCGMI
                     ELSSLTVSDAAGSASRDGNDTREDNQGYQDFSELSEQEYDLYLLASTLFDCKEFDRCA
                     FFLKDVSNPCLKFLKLYAEYLSWDSKVRNSTEDILTSGKTPRHMIRNANHANDSNREL
                     GSRGASKSPLSGDGQQADSPVIMKELTSFLEKTETQETGSNIGIALLYYLKGILLKHD
                     DNKSEASSCFLRSLSLYSYNWTCWVELLDCLSRSDESLLLLKHIESKLKLQSNDNIRS
                     QSSIQDNAMMKFFRVALFQEFSGNVDVFLEELHYLHSIFPNFTYLKAQNALINYNYMD
                     YGNAESLFDQIVKSDPYRLDDLDTYSNILYVMQKHSKLAYLAQFTSHVDKFRPETCCA
                     IANYYSARQEHEKSIMYFRRALTLNRNCTSAWTLMGHEFVELRNSHAAIECYRRAVDI
                     NPKDFKAWYGLGQAYEVLDMYLYSLYYFQKACTLKPLDRRMWQALASCYSKVGNRQEA
                     IKCYERALQLSLNVDQDSVLFYRLAELYEQIHDVANCKKFMVRCVDVEEATEGLITDE
                     TAKARLWLAKFEAKRKNYEQAYNYAVGVSHGTSQEIEEARSIARECRQRIQ"
     gene            <180934..>188196
                     /locus_tag="HG536_0A00950"
                     /db_xref="GeneID:59323375"
     mRNA            <180934..>188196
                     /locus_tag="HG536_0A00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281058.1"
                     /db_xref="GeneID:59323375"
     CDS             180934..188196
                     /locus_tag="HG536_0A00950"
                     /inference="similar to AA sequence:RefSeq:NP_012035.1"
                     /note="ancestral locus Anc_5.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136953.1"
                     /db_xref="GeneID:59323375"
                     /translation="MVDQIPPVSTKQTDGRGSISIGSLPPPPPTQFDGDEPPPPPPGF
                     DDGALPPPPPPPGFEDDILQPPPPPPDFDSDITESRIMRTHDSTSHVSGYERAELDND
                     SIRISSDHKRNLESRYASNSQRKRLKKGKRSSKKVRVATQKPEMPPEHLRKIIDTHSD
                     MASKRFNYDKRAFLGALKYMPHAMLKLVENMPQPWEAVKEVKVLYHVTGAITFVNEIP
                     RVIEPIYTAQWASMWLAMRREKRDRSHFKRMRFPAFDDDEPPLSYAQNILACEPLDPM
                     HLDLDKLEDTFVKDWFYDSRPLANDEDKVNGSSYRRWFLPPPVMANLQRLATPLRNEI
                     QDHNYYYLFDKKAFLTSKALNTAIPGGPKFEPLYPHEEEEDFNEFNSIDRIIFRVPIR
                     SEYRIAFPHLYNSRPRSVEISWYGDPISCLIKNQNDTENPTFFFHSSLNPIIAENDNT
                     NIHRLSDYKISLPQELTPAMADEELVFPDSKDAFELFFSPFPFNKNSGKMVRAQDVPL
                     IKSWYLQHPDEEYPIKTRVSHQKLLKTYVLNELKPKNGISTRKVKLLKDFRNTKYFQQ
                     TTIDWVEAGLQLCRQGHNMLNLLIHRRGLTYLHLDYNFNLKPTKTLTTKERKKSRFGN
                     AFHLIRELLKVIKLLVDSHVQYRLGNVDSFQLADAIYYILNHLGQLTGIYRYKYKVMH
                     QIRACKDLKHLVYFRFNKIIGKGPGCGFWQPAWRVWIFFMRGIIPLLERWLGNLLTRQ
                     FEGRSNEIIKTTTKQRAEAYYDLELRASVMKDILEMIPEGIRQKKARTVLQHLSEAWR
                     CWKANIPWDVPGMPEPIKNIIERYIKAKANGWISAAHHNRERMRRGAHVEKTVVKKNL
                     GRLTRLWVKNEQERQQLIEKNGPEIQPDEATAIFATMVNWLESRNFSPIPFPPLAYKN
                     DTKILVLALENLKDVYSSKVRLNSTEREELALIEEAFDNPHETLNRIKKYLLTQRVFK
                     SIDLTMVDHYRTISPVFAVDPLEKITDAYLDQYLWYEADERNLFPNWIKPSDAEIPPL
                     LVYKWCQGLNNLTDVWDVSNGQSTAILETRLGEMAEKVDFTLLNRLLRLIVDPNIADY
                     MTAKNNVVLNYKDMAHVNKYGLIRGLQFASFIYQYYGLVMDLLLLGPERANDLAGGPE
                     SPNDFMQFKDIETEKRNPIRLYVRYLDKVYILFQFEEKEADELTEDYLSENPDPNFAN
                     AVGYNNKKCWPRDARMRLMRQDVNLGRAIFWEMESRIPSSLAVLKWETSFVSVYSKDN
                     PNLLFTMCGFEVRILPKHRIDEVIYTSEGVWDLLDDNTKERTAKAFLKVSQEAIEDFD
                     SKIRGILMASGSTTFTKIAAKWNTALLSLFAYFREAIVATEPLLDVLVKSETRIQNRV
                     KLGLNSKMPTRFPPAVFYTPKELGGLGMISASHILIPASDLTWSRQTETGVTHFRSGM
                     SHEDEKLIPTIFRYITTWENEFLDSRRVWAEYAAKRHEALQQNRRLAFEELEGSWDRG
                     IPRISTLFQKDRHVLAYDRGHRVRREFKSFSLERNSPFWWTNAHHDGKLWNLNAYRTD
                     VIQALGGIETILEHTLFKGTGFSSWEGLFWEKASGFEDSMQFKKLTHAQRTGLSQIPN
                     RRFTLWWSPTINRANVYVGFLVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESI
                     VFDVCQILDGELDVLQIETVTKEAVHPRKSYKMNSSAADVTMTSMYQWAVSKPSLLHD
                     SKDSFDATYSKKMWFDVQLRYGDYDSHDISRYVRAKFLDYTTDNVSMYPSATGVMIGI
                     DLAYNMYDAYGNWFSGLKPLVQNGMRTIMKANPALYVLRERIRKGLQIYQSNIQEPFL
                     NSSNYAELFSNDVKLFVDDTNVYRVAVHRTLEGNVATKAINGCVFTLNPKTGHLFLKI
                     IHTSVWAGQKRLSQLAKWKTAEEVSALIRSLPKEEQPKQIIVTRKAMLDPLEVHMLDF
                     PNIAIRPTELRLPFSASMAIDKLSDVVLKATEPQMVLFNIYDDWLERVSSYTAFSRLI
                     LLLRGLKTDEEQAKMILLGDPTIPIKPHHLWPSFSDEKWIEIEAKMRDLILGAYGKKY
                     NVNISALTQTEIKDLILGQNIKAPSVKRQKMAELEAARIEDHADSLDAGASSVMKTKT
                     VNAQGEEIVVVTSANYENEAFSSKNEWRKNAIANSLLYLKLNNIYVASDDFIEEKDVF
                     VLPRNLLKKFIEISDVKIQVAAYMYGCSSPEHPNVKEIRTIALCPQLGNGNSVRICKP
                     PITEDQPELEDLQLLGWVHTQTQDLKFMTAPEVTTHTRVFASHFKEKIDLTVCLLPGC
                     VSLAAYNLTDEGYNWGTQNQGVADIISEGFDPGFSEHAQLLLSERFMGNFLVPSSDFW
                     NYTFMGASFTEELRYDMKIGIPLEFYNETHRITHFLQFSATNEDEAVDAEQEDPFA"
     gene            <188381..>189220
                     /locus_tag="HG536_0A00960"
                     /db_xref="GeneID:59323376"
     mRNA            <188381..>189220
                     /locus_tag="HG536_0A00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281059.1"
                     /db_xref="GeneID:59323376"
     CDS             188381..189220
                     /locus_tag="HG536_0A00960"
                     /note="ancestral locus Anc_5.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136954.1"
                     /db_xref="GeneID:59323376"
                     /translation="MSNKLHLQVMETFSNRLLRKRDALLRSISKSDKRRDDGQEVRQQ
                     LSVERDSGHNNLTVAVHRSVRNLIKLGFTFSQIVEGSGVSDAFLRQAFRELSLDLPNA
                     KQLEEPRDDRNSTGYLKPRFTVPKEDNNPNSLPEGSNQDTEKQTRRMIEPELRLFMLK
                     TRLEINRLRSLAKQPELAEQLKQDDAQSAIGKLKNAIFSNLQDFFNEIEVADPVRTST
                     RNDETPKRAHGDINLTLERSRKRAKTQNLRDMKGDPNAKENVEVSQKTDPSMVCDSMH
                     HRA"
     gene            <189703..>194070
                     /locus_tag="HG536_0A00970"
                     /db_xref="GeneID:59323377"
     mRNA            <189703..>194070
                     /locus_tag="HG536_0A00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281060.1"
                     /db_xref="GeneID:59323377"
     CDS             189703..194070
                     /locus_tag="HG536_0A00970"
                     /inference="similar to AA sequence:RefSeq:NP_012034.1"
                     /note="ancestral locus Anc_5.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136955.1"
                     /db_xref="GeneID:59323377"
                     /translation="MPTTPEKKRSGHLVASPEGGISAATKKPSTGGSKRKRKYQFAPV
                     DTLGNRSNDESNVLRAISVSQVRNSTVTKSSRQEKKASESKLRGSAPIAKAKHDARES
                     RVATGGEDGMPSEKVIWQYSPVREEHSDKVGSSYENSEDWMEPDRFEEPSSTPMPRRL
                     KSVLSFANISEREQTDNACPMSVPARISTRSRGTTESLRESLRDIDDILDDMEGELTL
                     KPNVPKMSQIPSSPSRMREQEKGDTADKKSEGDCAYASSDGDDSLINILTEKKSERQN
                     SARPLTDSDLLDDSLVDYFNEINNRKAGECCEDDIGNVEARLSQSLRIPETDSRQEPE
                     AKMDGYIKLAGFPSRRKGVERFVVTKTAEVSLPKIGRQKILSCIDEHGKNTSVIVRHP
                     WIYLEFEEGDVIHIVEGQNFENKKLLSDDKDPTTQLVNDNLLILNPDLLLSATEVGGS
                     VECLRRAVLQSVLEDSRGEPSIAMIVGNIVHELLQSALINMVNNKTLTMDFLEKKLDS
                     LLQTFSFAILLCNASIKTVRKEITEMHLKNIHNLLTRYVKQGNYGCYVSVSGTRKTDP
                     LSIANVIDTEESVWSPIYGLKGFLDVTLDVLCKKTRSIVPLEVKTGKSKSISHEAQGL
                     IYTLLLNDKYEVPFDFFLLLYTRHNEMIKHPYMLHSIKHVLMFRNQMATKLKYRLKEF
                     KKGGPIGDIWPPLLQSSFCDSCHLKAPCMVINNLLEDGTAESSGLKTEDYEYLTNHLV
                     ANHSENSRFLKKYNELITQEESSIQFINKSLFLLSSEAHESQGGHCLANLKVVSSTNN
                     PLDNSSFLHVFARTKEGLQSMLYAQLSKNDRVTISDESGHFCITQGVIVDIKADSVTI
                     SARRKVLNNRIPAQKSSGLTNIVSAVDDRTSIESLLRIQNMVSYRIDKNEAQQGLALA
                     RFSLLNLFLPPVQSGQVIIDEGTNELRSVKRSDGGDARMRAFLVDKVAPRFLTDNESP
                     LIAKARQTLTQFNSDQIKAIENVLRAQDYALILGMPGTGKTTVIAEIIKILVDAGKSI
                     LLTSYTHSAVDNVLLKLRATNIKIARLGRKHKILPEVQQYQPNFEAFETYEEYIEEIN
                     SLSVVATTCLGISDVLFSLREKDFDYVILDEASQISMPIALAPLRLGEKFIMVGDHHQ
                     LPPLVKNEAARVGGLEQSLFKILCDDHPQSVSELTIQYRMCEDIMALSNFLIYQKKLK
                     CGSDQVRDQTFNISSIGKLTRFRTNSNHQPWLEDILDPQRRVIFLNYDNCTDFEETSE
                     SDNITNEGEVRIIQQCLKGMAKCGVNPADIGILTLYRAQLHLLKRTFQGPKWANLEIL
                     TADQFQGRDKDCIIVSMVRSNTRNNAGSLLKELRRVNVAMTRAKSKLIIAGSKETIGS
                     LPQIRDFINLLKERDWIYDLASNFLQAYNFGDDGESRTDEEYSPKNSQTRTTGARNLS
                     SQSRIFKDTPIVRQAISEI"
     gene            <195011..>197431
                     /locus_tag="HG536_0A00980"
                     /db_xref="GeneID:59323378"
     mRNA            <195011..>197431
                     /locus_tag="HG536_0A00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281061.1"
                     /db_xref="GeneID:59323378"
     CDS             195011..197431
                     /locus_tag="HG536_0A00980"
                     /inference="similar to AA sequence:RefSeq:NP_011766.3"
                     /note="ancestral locus Anc_5.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136956.1"
                     /db_xref="GeneID:59323378"
                     /translation="MTVKPMEKGNRKSLKRYGEPGSDENQVSASSSNCSTPRSCTNSA
                     STSLDADFSKISLSGSSMNSQLEALANTNLLTVRIKLADRGDDASDEMQGIVSELEAV
                     CHHHKGTFVNAANIEPYEYLADSRRLNVIEEHKDIYIFESGNVEFASASSSDSKETPY
                     NYDKVIQVQFKRFNVLKSVCNVVQNILKSKNELIEKWSISYNGHALAQPGNLYVKGVP
                     KDMLLDQVIPIFSKFGPVSCLKIICDNVTGESLGYGFVSYPLGSQASRCISELNGKKL
                     GSSTLFINFHIERKERERIYRDNIKENSDDEKFRGVFVGNLPVLNSNNEVLTPEDVIK
                     LFRERLAPLMTDLVIESVYFPRKIRPGGSQFLSEIDTEVENEAAKYEKSAEEGCEAID
                     DTKRYCPQHDDNPFKNYGFIKFANHAQAVKAIEVFNDFEWLGRKLVVNKAAQNKAQAY
                     HHKKPLISTGFGNRGDNNYYPAPNLYGLYGGLGNLFFPYVNSMGSLSASSSDDTDLSD
                     SEAAYPLNRSRSAGPYSPAFQTFEQMPSPAQAFDPSATGGTVFPMNAYGIISQSPPFA
                     LPLPTRDQQESNLYVKHIPLSWKDEDLYDFYQVFGDIISAKIITIGGGKGRNCEGQSS
                     PISNAVNRDPNHPGTSRGYGFVCFKNPLDASRAILATNNFPLSHAHILHVSFAQKRAR
                     FGQSGVGSGHGQRANPDSHPFNPKLASNRASFNEHSRGQINVKFLNAMRQQRPSTGGP
                     MPSNFLPRGGAWAGVPIAPPSVSHALPSAPFVPSSANTSLMMREPYVMHHPNSRSDDD
                     EADDGISV"
     gene            complement(<197720..>198826)
                     /locus_tag="HG536_0A00990"
                     /db_xref="GeneID:59323379"
     mRNA            complement(<197720..>198826)
                     /locus_tag="HG536_0A00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281062.1"
                     /db_xref="GeneID:59323379"
     CDS             complement(197720..198826)
                     /locus_tag="HG536_0A00990"
                     /inference="similar to AA sequence:RefSeq:NP_011765.1"
                     /note="ancestral locus Anc_5.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136957.1"
                     /db_xref="GeneID:59323379"
                     /translation="MHSKTFIHQLHAILSESHLREWIKWSEEDDATFVLKPYDSGFSR
                     MVLKRYFKHGNVSSFVRQLHMYGFHKITTAPESAAAGRSGGSKDRSEVLWSFSHPQGH
                     FRKDADVATLKKIQRKSTGVGRDGKRKNVLSTVCINYVGSANGSGYGGQDASAPLAEQ
                     QQQYDRRHYASLPLLPPAALGLQKQEPQQQQQPLLPHLHRKEHLIARSRTISLPEVIQ
                     QSAAPTAPSSTASSTPAPAPVQYRSSSPLYSLNAFQYQSPFPHAPGPLGSYTTPSSSV
                     VSSNAADVCPISDYHQRLENNLQILRKSLATVADVLPSLCGDLSRDSAQEKDHKTNYD
                     RYIKSLQVLKEELVASSTGELPMAGFSNSNSTDN"
     gene            complement(<199206..>200225)
                     /locus_tag="HG536_0A01000"
                     /db_xref="GeneID:59323380"
     mRNA            complement(<199206..>200225)
                     /locus_tag="HG536_0A01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281063.1"
                     /db_xref="GeneID:59323380"
     CDS             complement(199206..200225)
                     /locus_tag="HG536_0A01000"
                     /inference="similar to AA sequence:RefSeq:NP_011764.3"
                     /note="ancestral locus Anc_5.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136958.1"
                     /db_xref="GeneID:59323380"
                     /translation="MVKVSPESQALGTVSGSSSHHSEALLMDLTALEQCLVTRSSTRA
                     VLIGRGNWDIKSTAPAGRPGAVFSSYIDRLQVLLMVEVYKYSEKQVLARKVGEFIVEC
                     QERALAADGNSTFTVAISGGSLVNVLRASLVDDDELSAKVKWSKWQIYFCDERLVPLD
                     DPQSNYGAFKTAVLDPLSHHGDHLNLGPTVYAINEALVQQGSHQNEKIAEEYASLLPA
                     AGFDLLLLGCGPDGHTCSLFPGDAHRYLLEETSKTVAWCRDSPKPPSDRITFTLPVIA
                     RSRNIAFVAEGSSKQQIMHKIFDDRNVSLPTALINASYGEKVRWYVDDDAFARVADSS
                     VLANR"
     gene            complement(<200288..>200956)
                     /locus_tag="HG536_0A01010"
                     /db_xref="GeneID:59323381"
     mRNA            complement(<200288..>200956)
                     /locus_tag="HG536_0A01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281064.1"
                     /db_xref="GeneID:59323381"
     CDS             complement(200288..200956)
                     /locus_tag="HG536_0A01010"
                     /inference="similar to AA sequence:RefSeq:NP_011763.1"
                     /note="ancestral locus Anc_5.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136959.1"
                     /db_xref="GeneID:59323381"
                     /translation="MTIALWYCPQQGSAAYEILELLIESLQSIFPSSPRFEPHITITN
                     NLVCNDPDDVNKILTSCVAAVQSIKPLLGSASSGGQLVSFKRCSVGKKFFDKVVLECH
                     ENRYLISIAQIMRELYVEIDDTSRSQRAATWARDEFRPHLSLLYSETYPISQAFLRII
                     QQRIEDALDVQLRSLPATGGDRQLAWQLSTTPTCSWSLPGTFKVVKCEGPVDEWQVLG
                     RTDV"
     gene            <201337..>203019
                     /locus_tag="HG536_0A01020"
                     /db_xref="GeneID:59323382"
     mRNA            <201337..>203019
                     /locus_tag="HG536_0A01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281065.1"
                     /db_xref="GeneID:59323382"
     CDS             201337..203019
                     /locus_tag="HG536_0A01020"
                     /inference="similar to AA sequence:RefSeq:NP_011762.1"
                     /note="ancestral locus Anc_5.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136960.1"
                     /db_xref="GeneID:59323382"
                     /translation="MPVCRSCRGTEFERDLSNANNDLVCKNCGVVSEDNPIVSEVTFG
                     ETSAGAAVVQGSFIGAGQSHASFGSHGGSSALESREATLNNARRKLRAVSHALNIPEY
                     IMEAAYQWYKLALANNFVQGRRSQNVIASCLYVACRKEKTHHMLIDFSSRLQVGVYSI
                     GATFLKMVKALHITKLPLADPSLFIQHFAEKLDLGDKKIKVVKDAVKLAQRMSRDWMY
                     EGRRPAGIAGACILLACRMNNLRRTHSEIVAVSHVAEETLQQRLNEFKNTKAGKLSIK
                     EFRNDESTEPGAHPPSFAKNRIKETKLKRKLDRMEMNETSEEALNRNPILTQILGEQE
                     LSSREILYYLKQFSQRREQEIKNMKATHGIDDLHVYRTESQDDEPADDQKDTNGDGKF
                     QDSIDGYTLETDPYRPRNLHLLPTTKSLLSKVPDDPDNLEDVDDEELDAQLLDDEASK
                     LKERIWIGINGEYLLEQESKRLKQEADVAAGNTSGKRRRTKRRKKTSAEIDAAAAAGM
                     MSDLKDESGLKAALKAAEESGDFTAADSVKNMLQKASFSKKINYDAVDGLFK"
     gene            <203263..>205503
                     /locus_tag="HG536_0A01030"
                     /db_xref="GeneID:59323383"
     mRNA            <203263..>205503
                     /locus_tag="HG536_0A01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281066.1"
                     /db_xref="GeneID:59323383"
     CDS             203263..205503
                     /locus_tag="HG536_0A01030"
                     /inference="similar to AA sequence:RefSeq:NP_011761.3"
                     /note="ancestral locus Anc_5.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136961.1"
                     /db_xref="GeneID:59323383"
                     /translation="MAKRGRAAILPTNIILLQNLVKRDPESYHEEFLQQYAHYESLRD
                     IFMLQGLTGSENIGVSGETGSSGSSGTTSTTEQLLELIGFVSQVCSCFPKETANFPDE
                     LKQLVLEHHKSLPFALKEKIIASLTMLRNKGVITAEQFIQTLFPLLIAYSSQGNALTV
                     NSHARELRQLIYKNLISLLKSCNTGSKNQKLNRSTQAVCFNLLDQPDSQGIWASKLTR
                     ELWRRGIWDDSRTVEIMTQATLHSDVKIAISGVMFFLDADREREANFEEDSDDEGGFD
                     LDAVKHKMQVNKKTGRRNKKLENAIKTYKKKKSGSGQPSGYLNFSAIHLLRDPQGFAE
                     KLFNQHLSGKSNTKFDLDQKISLMQLISRMVGTHKLMILGLYTFFLKYLTPKQRDVTK
                     IMSACAQACHELVPPENLQVLVRKIADEFVSDGVASEVAAAGLNTIKEICSRAPLAID
                     ETLLQDLVEYRSSKAKGVNMAAKSLVTLYREVAPEMLKKKDRGKVASMELQEARREGQ
                     DIKQKRPQFGVETDQVEGIAGIELLAKWKQENGDGDEDEEANWEVDEEAASEDDVDGE
                     WVTIESDKEYDVEMSDSDDKDSDLELSEDEDGDAGKKPAKIEPEEAFRDLASTRVLTP
                     ADFAKLNELRAEEGVSKLMGFPNKKNEELVDSETLVGPVKYKQTREERIQKIMEGREG
                     RDKFGSRRGKRDKAHSTTNREKARKKNFVMMIHKRSVQGKQKMSLRDKQKVLRAHITK
                     QKKKGF"
     gene            <205760..>207031
                     /locus_tag="HG536_0A01040"
                     /db_xref="GeneID:59323384"
     mRNA            <205760..>207031
                     /locus_tag="HG536_0A01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281067.1"
                     /db_xref="GeneID:59323384"
     CDS             205760..207031
                     /locus_tag="HG536_0A01040"
                     /inference="similar to AA sequence:RefSeq:NP_011760.3"
                     /note="ancestral locus Anc_5.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136962.1"
                     /db_xref="GeneID:59323384"
                     /translation="MLGAAFRQRAGVRVAQQVRQLSIHEFRSAELLRQYGVGTPRGQA
                     ATSADEAFEVAKKLNTDRLVVKAQALTGGRGKGHFDTGFKSGVHMCGSPEEARELAGQ
                     MLQHKLITKQSGPRGKLVSAVYLVERVDAKHEAYLSILLDRKTKKPLIICSSEGGMNI
                     EEVAEKNPDAIKKFYITPSEGITDETCQAVSENLGFSKEAQPEAAQAVRKLYQIFTER
                     DATQIEINPFSEVANSERKVMCMDAKFGFDDNASFKQKDVWAWRDLSQEDPDEVVAKQ
                     YDLNFVKLQGNIGCLVNGAGLAMATMDVIKLYGGDPANFLDCGGGATPETIKKAFELI
                     LSNKKVDAIFVNIFGGIVRCDYVAEGLVNAAKELGVTVPIVARLQGTKLEEGQQIIRD
                     SGLKIFSFDELDPAAQKAVQLANEHHSSAKK"
     gene            complement(<207068..>207496)
                     /locus_tag="HG536_0A01050"
                     /db_xref="GeneID:59323385"
     mRNA            complement(<207068..>207496)
                     /locus_tag="HG536_0A01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281068.1"
                     /db_xref="GeneID:59323385"
     CDS             complement(207068..207496)
                     /locus_tag="HG536_0A01050"
                     /inference="similar to AA sequence:RefSeq:NP_011759.1"
                     /note="ancestral locus Anc_5.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136963.1"
                     /db_xref="GeneID:59323385"
                     /translation="MSALNIAFRRFWNSETGPRTVHFWAPTLKWGLVIAGLSDIHRPV
                     EKVSGPQNLSLLATALIWTRWSFVIKPKNYLLASVNFFLGCTAGYHISRIVNYRIRSG
                     DSAGQVVRYIFNGEQGAGQPQQCENKKLVLHSGNANEYKH"
     gene            <207957..>209459
                     /locus_tag="HG536_0A01060"
                     /db_xref="GeneID:59323386"
     mRNA            <207957..>209459
                     /locus_tag="HG536_0A01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281069.1"
                     /db_xref="GeneID:59323386"
     CDS             207957..209459
                     /locus_tag="HG536_0A01060"
                     /inference="similar to AA sequence:RefSeq:NP_011757.3"
                     /note="ancestral locus Anc_5.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136964.1"
                     /db_xref="GeneID:59323386"
                     /translation="MTTYMKLVKGATKIKMAPPKQKYIEPIILGTADPGEFREVVRAL
                     ETRISDTAWTVVYKTLIVVHLMIREGDRNVAIRYFSTHLSFFELSEIERAGRWASADL
                     RALERYDRYLLTRCEEFEATGVDYVREGYSGLKSVAGSGGVRRALDHVGSLETQIQAL
                     IRNRYSQADLSNELLLCGFRLLVQDLLSLYKCLNEGIITLLEAFFELTRADAQRTLEL
                     YKAFVGLTDDVVKYLKSGKAVGMKIPVIKHITTKLIRSLEEHLREDEKTHITFSKDAP
                     ESGTSIAQKKLEQIRKQKKLLEQQLQNQQLLVSPTVQQQPYNPFGAQQADTFTFEQQP
                     TGNPFLNANGVPQQATGFYSTNQVTPAFTGAGFGGYSNTQNLHPSRTGSNNPFTAETP
                     HDLLNPFTQPNLPQQPQPQPQIQNPFQQPQPLMPSQTAPSLVPASNFDTTAYNQLGMV
                     QQGTGYNPFQLQQIQQQQLQAQQQMQIQQQHHQQQQQQQMYNQNPNLIDI"
     gene            <209926..>212880
                     /locus_tag="HG536_0A01070"
                     /db_xref="GeneID:59323387"
     mRNA            <209926..>212880
                     /locus_tag="HG536_0A01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281070.1"
                     /db_xref="GeneID:59323387"
     CDS             209926..212880
                     /locus_tag="HG536_0A01070"
                     /inference="similar to AA sequence:RefSeq:NP_011756.1"
                     /note="ancestral locus Anc_5.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136965.1"
                     /db_xref="GeneID:59323387"
                     /translation="MVALQEACYGVAFASVVTADEDKFKESIQFYHSLGFSTVKDFNK
                     FKHGENLILSSGTSQDSLKEAWLEAFKLSEIDECGFRVPQQEAKNKQQSGGALVKIRL
                     VMHEPSKEKNRDDCVVTYFTTELDQVLEKFPEAEKVSDSVVFIRDPLGNRIGFSSLAS
                     PLDERPTSREFFLNDGVVDAQAANGSQPVDALRQTLAAGERRKKIAVMTSGGDSPGMN
                     AAVRAVVRTGIHYGCDVFAVYEGYEGLLKGGEYLRQMKWEDVRGWLSEGGTLIGTARS
                     MEFRERWGRKQAAGNLISQGIDALIVCGGDGSLTGADLFRSEWPSLVEELVKDGKFTQ
                     EQVEPYKSLTIVGLVGSIDNDMAGTDSTIGAYSALERIVEMVDYIDETAKSHSRAFVV
                     EVMGRHCGWLALMAGIATGADYIFIPERAVPHGKWQEELKEVCQRHRNKGRRNNTVIV
                     AEGALDDQLNPVTADDVKNALLDLGLDTKVTILGHVQRGGTAVAHDRWLATLQGVDSV
                     KAVLEMTPQTPSPLIGILENKIIRMPLVESVKMTKSVATAIGNKDFDKAISLRDTEFI
                     ELYENFISTTVKDDGAEMLPVDERLNIGIVHVGAPSAALNAATRAATLYCVSRGHKPL
                     AILNGFSGLIQTGQIKELSWIDVENWHNLGGSEIGTNRSVAADDMGTVAYYFQKAKLD
                     GLIIIGGFEGFNSLNQLRDSRKEYPIFNIPMVLIPSTISNNVPGTEYSLGVDTCLNSL
                     VKYTDEIKQSASATRRRVFVCEVQGGHSGFIASFTGLITGAVSVYTPEDKITLSTIRE
                     DLALLKENFRHDKGENRNGKLVIRNEQASSVYSTELLANIISESSDGRFGVRTAVPGH
                     VQQGGFPSSKDRVTASRFAVKCIKFIEQWNKKDIALDQNAGDEKVLRFKYDLHGAKVS
                     TVDNEDNSAAVICVNGSKVSFKPIARLWECETNVALRKGHEVHWTEFSRIGDILSGRL
                     KLRAEVEASNSR"
     gene            <213456..>214262
                     /locus_tag="HG536_0A01080"
                     /db_xref="GeneID:59323388"
     mRNA            <213456..>214262
                     /locus_tag="HG536_0A01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281071.1"
                     /db_xref="GeneID:59323388"
     CDS             213456..214262
                     /locus_tag="HG536_0A01080"
                     /inference="similar to AA sequence:RefSeq:NP_011755.3"
                     /note="ancestral locus Anc_5.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136966.1"
                     /db_xref="GeneID:59323388"
                     /translation="MSASCQVNPLQQFVSKGDSAQGRGFGFSAQQRPSEQQPLPVEYS
                     FLHEQEGALQGSNMFLAVQQPSSLSHLQASPGPASRSWLNQFSSMKLEDPLSFDSDYR
                     KHYANYESQQLLQTRQRLSNMSPTLNRTMYYQPVNSYFRPPPAEGQPMTDASDSRLDE
                     EFQSLEAELQKENPGSQDENVGFDDEQVEFQRIASEIVESCSSTSHSPSPVSSKLYSS
                     KFMTLMRNVSEGSVTLSRGNSTHSAEFHSSDGEVIGNEFSPVADHVHELS"
     gene            complement(<214417..>215625)
                     /locus_tag="HG536_0A01090"
                     /db_xref="GeneID:59323389"
     mRNA            complement(<214417..>215625)
                     /locus_tag="HG536_0A01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281072.1"
                     /db_xref="GeneID:59323389"
     CDS             complement(214417..215625)
                     /locus_tag="HG536_0A01090"
                     /inference="similar to AA sequence:RefSeq:NP_012029.1"
                     /note="ancestral locus Anc_5.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136967.1"
                     /db_xref="GeneID:59323389"
                     /translation="MNKFDEFIAATDKDLEVDTSTRVSSGSITLPAISSPGRRVSGGS
                     ISRKRDLHTHEGTKTYGQSRQTTPQRLSHQDHPLKYSEEQSFNVAIATRPGNGLSKRR
                     SLIQPIVAPKTPEGHKKFNTSAPTTLMADRSYRPERNRSGSNASFRSSTADTDVMMST
                     LLQNLANKELEILDAKQRIEELKKQLASEDILYQERLKDLQELKEKVTNHFHKATNNN
                     TSPTVDRVKKDLKGDEQAKKRQGHGSNHPVKDTVASNDVPARENRPSVWSKSLAIFNQ
                     FDQIIQNELERSLHWEEQSGTAAQQKGGQESDDEVRSGKQNEETISVTKSLWSFVSDM
                     KYGLLGIEEESDSRQQNETFNDDELIRSELEGPNEPAVNDNKLKFVGGEMSAEEEEAS
                     KNVEMKDMPT"
     gene            <216003..>219062
                     /locus_tag="HG536_0A01100"
                     /db_xref="GeneID:59323390"
     mRNA            <216003..>219062
                     /locus_tag="HG536_0A01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281073.1"
                     /db_xref="GeneID:59323390"
     CDS             216003..219062
                     /locus_tag="HG536_0A01100"
                     /inference="similar to AA sequence:RefSeq:NP_011754.3"
                     /note="ancestral locus Anc_5.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136968.1"
                     /db_xref="GeneID:59323390"
                     /translation="MAPFNFKKKKETKSSSSASPTLVSTPAKSATPTAAFQTYFQQQR
                     QQQQQQQQQQQQQPVSKHGAAEKQGYPQQHRVYPTPPPSQQRNVSGASTALTQPQRDY
                     TPWNRIKLQNSPFPRYRHVASSYVSNDNRIYVIGGLHDESVYGDTWVIQADETATHFS
                     SKTVDISDSTPPPRVGHAATLCGNAFVVFGGDTHKLNSEGLMDDDLYLFNINSYKWTI
                     PNPVGPRPLGRYGHKISIIATNQMKTKLYLFGGQFDDTYFNDLAVYDLSSFRRSDSHW
                     EFLKPKTFIPPPLANHTMVSYDHKLWVFGGDTLQGLINRVFMYDIMTNDWTIVETTGA
                     KPPPLQEHAAIIYGDLMCVMGGKDEQDVYSNSVYFLNLKSYRWFKFPIFKAGIPQGRS
                     GHSVTLLNNDKILIMGGDKFDYARQGQYDLSTSDTDMGKGTILYTLDLSRLGDLCPGI
                     FDVSEPFNPTTPPIDSSSFASTKTSQPQTNILTPYVPGVDRTPTANRSPQQQDIETPL
                     SKVVDHNSGNEPSASKNSELEIPPRNSNRNAKEIKKPVSPVPALAASEGVQVPRVVSL
                     SSEYKDDQEGTDEEIGIATVASSPLKGDVKYDAGLQRPISTEDRAANQSDLKEAVSIK
                     KLNDLPPGKDERLTDAATHNFTEQPTTDNREQTLDKNVISHLRSELEHLKLLTEEKAT
                     EASTYIRQLEEQVRKLTSGSANNAGTINLQTRLDIVEADRDGLQDHVNEMEQLLDAKF
                     LELGTLNDIIKQQNDKIDGLANEALLKEELETLTQKFESQSKENQLLKQKLKEANSNS
                     RQEIKRLSSQIEELLSRWGSKTAAKSSEHGGDNSAGELKYAGKSPHHDAVINRLQQRL
                     DELLTSSDDLKRSHEKLDANYQDLKLKHSTLSEELLTKKSELEKFEGDYKDTLSSATN
                     TSRALEMTQEELQRYKQANKKLKEELEEMIYARESSLGDVSSSMDSKDAAGNNSALSQ
                     DSSMKFARYNMKINDLKAELYIIKQERDNLKDEVLELKKKQLVMNDE"
     gene            complement(<219142..>219744)
                     /locus_tag="HG536_0A01110"
                     /db_xref="GeneID:59323391"
     mRNA            complement(<219142..>219744)
                     /locus_tag="HG536_0A01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281074.1"
                     /db_xref="GeneID:59323391"
     CDS             complement(219142..219744)
                     /locus_tag="HG536_0A01110"
                     /inference="similar to AA sequence:RefSeq:NP_012027.1"
                     /note="ancestral locus Anc_5.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136969.1"
                     /db_xref="GeneID:59323391"
                     /translation="MAERKGGNSSGWMDESGEKSNGYAVVPVSLFCEQYAVSKEVRKT
                     FGLYNNGVRAISRTEFEQLKVGLKSCMAKRQREADALWQSKKRYSLAESLEGNTLGSG
                     YSLNGSHTLILSSDMLHSDLEPHYSASRQGGNEMLVSEDNEETGGRRLETQMQMLASS
                     AGSIVSVPEGSACTRIDSKRCFILLSETSYDRNSSPPLHD"
     gene            complement(<219972..>220445)
                     /locus_tag="HG536_0A01120"
                     /db_xref="GeneID:59323392"
     mRNA            complement(<219972..>220445)
                     /locus_tag="HG536_0A01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281075.1"
                     /db_xref="GeneID:59323392"
     CDS             complement(219972..220445)
                     /locus_tag="HG536_0A01120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136970.1"
                     /db_xref="GeneID:59323392"
                     /translation="MLVYLVYLNLTSLNATNLRVKMPNVSKRTISDFSPSLKHPIGVR
                     RRYSPQQATSNCYTSSPARLVVISHVPLLTVPNLVFPSDYQPGSSQATAGCASCASEG
                     KSKQLRLFEMWYPTTNQSLEFGERRRYRALRCSDSRMSTNVAALAALLGIFTFSR"
     gene            <220489..>222729
                     /locus_tag="HG536_0A01130"
                     /db_xref="GeneID:59323393"
     mRNA            <220489..>222729
                     /locus_tag="HG536_0A01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281076.1"
                     /db_xref="GeneID:59323393"
     CDS             220489..222729
                     /locus_tag="HG536_0A01130"
                     /inference="similar to AA sequence:RefSeq:NP_011753.1"
                     /note="ancestral locus Anc_5.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136971.1"
                     /db_xref="GeneID:59323393"
                     /translation="MTATRYVKHVSFDDLVPTLIDDQVEILKHSQKHAGFNNKFLHVP
                     PQYNPLYQSDSEQPKKKQELFTQNRSGERRRSDEHDKLEKVLQFMSPHQTIRPSLSSP
                     DVVDRSRSSSPLAHCRTNPRLPPPPKTPSLKWSAKRADEQERIIDWDIYDMDFATERK
                     LTKETEKNTQSNSGSRDGYTQAAFANLNELEDRLGSKSKPAAKEGSGGRKKSFAGMTD
                     KELAELEKFYESQSRSTASPTIDCYDFKEQDPFFIGKFDKKGGSQVADPLAAIYPSRP
                     VVDHRAICVTIQHPTYDQYVHGLNTETKSRKPEESLAAIRSVSCYISGRRYTWSSVDW
                     YVENCARDGDHLIIVTSIPFFEREIESSDYALNRRYFAESHGPEYGSFDEIDRGLRRV
                     STSSSETCKATTLGQVSKGFRIKAVHDEARQKCLNILNYYASRLQGIVMKITIEMIKC
                     DSPEYAITKAAALYRPEIQIVSTVSTNLQIKFRNGRVKLPFFVMQHYPMSTAVVPYEF
                     IDPRLLGESPRDMTDTLKERKEQIPRRNDRLVAIDSIILKSLRNPFAADVTTTKKYEE
                     DNDSLVESVNEYFPMPPEQKRKYELFERMGYVRCLPTRQAVYIKNSNPTINEDDRRST
                     PFSTASNSRRSSRIQYDDGMYKVKSLIIDSSESSDDESDQKRHGSSIRKTRSMGPPAR
                     SGHVSPGLSPTTSDRKPHFNNVMHPTSSKSPEHASPASESKNKKDNKGREKKKTFGSF
                     FRKVFK"
     gene            <222963..>223298
                     /locus_tag="HG536_0A01140"
                     /db_xref="GeneID:59323394"
     mRNA            <222963..>223298
                     /locus_tag="HG536_0A01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281077.1"
                     /db_xref="GeneID:59323394"
     CDS             222963..223298
                     /locus_tag="HG536_0A01140"
                     /inference="similar to AA sequence:RefSeq:NP_011752.4"
                     /note="ancestral locus Anc_5.91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136972.1"
                     /db_xref="GeneID:59323394"
                     /translation="MKLNSKTYSEVQRVARLPRLPLLMLGVICGAMVPTMYMRKYLLP
                     RFRKEDLQEITEPVSAGNSIARPVMKLWPMLNAQQKKDVMLAQAPVRRIDAEDLDDEG
                     NLLMFSSIM"
     gene            <223675..>224379
                     /locus_tag="HG536_0A01150"
                     /db_xref="GeneID:59323395"
     mRNA            <223675..>224379
                     /locus_tag="HG536_0A01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281078.1"
                     /db_xref="GeneID:59323395"
     CDS             223675..224379
                     /locus_tag="HG536_0A01150"
                     /inference="similar to AA sequence:RefSeq:NP_011751.1"
                     /note="ancestral locus Anc_5.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136973.1"
                     /db_xref="GeneID:59323395"
                     /translation="MTAGSRFYREQDLVKEAVIPRQNGMVLSSDAKQAVLEPLKSSKT
                     ATARAMSIIGNNELIDGISVRSPTYLLSVFHRLRLRVSRTIEKATQKIDKKTSAYYRH
                     ERRLTSTIASLHSDPRERLLPGFTYIIVAAMSGSVLTRNKRFLYRFTAPLVLGSACFS
                     YVLPTTFQNTAALLHSIESAHFPRAVAKQDAIINKTVQIGRTTASHIDYLAESVFNIA
                     AKFRHSVKEWTNLNIE"
     gene            complement(<225059..>225619)
                     /locus_tag="HG536_0A01160"
                     /db_xref="GeneID:59323396"
     mRNA            complement(<225059..>225619)
                     /locus_tag="HG536_0A01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281079.1"
                     /db_xref="GeneID:59323396"
     CDS             complement(225059..225619)
                     /locus_tag="HG536_0A01160"
                     /inference="similar to AA sequence:RefSeq:NP_011750.1"
                     /note="ancestral locus Anc_5.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136974.1"
                     /db_xref="GeneID:59323396"
                     /translation="MLSVQTRAIVKATVPVLEKQGTAITKVFYKNMLNEHKQLLNIFN
                     RVNQAKGAQPTALATTVHAAAKHLSVLLPHVEQIGHKHRALQIKPEHYPIAGEYLLTA
                     IKEMLGATAPPDILGAWREAYGAIADIFISVENRMYKEAAWAGWKPFEAVARERVASD
                     TEEFTVKAKPESGIDLSKCLSSLVST"
     gene            complement(<226037..>229027)
                     /locus_tag="HG536_0A01170"
                     /db_xref="GeneID:59323397"
     mRNA            complement(<226037..>229027)
                     /locus_tag="HG536_0A01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281080.1"
                     /db_xref="GeneID:59323397"
     CDS             complement(226037..229027)
                     /locus_tag="HG536_0A01170"
                     /inference="similar to AA sequence:RefSeq:NP_012024.1"
                     /note="ancestral locus Anc_5.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136975.1"
                     /db_xref="GeneID:59323397"
                     /translation="MAANSELFQHLNFLLVVTNAEGLEAANITAQLLRSNGCNRCELH
                     EQYLEHDLPNGEALRNWFVRKFGQDQMINFIISEDSNFPFYEIAAFDFLIPVVTSEWV
                     STCLSTNRHHRTSGFSPDERHIFKDLQIYVSRHAFNHSEYLFYTEMVHAMGGTCMDFL
                     SSKTTHLVTQDADDPAVKAVLGFGKANCVNFVFPTWIVKSFKALDVAKLEDHLLDPEA
                     SSEISAEKLQDLWDGLDDMGFRKTSTILEGHGFVIGLDVSLNRNLYATLVEFLQANGG
                     TVIRHIDEDDIKQSNADCYIGNSVMSKEYEVARDSGLELGNLIWIFFLWSYNQFISSK
                     TKLIFAPFKKKLFDVNELILSYSNYYGQQRFYIQRLAELLGGYSTGELSRKNTHLVSQ
                     FPWGKKFETAKKWQTCTVVNHLWLETIYKSGKVLDPLESQFQQFPVAGGLQHVIGQIG
                     PNEMLPQHRDVTRPEEITIMPADSPQKEDVKQPSNGSKKAGTEPPHIAAEDRTSSQLA
                     TAVTIDRCEATAIGEVKVVHKNVVAAETANVILGPAIVENEAEALLQNDAGRSVDHLE
                     DQATQDPCAPEIENDVLTEGLSAPKPPYEELKEPTAESQLWGAESNEVPSDAMTEKTA
                     TPQPSEILSQPDRGRLGTPTSHENISRSGTPFESSMPSQTLHSSGGRRAAKAKAARKL
                     HSDIELLNEFQRNSKRKRTGDLLPEEIAQLERRKLLEQKASEILRTIYAADESKSSEE
                     VNRRRRSVYNMDAICTGCHDDIGELDKILLERVGIRVHEEITKENLSLLNTIIAPKRM
                     RTAKFLKSFSFHPLRYALKPEFLTDLLQLIHRTQPLDCLSLNLTTYAIPEVDTQLLLQ
                     MTSLPTKVFERAGLSSVNLVNDIPGGVEVITSILKAHGIKEVRVVPTSRMNQLTINDL
                     VINDTPDAEVCAEQIVPDCVMIAIKSSQVKHFKRVVKNHCTSAMAVEWNWCISSIFKL
                     DAEYSDRSNIIFQQGQSNGKRSSK"
     gene            <229776..>230342
                     /locus_tag="HG536_0A01180"
                     /db_xref="GeneID:59323398"
     mRNA            <229776..>230342
                     /locus_tag="HG536_0A01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281081.1"
                     /db_xref="GeneID:59323398"
     CDS             229776..230342
                     /locus_tag="HG536_0A01180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136976.1"
                     /db_xref="GeneID:59323398"
                     /translation="MISINNCLLLHSLKHCPSLAAVRQTMKSCLPKAPTILKTRLSKR
                     RNIVVDLNFSHTFMGGTPIRGSSRGEIPLRGLHYRAGNCRSPAIHVAEGSFTEVFIPP
                     CKGGAGIENIDFGGDCENLLKRTIMLITRQCGFDEQAMGLSLAETHNLEELIHYCKTH
                     SRSFHRPRDTKAECEPASDFPRGNGCSI"
     gene            <230604..>233882
                     /locus_tag="HG536_0A01190"
                     /db_xref="GeneID:59323399"
     mRNA            <230604..>233882
                     /locus_tag="HG536_0A01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281082.1"
                     /db_xref="GeneID:59323399"
     CDS             230604..233882
                     /locus_tag="HG536_0A01190"
                     /inference="similar to AA sequence:RefSeq:NP_011749.3"
                     /note="ancestral locus Anc_5.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136977.1"
                     /db_xref="GeneID:59323399"
                     /translation="MKFGKYLEARQLELPEYNSHFIDYKALKKLIKQLAVPLTQASST
                     DHLTLDDIDESTIYQRLQENKASFFFKLERELEKVNSYYLEKESDLKIIFDILQTKFN
                     SYRERGQLSSKKSVSYGNILSGFKKFQRDLGNLEQFIELNRTGFAKVLKKWDKRSHSH
                     QKEFYLATVVVVQPIFTSSEVSKLNDATLGILDQLDGVSKEDAPDSYGSEINRRSTNT
                     PIGFIPSPTSRLSCQQLIVGPNTPVVLDLDIEIENWFLEIVNISKLRDENKKFSLLKE
                     FFMTKMKDVIDDAIPQSRIDKGVVLKDCLTRLFLLLVGSSTIDDVSLHVFYTSTRNNI
                     DLSYCDESDQVFSRRNVFHEAGNCSSHSRIFVLREALIMTSAMQSGDLPFLKKDNLKV
                     LLNAQDLYSRTPLHYAAELGKLEFVKLLISSNLLESVDVLDNHSQTPLILAIINNHTE
                     VVRELLVNGHAAAFPDVDEFSKPQFAPLIVACYHKNYGIAKMILEQGHALSPKLSDAK
                     GLGTLHIVAKEGGPAELIELLVRHGADPNGVDNFNVWTPIFYAIQEGHAETVKVLLKY
                     GARLDITDEHGLGPLYYAIWESHVDVLNVLMENLTIIQNGKEPVNYLPIMTTKPRSPS
                     SSLQDIPDFALPPPIIPLRKYGHNFLEKKIFVKLIMKPGNGSIQFLKEDEMILSSPGR
                     ITLTSNLAEIIPRNIILPISEEEEREVAFQVDSIENFAIDFEIFPAYGTRIIAKTTAM
                     PNLFNLEMANGTSSTSLPLFDTKLTNVGTLTFDYQVIMPYNQRPLEITKYEPYWKSTT
                     GTDVDPGKEGQQIVASSLSGSFITVMVRWLRDGTIIVARRPYIVTNNVKIFLCDLTRQ
                     QLEELRGYKLDDVMFIDNEQTLKNYLSTMICTLSDLLEKVPPSIQLEIQVCFPTNLEI
                     DTVPLNISPLLDLNKFVDQILFHIFEHVRRLRHSGQSVRPVVFSSCNWQACTVLNWKQ
                     PNFPVLYHMNDLRKVNDQFVRDTPHNLKDLALDPSKVTFADGRSKCLHEIVSFAVNNN
                     LLGISLPYELLTICKTLIDAIRGHGLLLIGARLPGDEGALNSAGVNGIHMSSELVFSE
                     SVEM"
     gene            complement(<233921..>234604)
                     /locus_tag="HG536_0A01200"
                     /db_xref="GeneID:59323400"
     mRNA            complement(<233921..>234604)
                     /locus_tag="HG536_0A01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281083.1"
                     /db_xref="GeneID:59323400"
     CDS             complement(233921..234604)
                     /locus_tag="HG536_0A01200"
                     /inference="similar to AA sequence:RefSeq:NP_011748.3"
                     /note="ancestral locus Anc_5.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136978.1"
                     /db_xref="GeneID:59323400"
                     /translation="MDLPLINACMNNDLRKVQETVETSPGDLLKRDGDGRIALHWAVS
                     FQHEEIVLYLLSHMRSVDLNEYRDDSGWTPFHIACAVGSLSIVKELYERVIKPDLNLQ
                     TNQGVTPLHLAVSKKHVPVCQFLLDHKASVRVKDSRQQMPIHRAAAIGSPVLVELLCK
                     KNSPVNAADNNGWTPLFHAFAEGHGDVAVMLVEKFGADDQLQDPKGLKAIDYALNEQI
                     KNYYKNHVS"
     gene            <235214..>236143
                     /locus_tag="HG536_0A01210"
                     /db_xref="GeneID:59323401"
     mRNA            <235214..>236143
                     /locus_tag="HG536_0A01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281084.1"
                     /db_xref="GeneID:59323401"
     CDS             235214..236143
                     /locus_tag="HG536_0A01210"
                     /inference="similar to AA sequence:RefSeq:NP_011747.2"
                     /note="ancestral locus Anc_5.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136979.1"
                     /db_xref="GeneID:59323401"
                     /translation="MSRSAGDFQRFARAFQQQLSKVQQAGGRGGPARGPPRGAFAGAG
                     GLILLGGGALFLNSALFNVDGGHRAIVYSRINGVSSRIYNEGTHFIIPWLETPVVYDV
                     RAKPRNVASLTGTKDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVL
                     KAVVAQFNASQLITQREKVSRLIRENLVRRASNFNILLDDVSITYMTFSPEFTNAVEA
                     KQIAQQDAQRAAFVVDKARQEKQEMVVKAQGEAKSAELIGEAIKKSKDYVELKRLDTA
                     REIAQILARSPNRVILDNEALLLNTVVDNRSKK"
     gene            complement(<236217..>236672)
                     /locus_tag="HG536_0A01220"
                     /db_xref="GeneID:59323402"
     mRNA            complement(<236217..>236672)
                     /locus_tag="HG536_0A01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281085.1"
                     /db_xref="GeneID:59323402"
     CDS             complement(236217..236672)
                     /locus_tag="HG536_0A01220"
                     /inference="similar to AA sequence:RefSeq:NP_011746.3"
                     /note="ancestral locus Anc_5.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136980.1"
                     /db_xref="GeneID:59323402"
                     /translation="MTESSYYKMEPVGSSGLAHMWQDRAAMEKQDVQTAGSGMQREQS
                     EQTTKSEAGQTEQCRRVPEKADPLKSNGGSVSLHRAALCRKRLSHGAVQKIHKLRTRQ
                     KFASPTDTLLSPCSQKLNQHRAKLFVAKSKPTKLNFATKRQRVSGEEDF"
     gene            <236922..>238385
                     /locus_tag="HG536_0A01230"
                     /db_xref="GeneID:59323403"
     mRNA            <236922..>238385
                     /locus_tag="HG536_0A01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281086.1"
                     /db_xref="GeneID:59323403"
     CDS             236922..238385
                     /locus_tag="HG536_0A01230"
                     /inference="similar to AA sequence:RefSeq:NP_011745.1"
                     /note="ancestral locus Anc_5.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136981.1"
                     /db_xref="GeneID:59323403"
                     /translation="MNVLKKKLKELVYSFSTDDHYAEYNANDGGRSFNMRRRANQGAG
                     VSGSRVHLNGGDELGDEEMNLGAVEEEEDEINIDEFGNMDKEGVSEALLAWRHIDSWT
                     SKHNPDLNATLGDPCTHNDITHAEEDLAVTLPAAVRVSLRVHDGQEDLESMTGVSGLI
                     YGLQLMTLDQIVEMTEKWRSVAKNLDRVSKADRETTVSSSSQSAEATKRKQFKLPHIP
                     RQDSIPKNSIQPVYAHPAWIPLLTDNAGNHVGVDLAPASEGKYAQVIIFGRDFDTKFV
                     VAANWGDFLLDFANDLEAGNWYLVDDNDDFLSGDGELVFRDKKSNGPVQDYLEVLKKR
                     AWTKYQESAKSRDTQQTAVEPENAKDATQIGTVALTDGVSAHEGAVQEVQVHPAVKEV
                     PEAGKDVNDREPTSLATEKTGSETHKTEETEAVASSAQSQANEESSKARGVSDEGNSK
                     ESTDLKNEQVKNDSEENGDAQDSNVETLKDEFKNIDL"
     gene            complement(<238515..>240074)
                     /locus_tag="HG536_0A01240"
                     /db_xref="GeneID:59323404"
     mRNA            complement(<238515..>240074)
                     /locus_tag="HG536_0A01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281087.1"
                     /db_xref="GeneID:59323404"
     CDS             complement(238515..240074)
                     /locus_tag="HG536_0A01240"
                     /inference="similar to AA sequence:RefSeq:NP_011743.2"
                     /note="ancestral locus Anc_5.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136982.1"
                     /db_xref="GeneID:59323404"
                     /translation="MTTQQPPETDQIDESPQLISPGIQRVLQREVVAGFLANLVIYPL
                     LVIYFIGTFSFVTRRVVPYVFIDEQFHVGQTMQYLSGHWSSWDPKITTPPGLYILGWV
                     SYKLVSVVTSWTALTAFRLVNLLGGAVILPLCVLRPLFLFNAIGFWPVALMCFPLLST
                     YYYLYYTDVWSTIFILQSLSLVLTQPYGPRASIWLSSACAALSCTFRQTNIVWTVFIM
                     VIALERRAAIRKQFNTHRFNNYLKLFIHSIDEFQDTVLPYVLNFASFLVYLIWNKSIT
                     LGDKSNHSVGLHLVQVFYCFAFMALFSLPLWFSRNFLRLYVIRLQWKPIRTIFELLGI
                     MLVIRYFTVMHPFLLADNRHYTFYLFKRLIGSHRRIFKYLLMSIVYHFSTFAYLEVLR
                     PSEMKFDPVAPLPIKDPIDLPIQLTHISWSCLIVCTCLTIIPSPLFEPRYYILPFLFW
                     RLFVTCSAEPIFGELVPAKEGETPITVTSTKRLFFEFLWFMGINMVTLYIFATRAFTW
                     ETEPFLQRIIW"
     gene            <240257..>241804
                     /locus_tag="HG536_0A01250"
                     /db_xref="GeneID:59323405"
     mRNA            <240257..>241804
                     /locus_tag="HG536_0A01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281088.1"
                     /db_xref="GeneID:59323405"
     CDS             240257..241804
                     /locus_tag="HG536_0A01250"
                     /inference="similar to AA sequence:RefSeq:NP_012021.1"
                     /note="ancestral locus Anc_5.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136983.1"
                     /db_xref="GeneID:59323405"
                     /translation="MQIPRKLLVIWALLWEVILCVNFEVLPAIDSQTQNAIRSQRDLM
                     LNVTIDQLPLVGVNLRKVILNNASTNDTESLLGMQSLMKNGVQNFMLELQLRNDSWGV
                     RDTNLDLQAFLVAFESFINKTDDNLSANILTLHLNISTEELPSNSTSGDDQSVITVDP
                     SKPMLNLTYVLDQFMGRFRIYTPDDLRTDRQLGSTFDTYGQSNSGWPTLNSFLYLKRK
                     RVLITEVSNRLNYSEVPYIFNNTILHYDVGNKTLETPNTIGELLYTSTISWRYLEAEF
                     TPAEIQQYISMGYSPVISNHYSIGNLTQISELLGSSIIWSWGAGEPIPAFTTATPKNS
                     SSLVAYNCALLKYYSTNNSAAWIVGNCYDKKQGLCRYAEQAFDWEVTEADDTYFAFEQ
                     RSECHCSDRYQFALPRTPLELTSLVIDLERSGTQDKEIWIDLNSIAVGDCWVTGGPYA
                     TCPYQKVVPHRNFVDMITPVSVSCCVILLIVFYLNLLRVPIHSNRKKWRKVVNELSKT
                     ELDGVPL"
     gene            complement(<241856..>243448)
                     /locus_tag="HG536_0A01260"
                     /db_xref="GeneID:59323406"
     mRNA            complement(<241856..>243448)
                     /locus_tag="HG536_0A01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281089.1"
                     /db_xref="GeneID:59323406"
     CDS             complement(241856..243448)
                     /locus_tag="HG536_0A01260"
                     /inference="similar to AA sequence:RefSeq:NP_012020.1"
                     /note="ancestral locus Anc_5.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136984.1"
                     /db_xref="GeneID:59323406"
                     /translation="MSSPSRKRDMVKAYFSNKYDKVLDSLLVADTTAALAHGTGVDSS
                     TKKIPNMDVVHGIASSLFNASVERLKAEKNGWSMSSIATESSDDFWKDENFKQETNTD
                     EGSTTMESVEKTAVKIENKTREHFVDLFVEKLIARMIPDKLPEREHFGELSEEERRKA
                     QTVSATVLSSNLKKLTPKMPIVFELQDSIVRLLTWRNPSGTVTMLILCTMICYNPMYL
                     ITMPLLYIAFGLMVPGYIRRHPLRRALYPVRRVYGRSLIEEIADSGARRTSGSASIHK
                     YSYNGEAAESGSPALEDPLSNRVEFVSNLRDFQTASTATVQMSNSLERFLYGTAGFKD
                     ERHSTVVFLKYIFWFCFLGAVSKFVNWSFVLSAWLWYAMIKSHPKVKKKLEAFKTKGT
                     KTTEVKPKKEGLQLILDEPPEVKLVEIYEIYKQGITPRHWDFYKYSNQVFDPLDKYRK
                     LQQPPPGVDNLNDVYAPSTWVFDENSAWDVDWNVKKWANERGLQYTTDGEFLVDDMFK
                     RRRLTRRVLRYANPVIKPSYKK"
     gene            complement(<244206..>245588)
                     /locus_tag="HG536_0A01270"
                     /db_xref="GeneID:59323407"
     mRNA            complement(<244206..>245588)
                     /locus_tag="HG536_0A01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281090.1"
                     /db_xref="GeneID:59323407"
     CDS             complement(244206..245588)
                     /locus_tag="HG536_0A01270"
                     /inference="similar to AA sequence:RefSeq:NP_011741.5"
                     /note="ancestral locus Anc_5.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136985.1"
                     /db_xref="GeneID:59323407"
                     /translation="MYPSDRKRPSTAQDEVHERRKSGCYPRRTRLTAGAAVGGKGLDR
                     YIPQVASKKAYRASPSLKKFDVRDPELMERSPSPERLSSPGFFNDLRSTGHYEAITGR
                     ERIGDSTSVTEPSVSGVVSTTTVGTETPNLSFEQKRHREYIADSLGFQSPQRVFQFAG
                     CVSKSRNDHSGGSSKLQSVHGSVAQHHHYLTVDPLTTALPPSKAMAHLATTAFSGMSQ
                     SRSFVSDEGAKRPAKRLKSHIPYRVLDAPCLRNDFYSNLISWSKSTDNIMVGLGCSVY
                     MWSDKHGAVPVLSHDYLNRKHDIVTCVSFCPQNALFVVGTKQGRVLLFDQDVCLKRRR
                     LEGEALKPLCEYQSTTLRGISCVQWLHRGKGTNLLVGEECGDVSYLAVKETLRLLDTN
                     FAGQNESESRRGQATQLLDYAEEYQNFKLQFISRFQAQSQQVCGTFLSNTLAPKLGRI
                     LTVITLKGYL"
     gene            <246251..>247618
                     /locus_tag="HG536_0A01280"
                     /db_xref="GeneID:59323408"
     mRNA            <246251..>247618
                     /locus_tag="HG536_0A01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281091.1"
                     /db_xref="GeneID:59323408"
     CDS             246251..247618
                     /locus_tag="HG536_0A01280"
                     /inference="similar to AA sequence:RefSeq:NP_011739.1"
                     /note="ancestral locus Anc_5.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136986.1"
                     /db_xref="GeneID:59323408"
                     /translation="MNVRKAIVEGSTERPARFLQVAFNQDDSCFSGATEDGFVIYNTD
                     PLACKLLRRFQPAEEGRMSGAGTGIGYTRMLYRTNYTALVGGGKRPRYPLNKLVIWED
                     LQQRESVVLKFMSPIKQVFLSRVHIIVVLESSVEVFQFQSAPKRICPSLDIYPHGTVD
                     FVVSQARYRRESQGSTGNSRGVHNGAASEVSSANGGVNGIIAFPSARSVGQVHIADLS
                     RLKHNDQNPEGTQLLPTSIIKAHKTPIRFLRLNHQGTMIATCSVQGTLIRLFSTHNGS
                     LIKEFRRGSDKADIYEMAFSPKGSKLAVVSDKQTLHIFQISLGKENNGGDEHSRNKTH
                     ALRKYVPSSWKPRYLDSVWSMCSVHLRNPMLRDSDGDARLQRDKCKIGWCKYAESESG
                     NDSDEEDSLVLVWRKTGIWEKYVILEREPQQASKHVYSAQETLRNEASTPTQWELVRE
                     SWREL"
     gene            complement(<247683..>248459)
                     /locus_tag="HG536_0A01290"
                     /db_xref="GeneID:59323409"
     mRNA            complement(<247683..>248459)
                     /locus_tag="HG536_0A01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281092.1"
                     /db_xref="GeneID:59323409"
     CDS             complement(247683..248459)
                     /locus_tag="HG536_0A01290"
                     /inference="similar to AA sequence:RefSeq:NP_011738.3"
                     /note="ancestral locus Anc_5.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136987.1"
                     /db_xref="GeneID:59323409"
                     /translation="MASKKAVSAVLSHLKSGKVLGVAGELSQAGPASRSTALKYKSYN
                     PSLDKADFVNILPEMLFSVAGAARTSGVDFQVLKCRDPRYFQFKDCYVLLFNSSQSLA
                     RYRSATELSRINKIRVKFVPLPPGDSSEHVYAQYVKNLTAAFESHGLYNEKSRTKEPF
                     DRSKFDLNALQERIRPIEERSALVWNLPFDMRPHDLIDRFWFYDIKHCFKLYWDVSTG
                     ATLYYIAFNDTSDCLKFKRNFHGVHFEDKLHMKLLVETLG"
     gene            <249181..>251151
                     /locus_tag="HG536_0A01300"
                     /db_xref="GeneID:59323410"
     mRNA            <249181..>251151
                     /locus_tag="HG536_0A01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281093.1"
                     /db_xref="GeneID:59323410"
     CDS             249181..251151
                     /locus_tag="HG536_0A01300"
                     /inference="similar to AA sequence:RefSeq:NP_011737.2"
                     /note="ancestral locus Anc_5.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136988.1"
                     /db_xref="GeneID:59323410"
                     /translation="MLETKVMSATRTSLAGTYTVVKREAQSSGSSTSSGKVAKCTGSE
                     SSCQKPSNTSAVTVGVAVAIPVGCVLILFVVILWVVYRRNKKEAQEDNDPDFEGDTEY
                     LPAAKGTNGYSLSTSSHSGDSQTPKEWAGDEESYFAGNSGRYLRGSESVRNSQARNVD
                     PFILPEANDDSLRDFARQLQNDEFGPYRIASNSNSRATSQLSLPLEKNPMKVSSNVGS
                     NVTRYTSADTNHTLGDATPTGDSTSSSEPPLNQSPVKSVTGDVTRKYAEDHSGLEAEH
                     SKFDSTLDNQNSHTRPTETSHDNFNFEAREVLNQLDDSASPGEARDDDRVISLSAKEE
                     EDIRRMKSVYKVYLDRNGTVKQRPFDESELQDDEEEQEAMAQSSNISETNAGTQLRVA
                     SDSHRVASSIYSAPPPQSYPAQETQLNPENYYTDHSPTSQQYSNQPQNVAPYGYAQSY
                     EQQQQYPPQHYPMQFSQQHQYAHPQTLETIGELPTPTNLPFSTSSHSLTSFRQKSKQP
                     QIAQLQTARINGTAVNPMDHPEMFYAQGNDSYTSYQTANGSVVSQPAAPYQLRQSVVM
                     TNPSDLTAAPRFRPAGSIRTASAANTRNNTITSRMNPYYQQQQAYNLRVSGLLNEADV
                     TQPPSVGQILPHSGSNEDLRRQIGGSHNYNVV"
     gene            complement(<251252..>251803)
                     /locus_tag="HG536_0A01310"
                     /db_xref="GeneID:59323411"
     mRNA            complement(<251252..>251803)
                     /locus_tag="HG536_0A01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281094.1"
                     /db_xref="GeneID:59323411"
     CDS             complement(251252..251803)
                     /locus_tag="HG536_0A01310"
                     /inference="similar to AA sequence:RefSeq:NP_012018.1"
                     /note="ancestral locus Anc_5.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136989.1"
                     /db_xref="GeneID:59323411"
                     /translation="MVRKLKHHEQKLLKKVDFFDWKQDQGHRDTQVMRTYHIQNREDY
                     HKYNKICGDIRRLAHKLSLLPPADPFRLKHEQLLLEKLYAMGILATKSKISDLENRVT
                     VSALCRRRLPVVMHRLKMAETIKDAVKFIEQGHVRVGPNLISDPAYLVTRNMEDYVTW
                     TDNSKIRKTVLKYRNQIDDFDFS"
     gene            <252047..>252691
                     /locus_tag="HG536_0A01320"
                     /db_xref="GeneID:59323412"
     mRNA            <252047..>252691
                     /locus_tag="HG536_0A01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281095.1"
                     /db_xref="GeneID:59323412"
     CDS             252047..252691
                     /locus_tag="HG536_0A01320"
                     /inference="similar to AA sequence:RefSeq:NP_012017.1"
                     /note="ancestral locus Anc_5.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136990.1"
                     /db_xref="GeneID:59323412"
                     /translation="MSFILKRSFSLSGALRSHIGSTAIYLTPQTKVCVTPLAVPRIIR
                     KGRKSMKLTQLATVEGPRGRIEMEIPDFVSVKLEDNNAKLTVCVASPEQKMQRSMWGT
                     VRSHLNNHVSGVNEGHLASLRFVGTGYRAQLERNNTFVNVKVGASVTQGLTVPDGIAV
                     KSPSPTSLLVEGCNKQQVLLFAANLRKFHPPEPYKGKGIYVNNETIKLKDKKIK"
     gene            <252844..>253659
                     /locus_tag="HG536_0A01330"
                     /db_xref="GeneID:59323413"
     mRNA            <252844..>253659
                     /locus_tag="HG536_0A01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281096.1"
                     /db_xref="GeneID:59323413"
     CDS             252844..253659
                     /locus_tag="HG536_0A01330"
                     /inference="similar to AA sequence:RefSeq:NP_011736.1"
                     /note="ancestral locus Anc_5.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136991.1"
                     /db_xref="GeneID:59323413"
                     /translation="MVKSVWPNVRGVRFLGNSSTRPSLVAPSVVSTVPLQAGKINHCA
                     EQAQLRRWLPVRCGALCKKEGMMPFFDETTGKRVAATVLSLNNVEVMMHRTVEKNGYT
                     ACQVGYGLKHPSKVSRQLLGHFASKFVNPKEKVAEFRVKNESGLLPLGTLIKPSFFKS
                     GQFVDLRSISKGKGFAGVMKRHNFKGLKASHGVSIMHRHGGSYGQNQDPGRILPGKKM
                     PGHMGSQQVTIQNVQVLKVDDAKGVVLVKGSVAGPKGAFVKIQDAIKKPPTEL"
     gene            complement(<253788..>257054)
                     /locus_tag="HG536_0A01340"
                     /db_xref="GeneID:59323414"
     mRNA            complement(<253788..>257054)
                     /locus_tag="HG536_0A01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281097.1"
                     /db_xref="GeneID:59323414"
     CDS             complement(253788..257054)
                     /locus_tag="HG536_0A01340"
                     /inference="similar to AA sequence:RefSeq:NP_011734.3"
                     /note="ancestral locus Anc_5.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136992.1"
                     /db_xref="GeneID:59323414"
                     /translation="MESILDFSSDLNITTLDEVVDTFYKGSGAQQKQAQDILTKFQEH
                     PDAWQRADKILQFSNNAQTKFIGLTILDKLITTKWKLLPEEQRVGIRNFVVGMIIVMC
                     QGDALFHSQKNLINKADLTLVQILKQEWPQNWPDFIPELIGSSNSSVNVCENNMIILK
                     LLSEEVFDFSAEQMTQAKSLHLKTSMSKEFEQIFKLCYQVLEQGSSTSLIVAALESLL
                     RYLHWIPYRYIYESNILELLSTKFLMSAETRAVTLKCLTEVSNLEIPQDNSRIKTQTV
                     LFFQNSLQQIAGNVIPVTADLKATYATATGMDQSFLQDFAMFLTTYLARHRSLLEELS
                     GADGNLRELLLNAHQYLIQLSKIDERELFKTTLDYWHNLVAALFLEVQQLPHNEMNPL
                     MQLSMGSQSITSNSGALNPEFLRRFPLKKHIYDEICSQLRWVIIENMVRPEEVLIVEN
                     DEGEIVREFVKESDTIQLYKSEREVLVYLTHLDVIDTEEIMISKLARQIDGSEWSWHN
                     INTLCWAIGSISGTMSEETEKRFVVTVIKDLLALTEKKRGKDNKAVVASNIMYVVGQY
                     PRFLKAHWNFLRTVVLKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVIQQPRESEP
                     FIQTIIRDIQETTADLQPQQVHTFYRACGLIVSEERNAGERDRLLSELMQLPNMAWDA
                     IVEQSSANTDLLLDSETVKIIANIIKTNVAVCTSMGADFYSQLGHIYYNMLQLYRAVS
                     SMISTQVANEGLIATKTPKVRGLRTIKKEILKLIEIYISKAKNLEVVEVLVEPLLNAV
                     LEDYMKNVPDARDAEVLNCMTTVVHKVGHMIPQGVILILQSVFECTLNMINKDFTEYP
                     EHRVEFYKLLKAINEKSFNALLELPAAAFKLFVDSICWAFKHNNREVEVNGLQIAVDL
                     VKNIEKLNGSTFANAFFKNFYFTFVSETFYVLTDSDHKSGFSKQSLLLMRLISLVEDN
                     KIGVPLYAEGEAPEGTSNQVYLNEYLANMLGNAFPHLAREQVTNFLIALLKQYKDPSK
                     FNGTLRDFLVQIKEVGGDPTDYLFAEEKEKALLEQSRLEKERASKVGGLLKPSELDDD
                     "
     gene            257490..257560
                     /locus_tag="HG536_0Atrna1G"
                     /db_xref="GeneID:59324252"
     tRNA            257490..257560
                     /locus_tag="HG536_0Atrna1G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59324252"
     gene            <257789..>259603
                     /locus_tag="HG536_0A01350"
                     /db_xref="GeneID:59323415"
     mRNA            <257789..>259603
                     /locus_tag="HG536_0A01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281098.1"
                     /db_xref="GeneID:59323415"
     CDS             257789..259603
                     /locus_tag="HG536_0A01350"
                     /note="ancestral locus Anc_5.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136993.1"
                     /db_xref="GeneID:59323415"
                     /translation="MLRSSFLYGVNFNTYICDCLLARRSIGSPVVDWQAKMGDDGKSV
                     TVKTPRVSIAEGSAYEMGNIASNIRYVQSKTGAGEVNYINSATSVNDNQLLAEIGYKQ
                     ELKRQFSTLQVFGVAFSIMGLLPSIASVMGGGLAGGPATLVWGWFVAALFILMVAITM
                     AENASAIPTAGGLYYWTYYYAPKGYKEVISFVIGCSNSLALAAGVCSISYGFALEVLA
                     AVVISRDGDFEVTNGKAYGIFAAAVVAMCLLTCMASSVVARLQIVSIVSNVFIMILLF
                     IALPIGTKINRGGFNDGNFIFGNYHNFSDWNNGWQFCLAGFMPAVWTIGSFDSCVHQS
                     EEAKDAKKSVPIGIIASVLVCWILGWLLIICIMACMNPDVETVLGTDFEIVLAQIIFD
                     SLGKKWAVAFMALIAFCQFLMGASIVTAISRQVWAFARDDGLPFSKYIKIVNKRYSVP
                     FVAIIAACAASLALGLLCLDGPAAAALFSLAVAGNNLAWSTPTFLRLTFGRDLFRPGP
                     FYLGSFWSPIVAWFGVIYQAFIIILVMFPSQQHGLTDKTMNYACVIGPGIWILSWIYY
                     VTYRRKYFHGPKSNISDEDYNDAVGEDLIEEILSRKDV"
     gene            complement(<259735..>265698)
                     /locus_tag="HG536_0A01360"
                     /db_xref="GeneID:59323416"
     mRNA            complement(<259735..>265698)
                     /locus_tag="HG536_0A01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281099.1"
                     /db_xref="GeneID:59323416"
     CDS             complement(259735..265698)
                     /locus_tag="HG536_0A01360"
                     /inference="similar to AA sequence:RefSeq:NP_011733.3"
                     /note="ancestral locus Anc_5.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136994.1"
                     /db_xref="GeneID:59323416"
                     /translation="MERSMRSLTRHFEPVAGPKSGDQNGETQPPHDEQQQAPLVPPSV
                     NIVPPQSEPERHSIDEASTESYKNGSREDKNFSLSNIFKSRGANNRKKTLPKLSLRTS
                     SVAKGHSGSPHLSERSFSQSSAEHSSATRLRRRSNESRSSHLSSNSATDQPPRSAKVL
                     SFIEADDMDEFKDLQKDFHSAVNNEGLTWLPQLNSPKGTVSDIDGPSEDLEPDPEENT
                     YVGIADRMMVGSSAAESTRPSSTPKKDTAESHMYEKEEGDTTFVVEVADPNDIPGRGS
                     KKPVKLYGNSLGMISPTNRIRIKLAMLHCDHRYKIFYQLLLMFFTALMAFRTYHPSQL
                     FFIYSFTYWADYLAFFSCIMFTLNDVTKVVAFGFWDDSQMFAAEGKEYKSLADTFGIT
                     KLHKSLRDKYGSRIVDFIIPFKIVGEEEEEKYQMKALATGLRKTSSFDDKVNNKFQSP
                     RAFLRSSWNRIDFTSTVCFWIGLFLAIHRYDTRNGIRIFKTLAVLRILRLVNTDTGLS
                     SILRGVKQAIPQLINIGSMLVYFWVLFGVLSVQSFKGSLRRQCVWFNQDDPTDTYQYD
                     MQFCGGYLEPGTKKHMPYLFEDGTAGPVSKGFLCPEYSKCISNANPYNGRVSFDNIVN
                     AMELVFVVISANTFTDLMYYTMDSDEMAASIFFVVTIFVLTIWLMNLVIAVLVTSFEL
                     ANEKFKKQKLEVKMLESWPIRITQGYWKYFQVKAQQTRIPPWEEKGQYLLEKTEIVFV
                     VLIVVDLVMRCRLDSSVSDHYSQVFLETDLIICSLLFSESAMRVLLHIHNPWRFLVKW
                     SYVYDLVVGVAALIITTLKFHGAIDHTYYWLSIVHISRFYRVVYLFGFTSNLWKRVLG
                     NRLMIWNLSAFYFFFTFLVSIILSVFFEGVVPDDAMSEQQFAMYYLTNSFLSLFIIGS
                     TENWTSILYTVQSYSPNISSSFFSSVVLIIWFILSNSVILNIFIALISETMEVKEEEK
                     RPLQIKHYLKYIYPRKIKEYTHATFLERLRRKLFRKDKAEDSRDFKQFLMRGTAIMNI
                     AQSLDGLTDEVKSDFPTIDLPPNIKVSFESLTYYFSFLQKLRIYANNPFYRKPEVLFT
                     ECDDGPHRTFILQLNEFEDEKLSYLTKHPSFNYSYFILPPHHAFRRFCQCLVPPSVGK
                     RTDGVRFYDDDTDLYGQKVYFHRIERDLFVLCTTVVTILLIVFSCAVTPLYRRQHNLG
                     TWSWPTYLDCAFVVVFTVEFIVKTVADGVFYTPNGYLRNPWNVIDFIVLISLWINFIA
                     FVKNDGDLSRIFKGLTALRALRCLTISHMARQTFNLVVFDGIKKIFEAAFVSLTLLFP
                     FTVWGMNIFRGRLGTCNDGTKDQSSCYNEFTNTVFDWDILMPRVYQQPELHLDSFGSA
                     FRSLYEIVSLEGWTDLLQNMMNSTGIGTVTSFFASPQNAIFLVLFNFLSMVFILNLFV
                     SFIINNHAKTTGSAYFTTEEKSWLEAKKLLSQAKPKSIPCLFELSSSRRFFYRLAVEK
                     SNFYYASILQLFLYLHIIMLLCRSYNKAGTQIQFEDVFFMISTTIFLVQELFHQYGEG
                     LRLYRKSTWNRLRFAIVATSFILTAMGLSLSTNAKSFNNLKELFHLMFFIFIIPQNDM
                     LSELIQTAVASWPPILSLTYTWGILFLVYAIALNQIFGLTKLGPNTTGNINFRTITKS
                     LIVLFRCSFGEGWNYIMADLTVSTPYCYSLPGSDSDCGSELYAYLLLMSWNVLSMYIF
                     VNMFISLIMGNFSYVYRKGGSKSPIGRRDILNFVEAWAKLDTDGCGELEFSFLPKLMH
                     SFSGPLSFCIWEGRLTVSNLVKNYMEVNPDDPYDIKIDLAGLNKELSLIDKRKIIQRR
                     LQYRRFVQEVYHIDAYSGAMKFSNLLQLVPLYTTYDPRECLGIDEYVRHLYNLGKVDK
                     FLENEKNVEVLNMVVTRWKYRANKRNKILKSSTNVQTFELNSNPFDDATERVSSELNV
                     ASTPLMDFGVDQFIWSPRNNKHEKNNGKL"
     gene            <265900..>267741
                     /locus_tag="HG536_0A01370"
                     /db_xref="GeneID:59323417"
     mRNA            <265900..>267741
                     /locus_tag="HG536_0A01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281100.1"
                     /db_xref="GeneID:59323417"
     CDS             265900..267741
                     /locus_tag="HG536_0A01370"
                     /inference="similar to AA sequence:RefSeq:NP_011732.1"
                     /note="ancestral locus Anc_5.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136995.1"
                     /db_xref="GeneID:59323417"
                     /translation="MAGYVFWPQHLSRRKYDGNGCDGLEAVAIKLRGTDWMVVDIVPS
                     RNLDGTELAMPYFIIAHKQAAEVEWQFEDEFCSVIEFKAPNQRLLQFFSLDPISLSLP
                     EKEVETGNGVLVNKNVTKLWEHPRYQAHDRRLRQTLSLLNLFRTHETAFHEKYPHIGR
                     QAEDLSTRVLNLIRVQYKESAVWRTLCLLGLYLTVIVCQFSLYTYNALNWRRMKLVAF
                     SAMAQQIDLRCQQTCYFPVQYLRINMNMSLRKALPRFRTYSEASATLRKDLPSNYYPD
                     YIRFYNTVWLFLNDISFGLIFAAFLFEWSERLTRLLSKIIDFFLYDMLKTVTSSLANN
                     PLGIKLNEELARFLSDLFLWIIEFSHANLIQPLVKPDNLSMFLRLVGNLGCCFGGAFA
                     FSVILDFFSILTLHIYVFYHISGKIYHWQLQIMKSLFHLFCGKKRNVLRNRVDNNVFE
                     LDELLLGTLFFIILVFLAPTVLAFYYSFTAFRLTTIFIQIGLESVIALLNHFPLFALL
                     LRLKDPRRIPGGISIEQTDGSSRLELKNRPLSVGSMFSPYLALIHQMKDTYLSARTFK
                     QVLLGEPLAMHRNNLYQLLYSSLPSKPIKIATIYDKLSALVSSSKDL"
     gene            complement(<267796..>268119)
                     /locus_tag="HG536_0A01380"
                     /db_xref="GeneID:59323418"
     mRNA            complement(<267796..>268119)
                     /locus_tag="HG536_0A01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281101.1"
                     /db_xref="GeneID:59323418"
     CDS             complement(267796..268119)
                     /locus_tag="HG536_0A01380"
                     /inference="similar to AA sequence:RefSeq:NP_011731.3"
                     /note="ancestral locus Anc_5.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136996.1"
                     /db_xref="GeneID:59323418"
                     /translation="MSVPKARLLKVAEISAKIFDQNFNPTNARTGSKILSQRLKGPAI
                     AGYYGNPDFLKFRHLKTLYPGFQFVDLEEEYRLSMIEARKRRGKGAPKKKKEASSGGK
                     TKKRK"
     gene            <269198..>270859
                     /locus_tag="HG536_0A01390"
                     /db_xref="GeneID:59323419"
     mRNA            <269198..>270859
                     /locus_tag="HG536_0A01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281102.1"
                     /db_xref="GeneID:59323419"
     CDS             269198..270859
                     /locus_tag="HG536_0A01390"
                     /inference="similar to AA sequence:RefSeq:NP_011438.1"
                     /note="ancestral locus Anc_6.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136997.1"
                     /db_xref="GeneID:59323419"
                     /translation="MAGVSRTSSYDVDVASQGELHNRDSRLQKTDSKTELDVAYDNHG
                     GEIHLRKSFSLWSILGVGFGLTNSWFGISVSMVTGISSGGPMMIVYGIIIVALVSVCI
                     GISLGELSSAYPHAGGQFWWSLKLAPPKHKRFAAYLCGSFAYAGSVFTTASTTLSVAA
                     ELVGMYALTHPNFEVKRWHVFVCFELLHLFLLIFNCYGRSLPLISASSLYISLLSFFT
                     ITITVLACSSGKFNDAKFVFATFYNETGWKNGGIAFIVGLINPAWSFSCLDCATHMAF
                     EVERPERVIPIAIMGTVAIGFVTSFCYVISMFFSIRDLAGLMQSNTGAPILDIYNQAL
                     GNKSGAIFLGCLVLFTSFGCVIACHTWQARLGWSFARDRGLPFSRFWSQVNPQVGVPL
                     NAHLMSCAWVSLIGLLYLASSTAFNSLITGCIAFLLLSYAIPVICLLRKKRQIKHGPF
                     WLGPVGYFANIVLLCWTVFSIVFFSFPPTLPVDRNNMNYVCVVIVGFTLYSLAYWRFK
                     GRKEFSAIAEEEELLTNLVPTEDSDIEHSQPEMVLMTGKDSKSSE"
     gene            <271096..>272622
                     /locus_tag="HG536_0A01400"
                     /db_xref="GeneID:59323420"
     mRNA            <271096..>272622
                     /locus_tag="HG536_0A01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281103.1"
                     /db_xref="GeneID:59323420"
     CDS             271096..272622
                     /locus_tag="HG536_0A01400"
                     /inference="similar to AA sequence:RefSeq:NP_011437.3"
                     /note="ancestral locus Anc_6.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136998.1"
                     /db_xref="GeneID:59323420"
                     /translation="MTKEEIKEKKRKSQDDLKTERKKHKKDKKDKKDKKHKKDKKDKK
                     DKREESKENCIEQIEKVDTGAVIHKSSEPEISAFYKENEVSVDYPIERHIQPVLTFDE
                     LSLDSRIQSALSVFTKPTPIQSVSWPYLLSGKDVIGVAETGSGKTFAFGVPAINKLVT
                     QSSKPKGVQVLVISPTRELASQIYDNLVLLTEKAKLDCCCVYGGVPKHEQREKLKKTQ
                     VVVATPGRLLDLMQEGSVDLSNVSYLVLDEADRMLEKGFEEDIKNIMKETNTKGRQTL
                     MFTATWPKEVRELASTFMSDPVKVSIGNRDELSANKRITQVVEVIEQFQKEKKLLELL
                     KKYQSGAKKNDKVLIFALYKKEAARVERNLKYNGYKVAAIHGDLSQQQRTQALSEFKS
                     GASNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTE
                     QEKHLAGALVNVLNGANQPVPEDLKKFGTHTKKKEHSAYGAFYKDVDMNKKPKKITFD
                     "
     gene            <272949..>273764
                     /locus_tag="HG536_0A01410"
                     /db_xref="GeneID:59323421"
     mRNA            <272949..>273764
                     /locus_tag="HG536_0A01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281104.1"
                     /db_xref="GeneID:59323421"
     CDS             272949..273764
                     /locus_tag="HG536_0A01410"
                     /inference="similar to AA sequence:RefSeq:NP_015128.1"
                     /note="ancestral locus Anc_6.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037136999.1"
                     /db_xref="GeneID:59323421"
                     /translation="MVFGMRQALDRLKTAISPEEASSRSSSPVSTATEQSTRKSLRVR
                     RGSVDGGLIYQDDALPTVKLNGYLPTTKNKLLMPDMCDELRNLMPTRVQLYTDWQLLY
                     SLEQHGASLRSLYDNVAPERATPMRVGYVLVIKDRKHGIFGAYTNEPFHPTENRRYYG
                     NGECFLWKMDRVRGLSIGERRDTGCQSEEKVHDGEYGWQFRGYPMTGVNEFAIYCQSK
                     FLSLGAGDGHYGLWVDDSLLHGVSCPSLTFGNDVLSREGRKFHIVALEVWRVG"
     gene            complement(<273820..>274416)
                     /locus_tag="HG536_0A01420"
                     /db_xref="GeneID:59323422"
     mRNA            complement(<273820..>274416)
                     /locus_tag="HG536_0A01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281105.1"
                     /db_xref="GeneID:59323422"
     CDS             complement(273820..274416)
                     /locus_tag="HG536_0A01420"
                     /inference="similar to AA sequence:RefSeq:NP_011436.1"
                     /note="ancestral locus Anc_6.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137000.1"
                     /db_xref="GeneID:59323422"
                     /translation="MSDRDECADYDSKRSQSPSIDSQAYAIPMPAEIVSQLSEGSSDD
                     EVDNSNIEDSNGDMFLDNLVPGASSGLFMDSQDAGPMLDVSKYIFDSLIQAINSADFA
                     EAISLQTKTSAVINARSMKLKQLIDSTKEQLAHFKSRFERGAETSKAMRHNLRQTRET
                     ISKINAELGTAYPIELNQAREKVLERQFGESPESQSDP"
     gene            <274567..>277377
                     /locus_tag="HG536_0A01430"
                     /db_xref="GeneID:59323423"
     mRNA            <274567..>277377
                     /locus_tag="HG536_0A01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281106.1"
                     /db_xref="GeneID:59323423"
     CDS             274567..277377
                     /locus_tag="HG536_0A01430"
                     /inference="similar to AA sequence:RefSeq:NP_015129.1"
                     /note="ancestral locus Anc_6.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137001.1"
                     /db_xref="GeneID:59323423"
                     /translation="MTSLYAPSADDVKQRLRPFGIFFEKSLKDLIKGIRSNNGTPEKL
                     QQFLAQALSECREEANSPDMNIKTNAILKLTYLEMYGFDMSWANFHILEVMSSSKLQQ
                     KRVGYLAASQSFHKDSDVLMLATNLMKKDLKFGGNYDVVKVGIALSGLSTIVTPALAA
                     DICDDLFSMLNSPKPYIRKKAVTALFKVFLQYPEALRDNFDKFAAKLEDDDTSVLSAM
                     VSVICELSKQNPKPFIQLSPILYEILVTISNNWIIIRLLKLFTNLSKIEPKLRPKLLP
                     KILELMDSTMATSVLYESINCIVKGNMLDGQEYDTAICCLDRLHNFCDSSDPNLRYIS
                     CVLFYKIGKINVAFISQFDKLVLRLLNDVDISTRSKALELVEGIVNEDNLQSIVLTLL
                     KQLTEEGKAVMKIGASRFESTKEISIVITESYKTKMMNTIIHICSMDDYSNLSDFNWY
                     NSVLLDIAMLCQELSEPRLEQKIGEQFRNIMVKVPSMREDTMSTIIKLLSTDSIYTQI
                     PGVLKELIWSLGEFSSLIDNGDDLIESIIAKDHYYAPSVQQIVIIALLKIFSHWSNNH
                     EHTDRARLKGIMRSLLRYLERLSCSKYFEVQERAIESMELLKLSSEALNDDPDGLPLL
                     ISDVIPSLFNYYELKPISSGAQQQMQRNVTVDCETPFLTAEELEQILEQDGNTSVHSE
                     GSMASDISDIEPSEEIAYSSSDENQPTKDWALSKEEKEELERRKKEERQSNPFYLAEE
                     EVQARTNNDLLDFEENAHDEQSANVIRLNRTANVTGPDEFDKSQTKSKKKKRSTKRVE
                     ILPDEVIQASNGDATIPGSDMKPSRSSPSISSLTSSNKKINLRTQNKLENFDFSKPKA
                     SSVLLGNAAEASGSQDEQVELEKLRQKFANQALVGPTDGNSDEEVVVIKKKKKNSSKK
                     KRKESSKTNSTPANDEPDILEQ"
     gene            <277544..>279214
                     /locus_tag="HG536_0A01440"
                     /db_xref="GeneID:59323424"
     mRNA            <277544..>279214
                     /locus_tag="HG536_0A01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281107.1"
                     /db_xref="GeneID:59323424"
     CDS             277544..279214
                     /locus_tag="HG536_0A01440"
                     /inference="similar to AA sequence:RefSeq:NP_015130.1"
                     /note="ancestral locus Anc_6.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137002.1"
                     /db_xref="GeneID:59323424"
                     /translation="MSFKATISDPERHQIWSRTVNALSTIYEDVRLTITPSELIVWNI
                     NSTDTTLSKVRFSSQFFEEYTFQPREIIFGESGIQVVTDSHGVDHKLYSLQINGRHLS
                     TVSKKPDGDAIKNFTISINNSPTCPDILTNRLLVHVEMESLIRKEYTPQFQPIEYDPI
                     IIDLKYKRNFLNVYGSASSLPNGEMEHLDPKLQAIFNDSRKELSEALFSDDPKADSKR
                     DNKLTAADEINFICCNQALLKNFIDNCNANVTEEFKLEINVHKLVMTAFTKAIYGKNN
                     DILKNTMSLSNTISVADLEHYCLFTTVDEGESSSADGKKDQTKSIIFKLKDLKNFLST
                     TWSWKTAHNDNLNIWFCHSGDPILIELKKNGVTLQLVQVTDGSGAHFDHEDHMAGTVI
                     KKAISPEKSKIHVTHGDTSDPRRSPLRSHQRYTTETRTSPLNDRPTSTAAHAPRRLFV
                     TGDSQPASQRRGSGSRLDWNDQDRLSREPTEFAPEPTNTAPVRAERTGTTIEWGKRPR
                     EEDEDFSTLDRQSVLKNEKIKHFQAITKMQEAEGLGPTQQTKPKGLFD"
     gene            complement(<279261..>279638)
                     /locus_tag="HG536_0A01450"
                     /db_xref="GeneID:59323425"
     mRNA            complement(<279261..>279638)
                     /locus_tag="HG536_0A01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281108.1"
                     /db_xref="GeneID:59323425"
     CDS             complement(279261..279638)
                     /locus_tag="HG536_0A01450"
                     /inference="similar to AA sequence:RefSeq:NP_011435.1"
                     /note="ancestral locus Anc_6.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137003.1"
                     /db_xref="GeneID:59323425"
                     /translation="MSQPVQRAAARSFIQKYINKETLKYVFTTHFWGPVSNFGIPIAA
                     IYDLKKDPTVISGPMTGALVLYSAVFMRYAMAVTPVNYLLFGCHLVNECAQLGQGYRF
                     LHYNYFTDEEGRKAIEEKWKKTD"
     gene            <280103..>281059
                     /locus_tag="HG536_0A01460"
                     /db_xref="GeneID:59323426"
     mRNA            <280103..>281059
                     /locus_tag="HG536_0A01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281109.1"
                     /db_xref="GeneID:59323426"
     CDS             280103..281059
                     /locus_tag="HG536_0A01460"
                     /inference="similar to AA sequence:RefSeq:NP_015131.1"
                     /note="ancestral locus Anc_6.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137004.1"
                     /db_xref="GeneID:59323426"
                     /translation="MLIKRLPSEGGSIAMNYHSNAGYGRGFRPLPRPSSSGTLSGGPQ
                     YEPTNKRQRLQETPAVGAGYPPPPLPYHMPTPMATYPYCMQPPPASHPMPLPYMSNEW
                     SAQPYREPPQTIAGSRQQPQSVEIEAASGDEEGDERGNDESSQDESSEEQQSEATGSQ
                     PLTVPGTSITLATEEDILKWREERKRMWLLKISNNKQKHMQGMGIKEEDLKVQKSALQ
                     EGKKQKQFIQNIQNQVNRINPRSTLSVRIAQREMAQENSRLLDFIEKLGDAGLLNCEL
                     TEEEKEKLFGPHDSTQKKGRNSYRSDFKKSDTHTSNKAYHRR"
     gene            complement(<281056..>281433)
                     /locus_tag="HG536_0A01470"
                     /db_xref="GeneID:59323427"
     mRNA            complement(<281056..>281433)
                     /locus_tag="HG536_0A01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281110.1"
                     /db_xref="GeneID:59323427"
     CDS             complement(281056..281433)
                     /locus_tag="HG536_0A01470"
                     /inference="similar to AA sequence:RefSeq:NP_015132.1"
                     /note="ancestral locus Anc_6.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137005.1"
                     /db_xref="GeneID:59323427"
                     /translation="MSSSESDSGETISNKQNDVPAELNFQDKPSNKVFETVTEGRAAP
                     GKKSRNPKEGRVSKPKRTVARSSQPRNAHRQRESRLIATPTAQQIAKDANSFYRGALL
                     GSFLGATLTTVVTNLVAKAFQTS"
     gene            complement(<281686..>282636)
                     /locus_tag="HG536_0A01480"
                     /db_xref="GeneID:59323428"
     mRNA            complement(<281686..>282636)
                     /locus_tag="HG536_0A01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281111.1"
                     /db_xref="GeneID:59323428"
     CDS             complement(281686..282636)
                     /locus_tag="HG536_0A01480"
                     /inference="similar to AA sequence:RefSeq:NP_011434.1"
                     /note="ancestral locus Anc_6.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137006.1"
                     /db_xref="GeneID:59323428"
                     /translation="MEEVRRFRFTLDEAKSERGVVKLIGRASDVNPDRFARRDNLLFD
                     EKSLSKNHALLGLKLLDPLETGVHIIDQFRIYVKDLGSTYGIVDLNSEESDPFVIDLK
                     NGERFGLIGLEQPISMYQGRAAKLKFQVNLQYHDVDKGIFECIVKDVSFDDSPILSRP
                     STCEDAASGSSSESNFSEDFTIIREEALGESDIDEVENEETESSSSSYSSDSGTSGRY
                     AIVDLIESDNTPEKWDILQTEKSDDDSDHLCSCSSGTCRLGSKYVIINYGGKAADDGP
                     ETNKAAGIVRVFVISALAGFFLGFLGTVVLLVGLALKEME"
     gene            complement(<282850..>283956)
                     /locus_tag="HG536_0A01490"
                     /db_xref="GeneID:59323429"
     mRNA            complement(<282850..>283956)
                     /locus_tag="HG536_0A01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281112.1"
                     /db_xref="GeneID:59323429"
     CDS             complement(282850..283956)
                     /locus_tag="HG536_0A01490"
                     /inference="similar to AA sequence:RefSeq:NP_011433.3"
                     /note="ancestral locus Anc_6.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137007.1"
                     /db_xref="GeneID:59323429"
                     /translation="MDISFSTKSIQINGCQHKILLQNQNGPCALLALANVLLLAPRHA
                     AEVQELIYLVSRNESVALQDLVQVLANIGIQNQHGADTDVSQLLQLLPQLHTGLNINP
                     KFNGSFEDGVEMSIFRLYNVAIVHGWIIDSESDPVVYGHVSKYSYEDAQKVLIEAYEV
                     QRNNLQVANSEQVLEDASYIRSFFARSATQLTEYGLRHLQEVLVEKSFAVLFRNDHFS
                     TIYKNNGELFTLVTDLGFRDRGDVVWQALKSVSGSQDAFYTGAFIPTSLERTRTTATS
                     GTQNQPDSFVSNPFSDRNDARAPATNEIQQIEDDELLARRLQEEEDREAVSSIQRRQD
                     QAIRKDKQSKGKKARSKNGAKRSKKEKLKQCIIM"
     gene            complement(<285837..>287996)
                     /locus_tag="HG536_0A01500"
                     /db_xref="GeneID:59323430"
     mRNA            complement(<285837..>287996)
                     /locus_tag="HG536_0A01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281113.1"
                     /db_xref="GeneID:59323430"
     CDS             complement(285837..287996)
                     /locus_tag="HG536_0A01500"
                     /inference="similar to AA sequence:RefSeq:NP_015134.1"
                     /note="ancestral locus Anc_6.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137008.1"
                     /db_xref="GeneID:59323430"
                     /translation="MSDTEMTNSTETPELAEMEETKISTSSEFVTNDEEEQQIEAQSE
                     SEVPGSENEVPQEAAEDEQEPSEEQQEPSESVDDGEVAEEDDKEAGDDEDAVDVDNEQ
                     AGGDEEAQVSSSHEGEEESADKEYNGAGEAAESSDADPQEDKSTTDVVEMAAEQYGRA
                     ENVQYDLLQRQAKYIMESNMLNLPQYQQLSQEDKISALVNMLNSNPDTMMPVIPEMRS
                     LSQPEVVSQPGQEMSPRGRSRPDLNGPMSPEERERYAQYLHGENRITEMHDIPPKSRL
                     FIGNLPLKNVSKEDLFRIFSPYGHILQINIKNAFGFIQYNNPQSVRDAIENESQEQNF
                     GKKLILEVSSSNARPQFDHGDHGTNSSSTFISSSKRPFQHEESDAADMYNDNQGYKKS
                     KRRVPACVIYVKRTADRGYANEVFNHFRRGTDLETDMIFLKPRMELRKMINEVAHDGV
                     WGVILVNKTRNVDIQTFYKGPQGETKFDEYISISADDAIAIFNNLKPSRGSAGGPPVG
                     PVNPYAQQPAAIPPPQHPSSQNYYGGYGMPPPQQPYVQQGYGMPLPNQGYGAPAPAPM
                     GQPYGRYQGSPPAMEPALSQPQLSSLLSANGGGQMNQQQLLSAIQNLPPNVVSNLLSM
                     AQQQQQQQQPQTQQQLLGLLQSMQGQQLPQQQQASAYSSLNDSYAQRSPMGTVQPQQS
                     PPPPLQPQPQQPQQQPQQSSPGNNVQSLLDSLAKLQK"
     gene            complement(<288496..>288696)
                     /locus_tag="HG536_0A01510"
                     /db_xref="GeneID:59323431"
     mRNA            complement(<288496..>288696)
                     /locus_tag="HG536_0A01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281114.1"
                     /db_xref="GeneID:59323431"
     CDS             complement(288496..288696)
                     /locus_tag="HG536_0A01510"
                     /inference="similar to AA sequence:RefSeq:NP_878179.1"
                     /note="ancestral locus Anc_6.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137009.1"
                     /db_xref="GeneID:59323431"
                     /translation="MRAATRNHVTNRLFMTTFLVAFSSVALGSVLPCPAHTLDSDSPT
                     HDHQRANQHQKPAVQQNKVTDI"
     gene            complement(<289022..>291367)
                     /locus_tag="HG536_0A01520"
                     /db_xref="GeneID:59323432"
     mRNA            complement(<289022..>291367)
                     /locus_tag="HG536_0A01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281115.1"
                     /db_xref="GeneID:59323432"
     CDS             complement(289022..291367)
                     /locus_tag="HG536_0A01520"
                     /inference="similar to AA sequence:RefSeq:NP_011432.1"
                     /note="ancestral locus Anc_6.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137010.1"
                     /db_xref="GeneID:59323432"
                     /translation="MFWSAKTGITSKYSFSSSPTFTCEPWNIYMGRLKSSNSASGAPS
                     KVSIFVFDKRQFENHLLNYGIIKSRSSSHDKTLLQDAYEVLRRQVSNLSKLKHPNILA
                     VIEPLEEHSKNFMFVTEYVTGSVESVFGHGNEETSFLQQHDKEEVIIQRGLLETVQAL
                     DFIHNRAISVHLDIQPRSILINENSDWKVSGLGHLIKLPHGTSSSEYFIDQYDPRIPS
                     FLHLQLNYTAPEIVLENTVSFKSDFFSLGLLIYMLYTGKDMLSTENSTSQYRAEYTRF
                     ERKLATMSWENMFNKLPVSLRPCMPRLMNRDIYSRYDNINEFLDSEFFQDPLIKTLSF
                     LDDLPTKTNDEKVVFLNGLEELLPKFPVTLLQRKFLTVLLEGLAQQCKDKEPNGPCIS
                     KEVEIIIRIGSTVSQLTFQEKIYPALTKKSDFPIILHNATMALIKNLSTIRQKVKKED
                     FLEIILKPLLTFTFHDMQGEQSLAAQESLLGDLNIVADLFDFVTMKNFLMPLISHLFT
                     KTTSLMVKVSSISCLRELIEKELVDSDLICDEVLPLFKSMKTRDPRILMQSLTLFEMV
                     PKVIKSDGTLVEQLLPLLWNYSMSQTLDKAQYSRYTVVINRLSHTIQKTHSNTLQDPT
                     SSSHDAAGTKDFDNLIKPVSVKREDPETKAAKSIAVPAIVPKKKSGARKPSILTPRPA
                     QPSKNAPRPRILPLKPRQQEADADDFDDFVSATSSPAPPTANHGSASTTPSHGHPRII
                     MESKLHTPMSNLPPGFSVSLQPSRKPFDTATRSEDSSASLI"
     gene            <291741..>293573
                     /locus_tag="HG536_0A01530"
                     /db_xref="GeneID:59323433"
     mRNA            <291741..>293573
                     /locus_tag="HG536_0A01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281116.1"
                     /db_xref="GeneID:59323433"
     CDS             291741..293573
                     /locus_tag="HG536_0A01530"
                     /inference="similar to AA sequence:RefSeq:NP_011431.1"
                     /note="ancestral locus Anc_6.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137011.1"
                     /db_xref="GeneID:59323433"
                     /translation="MGSRACMKLWIEGAVSWVYMARIMQNVERFLSVESLDGRLKPCS
                     RDVKYQNKENDGDGSKLNGKVLTTQPSRWGTWEFRFYYLAFIVVLPLMLKAVMEASSE
                     LNPNYPRYAGMLSKGWIFGRKVDNSDSQYRFFRDNLPLLIALMLGHTVVKRVVRYATG
                     ASKLSFDFGFGLCFLYAAHGVNSVRILLHMLVMYSIAHLLKNERKLATVLSWTYGIGT
                     LFINDKFRNYPFSNFISCLSFLDTGYKGIIHRWDVFFNFTLLRMLSYNMDFLERWSSI
                     RQNQPSTSSADASTNDARISSDSFESSATSTVLNERQRLVAPHNIQDYGVINYIAYIT
                     YTPLLIAGPIVTFNDYVYQSRNTLPSINVRYITSYAIRFAICILTMEMVLHFAYVVAI
                     SKTKAWTGDTPFQISMIGLFNLNIIWLKLLIPWRLFRLWALIDGIDAPENMIRCVDNN
                     YSALAFWRAWHRSYNKWVVRYIYIQLGGSKNRILSSLAVFSFVAIWHDIQLKLLLWGW
                     LIVIFLLPELFATQFFARYRNRPWYRHLCAAGAVINIWMMMIANLFGFCLGSDGTMVF
                     LRDLFGTLPGITFAVTASGALFIAVQIMFEQREHERRHGINLKC"
     gene            complement(<293632..>294465)
                     /locus_tag="HG536_0A01540"
                     /db_xref="GeneID:59323434"
     mRNA            complement(<293632..>294465)
                     /locus_tag="HG536_0A01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281117.1"
                     /db_xref="GeneID:59323434"
     CDS             complement(293632..294465)
                     /locus_tag="HG536_0A01540"
                     /inference="similar to AA sequence:RefSeq:NP_011430.1"
                     /note="ancestral locus Anc_6.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137012.1"
                     /db_xref="GeneID:59323434"
                     /translation="MSADNKVAVSPAGLLNPDVVLLSLLFAGSFLGARSAFNRYLRQL
                     NKVAEIPSSVFRKRWLYGKVTSVGDGDNFHFFHMPGGLLGGWGWLRKVPKLERLEGKS
                     VTESTDMIQSLYRRRLWRLFKTESLESAWSNHYLSLKVPYKNRRNLSTIPVRFCGIDA
                     PERAHFGNPAQPFSEEALNWLKYTVLSKGVWIKPLSVDQYGRCVARVAYWTWTGYKDL
                     SLEMVKRGLAVVYESKSFAEFDGREKAYRVQERIARAHKRGLWSQKKVETPGEYKKST
                     R"
     gene            complement(<294698..>296704)
                     /locus_tag="HG536_0A01550"
                     /db_xref="GeneID:59323435"
     mRNA            complement(<294698..>296704)
                     /locus_tag="HG536_0A01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281118.1"
                     /db_xref="GeneID:59323435"
     CDS             complement(294698..296704)
                     /locus_tag="HG536_0A01550"
                     /inference="similar to AA sequence:RefSeq:NP_011429.3"
                     /note="ancestral locus Anc_6.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137013.1"
                     /db_xref="GeneID:59323435"
                     /translation="MSDSGGSSPFLKSPLRAPSKLEETVDKDRKLMSLQYKLNSVQNE
                     FEIERLRLQQQYNSVDKKYRVKVEELEKALSDTTFLYETNNKLEQELRELKVQLDDSQ
                     NRKDQVIQDLRRKLHVKEQEGLDRLSELQSKLSDREHVIDRLKIEAQSSQSLVKRYDE
                     EIAKQAAEIKQLRKASTEKDDEIASLRASRVIMAHHNYSTEELQELTVVNKMFKDQVQ
                     YTKELEEVNLQQASELKKLRVSSDSQQFWKSENEKLKNKLEQMDQMERQIQDLQLENL
                     NLKSQLASWDIYNNGKDRPEDIIREIKLAKESLVVLTDENEKFRLDNGNLKMLNDELA
                     LERNQLLDLSKNYEASIINYKKLNHEIEQQKQLAFEECRLLRKQLDEFAAFNEESREG
                     NEAKQAKGLKELETIVDGYKNQTEDLTEELRKLNDQLLAQEPSLKKRKMSDQLGLNYS
                     QRLNELQLNNVKILRELQNSQNNNKILQEKLQKLSDLKEKSIRILQLRDNPLLKDQFV
                     KRKQLQLLKKENEDLLRELSNEEGIPVERIPRSIYESLSFELKQRDDDLLRAGKKFNR
                     LKEMFNKKSLEFIDVVNSLLGFKLEFQQEGKVKIFSAFKPERYLTADLNQNTLKSNLT
                     ADLDDWDSLLRTWVDERGQIPCFLATLTLRLWEMSNENKTDKTT"
     gene            <296942..>297423
                     /locus_tag="HG536_0A01560"
                     /db_xref="GeneID:59323436"
     mRNA            join(<296942..296952,297018..>297423)
                     /locus_tag="HG536_0A01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281119.1"
                     /db_xref="GeneID:59323436"
     CDS             join(296942..296952,297018..297423)
                     /locus_tag="HG536_0A01560"
                     /inference="similar to AA sequence:RefSeq:NP_011428.1"
                     /note="ancestral locus Anc_6.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137014.1"
                     /db_xref="GeneID:59323436"
                     /translation="MSKVPRSFRLLEELEKGEKGLGPDSCSYGLADSDDISMTYWNGT
                     ILGPPHSNHENRIYSVSIECGPNYPDEPPKIKFISKVNVPCVDPKTGEVNSSLFHTLR
                     NWKRAYTMETLLLDLRKEMATPTNKKLPQPKEGTTF"
     gene            <297857..>299137
                     /locus_tag="HG536_0A01570"
                     /db_xref="GeneID:59323437"
     mRNA            <297857..>299137
                     /locus_tag="HG536_0A01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281120.1"
                     /db_xref="GeneID:59323437"
     CDS             297857..299137
                     /locus_tag="HG536_0A01570"
                     /inference="similar to AA sequence:RefSeq:NP_015136.1"
                     /note="ancestral locus Anc_6.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137015.1"
                     /db_xref="GeneID:59323437"
                     /translation="MSATEMLCNLRLTGSLRSLRCYSSLEFPAIRIRDYSKYVSIKPV
                     TELRRSSSPDFISSPNSKLQSLIWHKPLQNVLVTKKPWTNTTREAMVQFITHLHDSYP
                     EINVIVQPDVAEEIAQDFRSTPHQNPNEPHILYTGADQDIVANTDLLVTLGGDGTILR
                     GVSMFSNRQVPPVLAFSLGTLGFLLPFDFQDHKNVFQQTISSRAKCLHRTRLECQVVR
                     RGEKESHDLSTSLHAMNDIFLHRGDSPHLANLDIFIDGDFMTRTTADGIAFATPTGST
                     AYSLSAGGSIVSPLVPCILLTPICPRSLSFRPLILPHSSHVKVRIGAKASQGPANNVV
                     KLSVDGIPQPDLRIGDEIHVVNEVGTIYLNGSQVPSTNKKDVSERRKTIKNSGIYCIA
                     KTENDWTHGINELLGFNSSFRFSRHAKHIKKDNK"
     gene            <300099..>300698
                     /locus_tag="HG536_0A01580"
                     /db_xref="GeneID:59323438"
     mRNA            <300099..>300698
                     /locus_tag="HG536_0A01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281121.1"
                     /db_xref="GeneID:59323438"
     CDS             300099..300698
                     /locus_tag="HG536_0A01580"
                     /inference="similar to AA sequence:RefSeq:NP_011426.1"
                     /note="ancestral locus Anc_6.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137016.1"
                     /db_xref="GeneID:59323438"
                     /translation="MSGRSVREILFSVTLYPSHLSELHSKIRFLYTPAIMKFTSIALS
                     VICLISNVFGAPTEATAGDLKVPSEAIVGFLDLAQDKDVGVIPFSNETTTGLLFVNTT
                     ILDQATDNKANKRSAEAWHWISLRTGQPMYKRDANADPWHWISLRTGQPMYKRDANAD
                     PEADPWHWISLRAGQPMYKREADANPWHWISLRTGQPMY"
     gene            complement(<300854..>301498)
                     /locus_tag="HG536_0A01590"
                     /db_xref="GeneID:59323439"
     mRNA            complement(<300854..>301498)
                     /locus_tag="HG536_0A01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281122.1"
                     /db_xref="GeneID:59323439"
     CDS             complement(300854..301498)
                     /locus_tag="HG536_0A01590"
                     /inference="similar to AA sequence:RefSeq:NP_015138.1"
                     /note="ancestral locus Anc_6.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137017.1"
                     /db_xref="GeneID:59323439"
                     /translation="MKIIYCHSPDNFQNLQIAGDFSDWKPLSMVKNGKDGLWEYVIDS
                     RKLPPDTGKVHFKFIDDNGVWFTDDDYPKEVDEHSNENNVKMLTADERDDKIDMNEGI
                     PVDFEGPGSPAPSLEAESEEKKGAAKRIATPNGPKSSRSKSAVEDKDESVGGSAVVVN
                     HSDAEDERQVAESSERPDTSGTALTGRENNPEQYRDVLARIIAFFTNLFRSWFG"
     gene            complement(<301858..>303618)
                     /locus_tag="HG536_0A01600"
                     /db_xref="GeneID:59323440"
     mRNA            complement(<301858..>303618)
                     /locus_tag="HG536_0A01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281123.1"
                     /db_xref="GeneID:59323440"
     CDS             complement(301858..303618)
                     /locus_tag="HG536_0A01600"
                     /inference="similar to AA sequence:RefSeq:NP_015140.1"
                     /note="ancestral locus Anc_6.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137018.1"
                     /db_xref="GeneID:59323440"
                     /translation="MRTYGNNTNQFFQPSLQNRDSQPHNLSSLQSGALLQAGQGDSRA
                     SWSQNTSGFTLDRYPSQQLCSSGFAGGTVVNGIGTFRTSEEDGICENHISFCFNRDLD
                     EYPSSQLSTVSSGYSRADICGSVAGQRNDGSYAMVHAVANSNNILPSGGQLSCPPIFT
                     SAPSKTVYLGNIPPTLTVKALLDHVRSGVVEEVRILPDKMCAFLTFVDESAALLFHSD
                     ALLKRLHIDGRDIKIGWGKPTPVDPFVANAIRSDGATRNVYIGQLNTDTDIASQVGAD
                     PTEEKITEDKLKSDLQEFGEIDCVKIVAEKGIAFIHFASILSAIKVVANLASTNAYYK
                     NKKIFYGKDRCAFITKTQQHNAAQFLGIHPGMDRSAQFKDYELISNALLQQSAAAAAI
                     ATSAGGPNNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKLLSDRHVCFVTFIDPA
                     AAAQFYAMSSLHGITIQKRRCRVGWGKHPGPLQNSLALAVSNGASRNVYVGNIDFEQD
                     SKRQNPIFTAENLRSVFEEFGEVEQINFLPERNCCFINYTNINNAISAIDKIKSNPSF
                     QDLKINFGKDRCGTIPHQRR"
     gene            complement(<304116..>305294)
                     /locus_tag="HG536_0A01610"
                     /db_xref="GeneID:59323441"
     mRNA            complement(<304116..>305294)
                     /locus_tag="HG536_0A01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281124.1"
                     /db_xref="GeneID:59323441"
     CDS             complement(304116..305294)
                     /locus_tag="HG536_0A01610"
                     /inference="similar to AA sequence:RefSeq:NP_011425.1"
                     /note="ancestral locus Anc_6.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137019.1"
                     /db_xref="GeneID:59323441"
                     /translation="MKFVSCIAVSNVVDEEAPEDVVLCESDLGEQRLPESEQELSELM
                     IEEIVISEGNEIHKRQKISREDLKIFPGTEREKSSLKGAIWHELVKLLTGHRVQLDSV
                     KGSVQYTRWVCHAADGKTWYLAMEMEAGGIVRKLAQLDVPAVSEGEVDLFQMTNRLFA
                     SYCESSDAVKALLLRTAELESFLSERESLEKVRLERDDKTRSIMVNLLNEKKTRIAQL
                     EQQLEEKCPVSGLGDIQDSEVINRNVREAVSELISPGKRRARAEQMKDDHKRKKVNRK
                     LFPEPKIEPADDFDDDFQFFGITKVKEESPNSNSTPKKPAVKQESHEERLHETDSQNS
                     HPIVDSRSTIGAESQSDTEADTEADTETEVPNAGEQSPASKSDPESSSQPDTDISSPG
                     "
     gene            <305537..>306523
                     /locus_tag="HG536_0A01620"
                     /db_xref="GeneID:59323442"
     mRNA            <305537..>306523
                     /locus_tag="HG536_0A01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281125.1"
                     /db_xref="GeneID:59323442"
     CDS             305537..306523
                     /locus_tag="HG536_0A01620"
                     /inference="similar to AA sequence:RefSeq:NP_011424.3"
                     /note="ancestral locus Anc_6.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137020.1"
                     /db_xref="GeneID:59323442"
                     /translation="MGLVLGNVENSGMPPEYELEHPKAEHCPGPESENAGKGDACNGC
                     ANQSVCESLPKGPDPDIPAIVENLSNIKHKVLVLSGKGGVGKSTFTTMLSWALSADED
                     LQVGAMDLDICGPSLPHMLGCVNDVVHESNAGWTPVYVADNLATMSIQFMLPEDDSAV
                     IWRGTKKNALIKKFLKDVNWDYLDYLIIDTPPGTSDEHITINKYMKDSGIDGALVVTT
                     PQEVALLDVRKEIDFCRKAGIKVLGLVENMSGFVCPGCKGQSQIFKPTTGGGKGLCAE
                     LGIKFLGSVPLDPRIGKCCDNGESFLDAYPDSPASEAVLQVVESLRDAVGDL"
     gene            complement(<306603..>310535)
                     /locus_tag="HG536_0A01630"
                     /db_xref="GeneID:59323443"
     mRNA            complement(<306603..>310535)
                     /locus_tag="HG536_0A01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281126.1"
                     /db_xref="GeneID:59323443"
     CDS             complement(306603..310535)
                     /locus_tag="HG536_0A01630"
                     /inference="similar to AA sequence:RefSeq:NP_011423.1"
                     /note="ancestral locus Anc_6.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137021.1"
                     /db_xref="GeneID:59323443"
                     /translation="MFGKSTTAGSLFNNTSTPTSTPTAPNNTLQKPFKAGGQGLFGNA
                     NPTAAVSTPSPSGNLLNGGANIQTKGNGLFGGTQANTTTGGLFGSNSTQNKGSGFAFG
                     QNTAGGSGGGLFGTSSSSNGASSRNLPFENKISGGAGFSGSGQASGGLFSGTNATSST
                     GLFGNHQSLGNSTQGTFSFNNNVSNSVQTQPSFNPYGLNIANVPVPVSSMPASITAPA
                     MDSKTTLDRSTESNTSFTSGSTAPNRRTYSISSTISNTTGSQVSLPATSKSSLINKLS
                     ARLKSAPNTSSTHGIFSPALDGQWNSQEKNKPNVKDITDSRESASKQKDEFPSGGFTP
                     LSLQRGGSSDMRKLKIDPSRSIAKKLKLFTGESTPTKSHTIDQSGEEKINCAEGKTQK
                     DEQQEPAINALTKDNDIPNQVHDHDELSDSSPPAVDNSGYWCSPSPEQLANLSEEQLT
                     AVPNFLIGRKGYGSITFQYDVDLSAFAKHIETELFGKVVIFNANKTVEVYADESKKPP
                     IGCGLNVPAIVTLNNVYPVDKKSKKELRDEANSNEVQVLVRRLRNLRNMDFISYNPFG
                     GVWTFKVNHFSIWGLTNEEDAEIDEQEVKNAKAETIIDENFAYPNARRSLAQTKMDQE
                     MLPGTFESQENGFSPAELPQRELIGVRQANNSDLESVTPRESDFLVEEKPYEPDINES
                     DFEGMVNEPALNTSSNWVEQLQLAGSNLKSVFAEASDLSVDGDNGIELLFNEFNENLR
                     KEKTAKKERRIVNFNFAKFSSDSSLLMKAPNRTSGVRSHIIPMNSCREPAFVEALFSK
                     HFSLCAFTKRQSNNYPKVTGSQLLFSDIADLCSPSSVEYTLWTLCSVLFDEINLNYTV
                     DDPSVEEALLKNERHKQICSWIVEQTKDEINARIENETDALEIIFLYLLKNDVANACK
                     MALKSQNGHLAILLATLDSNDPRIRDLAAGQLERWRSCGQRVSPAIARIYRLLAGEEV
                     NEKFLNEREKDSISWLALLGANLYYGKVNELSLKEVISLATRDPISNKHDFKYTIFKL
                     YGLQEPIEFTFEELKNAVSPLDYSISWHIAQILRFGKEGVISDRMNDKLTSDYIGQLR
                     VCQLHKEALFAASFYSDDSAAEQHIESIVYHEIPILSSASNKDMIQRLRIPTRLIQKA
                     AALKHRYDGDYLREAQCLIKAEAFEEAERVVIESVGPMLIINGLTNNERDLTVLQGLL
                     SSFPASEMKNWSTGLGVYDIYVKLKLGSNADKQLIDCLLDGVCLLYEAHKRCKAIPVC
                     CSIISQYVAAQYLELEQHSAEKDDSYKEKLLKLPLGQPEKKYLESSLV"
     gene            complement(<311000..>313264)
                     /locus_tag="HG536_0A01640"
                     /db_xref="GeneID:59323444"
     mRNA            complement(<311000..>313264)
                     /locus_tag="HG536_0A01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281127.1"
                     /db_xref="GeneID:59323444"
     CDS             complement(311000..313264)
                     /locus_tag="HG536_0A01640"
                     /inference="similar to AA sequence:RefSeq:NP_011422.1"
                     /note="ancestral locus Anc_6.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137022.1"
                     /db_xref="GeneID:59323444"
                     /translation="MGEKSFSGGEGRSNGQLKKSGGMVAPAKGILKSSQNTDQPQQLH
                     ALDSSFLASGDIQLPDRILSKSDLQEGNNTTSRIHTLALQEKISRRVSFAPDVTLHSF
                     DFVPETKANLREPRRRAYDVFATSTQNEQVPGEVEDESLPMDLTSPVAVSKQAYKPVF
                     DQEVSMEITQLFPKHDKTHPTDTEETMEFTALQNRSNNAIPEQSTMEITEVHSFKQSA
                     GASRPETPPTSKRRKLAEPSNDIRDSESSEEQDMELSLMEKLSPIKLNSIEPQVTKPV
                     FEEPESYSLQKFIEITGLSFFIDTDLLDKTKKPVVFKTIQPLQPASFRLNKVLNVLYL
                     DTPVLEMNAFICKELMHRVEQSKKQFDDLDRQINTSSPPPLLLSEYFNASYDMRQSMN
                     QQLHLVKSYSKLKAKKSWFEWRFQHLNGIKAVLEENLTLIRGENAKVELELTKARDIR
                     SKAQALREAIKNEIMLLKELPPEACQEEKRLEEKVRLEQLKQELALYAVDITNHQALA
                     EKSSELKSKLTAKVAQLVSLKNEIKSLDQLHSTKPKKSGFTQYDIKKYSAKLDILGKI
                     SGVEFVQFKKSELTLRFAWLDTSQQLTINLSNLNNSSAKTYEIIGSADMAFIFDHCYH
                     RAMKAVSVTSSHQHLSLFLASARQSQALIKEYALLRLSFPVEVRLKNDVKVLEIKDFD
                     LRTNSKRIYDLNLNDFLTAAQDKNGSVRVKTTVIERGHSASSSNSAAFFKKIVKILPW
                     FDMSRVIFSENLTK"
     gene            <313845..>315722
                     /locus_tag="HG536_0A01650"
                     /db_xref="GeneID:59323445"
     mRNA            <313845..>315722
                     /locus_tag="HG536_0A01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281128.1"
                     /db_xref="GeneID:59323445"
     CDS             313845..315722
                     /locus_tag="HG536_0A01650"
                     /inference="similar to AA sequence:RefSeq:NP_013065.1"
                     /note="ancestral locus Anc_4.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137023.1"
                     /db_xref="GeneID:59323445"
                     /translation="MEADRSEVPQYAADSDSSSDSDSSSESALSSKEVTVNVGVEEYE
                     DDDNEELQDQKKNTFSASENKNCFLIDAEQDAVLVGLSEKQRMYISGVFKLQVVKGGI
                     IYNNVHYNASSEKFNVWHPLCNAVPAIQGSFYAGWEETLPIGDRYRDIVLDELSEYSC
                     VVKIQNGCVKGLMGAAELFPDVRYLWRTPDSRKLGFVSDNCTYSIMREDVDQFNALHI
                     SNEWSTSIEKLTVVHKSSLHDTRIMIIGGKNSGKSTLLRLLTENFLFGGDMQAVDNEI
                     SYLDLDPGQPEYSDPDCISLTCVQRKTRVLGRHLGQPCFEVLRQHYIGSSSPQEMPSS
                     YLECVSDLISYLEELNQMGTSLVNLPGWIKGFGLNIIGHILSRYKPTHIVILESKGSR
                     RHLSDLNLDLTFNSSSRSDYRPVVTTMTGISVNPDDFRFQPPQIRTFKTLSYFHMKER
                     STTSLSYDFSPLLLKPPLQISFGITGIQGFSFPEEFAGLHENDIRTALEGTIVGLYMC
                     VNSFQDSLAIKGAFPILTRRLVKMEFVSLVLVHSVDTDAKLLNVFVPETKLGVLRGNS
                     RTSWLVLRAKSETPFCELYPRNNMFSGARTPYVSFDLRKKHEHVWKVRKNVMRRGHHL
                     K"
     gene            complement(<315815..>318283)
                     /locus_tag="HG536_0A01660"
                     /db_xref="GeneID:59323446"
     mRNA            complement(<315815..>318283)
                     /locus_tag="HG536_0A01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281129.1"
                     /db_xref="GeneID:59323446"
     CDS             complement(315815..318283)
                     /locus_tag="HG536_0A01660"
                     /inference="similar to AA sequence:RefSeq:NP_013066.1"
                     /note="ancestral locus Anc_4.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137024.1"
                     /db_xref="GeneID:59323446"
                     /translation="MAKAASRKLSQWGPLEGKIEGLIYRLLEEKSLDKKRQQADDGEI
                     SNEELDNIFFAKDLVVPEIFTFCQSKDVSMLRVKKVILQKSIERVLKKVMEVEAAEFD
                     SYSSYKDDTVESAAKPDNLVPIEDNNEFNKSITNQWSAKEDKALKKATSAENLEADET
                     SSQPKKRARDTVSVKAKRQKVKENRTPPMTNLESLGGVDDVIAQLMELVGLPILHPEI
                     FESTGVEPPRGVLLHGPPGCGKTSIANALAGQLQVPFIPVSAPSIVSGMSGESEKKLR
                     ELFEEAKSLAPCLVFFDEIDAITPKRDGGAQREMERRIVAQFLTSMDELSMEKTNGKP
                     VIIIGATNRPDSLDSALRRAGRFDREICLNVPNELSRIHILKKMSSHLKIDGTIDFVK
                     LAKLTPGFVGADLKALITASGTCAIKRIFRQYADVAPGADGQMDVDQSLDTSEEEALK
                     NTANMIDPVPLSTIQKFIKNFPEPLSDEQLQSLSINYEDFLKALPTIQPTAKREGFAT
                     VPDVTWANVGALSNIRIELNMAIVQPIKRPELYEKVGISAPAGVLLWGPPGCGKTLLA
                     KAVANESRANFISIKGPELLNKYVGESERAIRQVFTRARASVPCVIFFDELDALVPRR
                     DTSLSESSSRVVNTLLTELDGLNDRRGIFVIGATNRPDMIDPAMLRPGRLDKTLFIEL
                     PNAQEKLDIIKTLTASSGTPLASDVDLEAIVSNERCKNFSGADIAALLREASVLALKR
                     NFFKTEKIHSVMENDLDKEFEDLTVGASEEEVLVTMKDFTTALAKLKPSVSERDRLKY
                     DKLNKKMGWIDEVELQSEDVANNK"
     gene            complement(<318452..>319261)
                     /locus_tag="HG536_0A01670"
                     /db_xref="GeneID:59323447"
     mRNA            complement(<318452..>319261)
                     /locus_tag="HG536_0A01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281130.1"
                     /db_xref="GeneID:59323447"
     CDS             complement(318452..319261)
                     /locus_tag="HG536_0A01670"
                     /inference="similar to AA sequence:RefSeq:NP_011837.2"
                     /note="ancestral locus Anc_4.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137025.1"
                     /db_xref="GeneID:59323447"
                     /translation="MVKSEGSGLLGRSSLLFNFCYIFLAHGVVSGIISGGIEFAIAYG
                     MYYHSSKPVYLWGFPNTLSGDCALTVFIQVGVTWVCEELIVGWDCFQSKTPLLPFEIE
                     LPDEASHGLFWRLFEVKHGIAKDELSLRSYVRKQFIRYPSRSRCFNLFSWLLHKFVIS
                     MIAAAMIWFWVWPVTMGVMAGVGTRVGSHEYKFHGWAPQIMKLIFGFVIGLMCTPLAI
                     IVILLRDKWFLEYKKSAQTGSQEDEKRAPTDAIENSSGDFHTDSTNQDPSA"
     gene            complement(<319629..>321080)
                     /locus_tag="HG536_0A01680"
                     /db_xref="GeneID:59323448"
     mRNA            complement(<319629..>321080)
                     /locus_tag="HG536_0A01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281131.1"
                     /db_xref="GeneID:59323448"
     CDS             complement(319629..321080)
                     /locus_tag="HG536_0A01680"
                     /inference="similar to AA sequence:RefSeq:NP_011836.1"
                     /note="ancestral locus Anc_4.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137026.1"
                     /db_xref="GeneID:59323448"
                     /translation="MVLLKDILNQDSQANVDEKSSDGCSERQLDAPHSDASIDRKKSD
                     NSLPSPTLSASSHMNSNGNVDNDGCYLTATRRSSYDSSTGGHAGTPQSELSSGSEEEH
                     QMCRWDGCGKVFSQAELLYHHLCKDHVGRKSQKNLQLNCKWGDCQAKTEKRDHITSHL
                     RVHIALKPFKCTTCDKNFKRPQDLKKHLKTHIESHIIFKKKRGPKIGAKRVTKKETDR
                     RDPAKSDSASSPLNCSSSPSGQLPISLQQLVTNELPSYEPIYSEKLGARLNAVLQPIA
                     ADDDLPRSAPLATANAAHFFSALSRNMQSVRPAPAAYQEIQKPLINGEPALAAASASR
                     STGTGAGLLAGSLGQYPEMRPLPPIEPQFAHDRSSVLPSLSSAPLLMPRHKTFERAPH
                     FNTPAQYYSSAQRSSGKRDTSDDQGLSDALTSLDITRELNAEEYEETLATVNLMRDYL
                     VCLLLEDEYTDVGESAVTASPRVRISRYPQVVI"
     gene            complement(<321416..>322891)
                     /locus_tag="HG536_0A01690"
                     /db_xref="GeneID:59323449"
     mRNA            complement(<321416..>322891)
                     /locus_tag="HG536_0A01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281132.1"
                     /db_xref="GeneID:59323449"
     CDS             complement(321416..322891)
                     /locus_tag="HG536_0A01690"
                     /inference="similar to AA sequence:RefSeq:NP_011835.1"
                     /note="ancestral locus Anc_4.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137027.1"
                     /db_xref="GeneID:59323449"
                     /translation="MVLVTWVWLMPVVQAVGEKYCSSQNTGSGDGSSWLYQSNGWCSD
                     HCAGSQYAIIQGANCWCSESAPGSVVSLSDCSDPCIGYPAERCGNKDAGLFQYLYLGQ
                     GSPPSFVTSVSSSASSTASFSSGSTSSSSETSSVSTMSSLSSSGSSSTSSSSSTSASS
                     STTTTSSTSTSASSSSTTTTSSTSTSASSSSTTTMSSTSTSSTSSTSSSSTSSTSSSS
                     TSSSSSSSSTSASSSSSSTLIVASSSSSTPATSSSPRPTSPVQTQYSTSVIGFTSVVY
                     SVLTLTQTQTTLDGSSGNFTTQLTHVSQLVTTMTMVVTTSSSSATVVALAPSNVNKSN
                     NSDSNDYWHSPGKVAGTFVAVGVVVLAIILLLLWFFLIRPRKQKRDFEEQYNEAVLSP
                     RRHDQSSGADSVNYGGNRSSSGSQGFVYADEKGIFEPTLRSKRPSFDDDSLDFTTAQP
                     VIMDQRLDPNQVLSEICHSNSKVSLADDIDYSRKVLRVINE"
     gene            <323024..>325234
                     /locus_tag="HG536_0A01700"
                     /db_xref="GeneID:59323450"
     mRNA            <323024..>325234
                     /locus_tag="HG536_0A01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281133.1"
                     /db_xref="GeneID:59323450"
     CDS             323024..325234
                     /locus_tag="HG536_0A01700"
                     /inference="similar to AA sequence:RefSeq:NP_011834.1"
                     /note="ancestral locus Anc_4.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137028.1"
                     /db_xref="GeneID:59323450"
                     /translation="MHIVENNKEASSRQRNSAGKLRALEGQITRLGGASSVVLHGVLS
                     CCTCCQVGTSSILVWFNSAELEVSTQICKALCSIYHGRCCLISGLRWTFLSQRAPRAV
                     ENRLYYPQRALKNSISSDIKYRGTAKVVDVQCRCWFVKMVEKKSSMSSPHHHLKHLKH
                     QQQGRELVETIIELVEQNDHDSLAFIARNCGIPPQLRHVVWPILLKYHPMCISPNIMS
                     NVITWDPHCNSYSVVESQVEPSQEDLEGLILHDLRKYFHSRSNGTVTGYTTSSSDVST
                     VSSMDISMLTAEDESVVLNALKRAILRFLSRWSKIFKYESGLAWIATGLAEWVPVQEL
                     SLGLEGPVVLSGKKHSHSHASSFAHSHNSGAASLSVTPTTGVSQSANVCLCYLYKEYP
                     LPAQLRSKLPSEPVSSFDHTFERLVLVILHCPDTILAQKQTASHLNTKEPHPINYFPV
                     ISGGDISYQTQVFFKVFSTILPELYQPFTEESVLQTSNRRVSWLYWWIKCSGARALQK
                     QDRARLWDILLGWRPEPRMSSINFFLNYNTKKFDHLYKEPSKKHVNFLKSLAKNDPFW
                     FPDLDLIPIGTQKYRFDYEILKEILRRNRYGQNAEDQTSIDEPHDDKIPYSLIDPHIQ
                     LLFVYVAILQYNEFKLLEFEETEISEFLTNVPMLSKADDYCYRKLYDTTNISESSHSS
                     SQEDLHKRPGSSNMLIEVGNDAKASHSFDDLLSMAGDIWRKWLWAELEESSVDE"
     gene            <325370..>326932
                     /locus_tag="HG536_0A01710"
                     /db_xref="GeneID:59323451"
     mRNA            <325370..>326932
                     /locus_tag="HG536_0A01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281134.1"
                     /db_xref="GeneID:59323451"
     CDS             325370..326932
                     /locus_tag="HG536_0A01710"
                     /inference="similar to AA sequence:RefSeq:NP_013064.1"
                     /note="ancestral locus Anc_4.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137029.1"
                     /db_xref="GeneID:59323451"
                     /translation="MFCAISGKPPRFPVLSPRSKCIFEKELIEQYVSDEGKDPVTNSP
                     LTVDELIEISQSPEQSSFADSLNSSTLNTNYSIPNLLSSLQNEWDAIMLENFKLRKQL
                     DESTKKLSVAFYERDAAKIVAAKALKARDDIMREMNHLVSQIGDAEVPESLEHQGAPV
                     SLSLVSSALLERLSQESMSYLKKTKKVASDFSVPALAPFKLEGKWDVDKSLKLHRTTS
                     LCLEFQQSVVFQLQDVSQVCYMKGPLSHRVVGAPFSDKVKYLAAASHDRLLICTADGR
                     MGVSSISGDQMEVANTKIGNIIFMENHEEILNDHFLWADDSGAVGFTTMDCKETILLI
                     AGQQEKQFFQAAYHKDGLLLALVNTREIKIFDLTKPEEHSTDFQIGKEIKADGEIKEV
                     RFSSNGYWMIVHCGNTLMAFDLRKSPGTLALNPFELGSGSTKVLWDLDVSARHLALLK
                     EGNDSHQHALEFFSYQKSKKSWEPADLEVFHLESPNLPHEELNNFLMLYTKEGPAAIL
                     QAREQVLFYVTK"
     gene            <327110..>327883
                     /locus_tag="HG536_0A01720"
                     /db_xref="GeneID:59323452"
     mRNA            <327110..>327883
                     /locus_tag="HG536_0A01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281135.1"
                     /db_xref="GeneID:59323452"
     CDS             327110..327883
                     /locus_tag="HG536_0A01720"
                     /inference="similar to AA sequence:RefSeq:NP_013062.1"
                     /note="ancestral locus Anc_4.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137030.1"
                     /db_xref="GeneID:59323452"
                     /translation="MPLLDSVKSFVQSTTELKVRQATDESENSGATGTLMNEISVLTY
                     SPKTLKEIVQVIRKRLTGNGRKTSHKNCIHLVKTLTLISYLMNNGSNEFIAWVRSSIF
                     IIECLRNFQTEDRADEKICKQIRLISNDLCMLIRDDTLLEQRRKEVGVFRSSISSPGR
                     KSTDNSHLKKWSSNASANSEGAKSNLSMSPITPTTINEYQYSSNTTKYYQRGMTSLDL
                     KRRLVNKNSSEHNPLGPLREEDDAHTPSVSITASNNPFR"
     gene            <328157..>329074
                     /locus_tag="HG536_0A01730"
                     /db_xref="GeneID:59323453"
     mRNA            <328157..>329074
                     /locus_tag="HG536_0A01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281136.1"
                     /db_xref="GeneID:59323453"
     CDS             328157..329074
                     /locus_tag="HG536_0A01730"
                     /inference="similar to AA sequence:RefSeq:NP_013061.1"
                     /note="ancestral locus Anc_4.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137031.1"
                     /db_xref="GeneID:59323453"
                     /translation="MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI
                     FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
                     KSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTL
                     TGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKEST
                     LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGK
                     QLEDGRTLSDYNIQKESTLHLVLRLRGGF"
     gene            complement(<329153..>334717)
                     /locus_tag="HG536_0A01740"
                     /db_xref="GeneID:59323454"
     mRNA            complement(<329153..>334717)
                     /locus_tag="HG536_0A01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281137.1"
                     /db_xref="GeneID:59323454"
     CDS             complement(329153..334717)
                     /locus_tag="HG536_0A01740"
                     /inference="similar to AA sequence:RefSeq:NP_011833.1"
                     /note="ancestral locus Anc_4.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137032.1"
                     /db_xref="GeneID:59323454"
                     /translation="MSSSQVSEAKERDLVEKVELRLALADSAEKLEKSLDTFVTPLLL
                     KLASPHASVRQAVFNVLKDVLARLNSLKEVKVPVRKLIEQAQRPAVPPEQDDSNVSNV
                     RLYSLLLASKGIDRLDAEELRLLVPLIMSGISQLPRIAAARMFHILCKTLLRWTPPLK
                     GSKEEDETREFLRLDDEEDLKFLLEKFIQFLLLVPARPDARSGIIPRGYSCPGLSSDD
                     VSFLTYEAGVSFTREQALRFKCAVFKFVNSGFVPEDKLLTKFLLVASADPSEISESAQ
                     QGLKRIYIPYEDADFIESIITLYAGDKRRGSPPAKQELQERILRILTRSVLATSKADH
                     VAAIISIGMHSESYKLRALCLIFIRHVAKHNYRSLAGQQENNIGIAPLLRNNLHDEGW
                     PRLQLGQSSSISSASIDRRRLQYETLGDILKRDFDLLLDLSYIEFLLDSLKSDLPEFR
                     ASIQEALVSLTPSLHQLPDTTREKLRLLIRKIMMDESEEDAEDDKGKKEGIMACKYVC
                     IKYCNAAFPFNDTKARMLNVWGTWRGNKFDVIEESYKGLNPYWFRKNQALNTTEFKST
                     ADLLATEIRQSPLPSFQEFVCLMLDELDYASDKQSTIMFRTLNVAVSFSKQCLISQAI
                     HDRKTMIVQDEDWSVRIEKALAIDENVRSSVLDLLSRIEDNWLLKFFSRLCAEFTIKN
                     ELDNQVSLFTYNDVVFGETLLGLIRFCSRHVLSALLFLIPQLMKYLQSSETNTHENLR
                     IAANTLGIIAASVPESEIVQKILETVEISAVDQRLPSLLAKCYIVPRIALAKRFDYPS
                     NIINTVVGNLSAFLQNSRHKIAAINLLAQMMKYGTLRCLDLKTRCDFLSEVSDILEPN
                     LMKNAETIELWGYLSMYAEDDRTFELQLDRIWETHVSKQVDLLFSAGEALAIMAGGWR
                     SKILHQQLDLSFVPLSWLEVIYCSKRVPMVLDRVLRDCGSTKPSLRRASCIWLLSLVQ
                     YLSSEQTLKERSADIHSKFMKFLADRDEFIQESAARGLGLVYEMGDGDLKEEMVKGLL
                     KSFTDNKEAMNMAAGSVSGETELFEEGALNTDGGSVRTYKDILNLASDVGDPSLVYKF
                     MSLSKSSSLWSSKKGVSFGLGAIMSKSSLQNLLLQDRNFALRLIPKLYIYRFDPYTAV
                     ARSMNDIWNSLVSDSATVTSHYFDNILREALSGMANKEWRVREASALALLQLVQMQPN
                     KKFAQNLLEIWTLAFRAMDDIKESVREAGTKLTTVLSKILARSINVKDGIKSEDAESI
                     LSQLLPFFLGPKGLNNDAEEVQHFAMKTLLELIENSGDAMKPFAINLVYDLTLLFSSI
                     EPQAINYLSLNANNFNVDAKAIDYLRRSGVGKSPLMNAIEKLINESDETLMDGHVAGA
                     IKAAKNAVGLPSKVAVSLVFNLLVKKYSLSLKPLAGKLLKSCITSFEGRNPSVKAAFA
                     VTFGHVFRVTTLDKAVKYSKQLENIYFAGDTDSKVIVATAIESVLKHAPSEFENVASI
                     IMPLLFLASNDADKEVSSHCENIWTEASTQGSGSVMLYLDEILDLLNNHIESNDFSVR
                     KTCGQSISVLCGKVDRSMSEKHIKKLFDITVHSLSGRSWEGKEIILDSLQTLASKFRD
                     HIAKDVQLRERLNEVFYTEISRKNMAYVSNAFFPTGDFIFNFPNERLIKKIIDIAGIL
                     LARSSGNGTETDTDEGQSSKRVKADSEISRRSSKQNIEDEVQHIKILKKCSKICKLSE
                     EDGLYPFNLLNFIIEHTTDAFNNKSVLYTWRTQVAAAEIGIELTQHLTTSIVSSDVKQ
                     LMLRFWSQLFLYNGTKETIENAQLPTIKFGDILRRRIPDLKQQIDADLRSLGDINPTS
                     RIELELQKIGIY"
     gene            <334945..>344262
                     /locus_tag="HG536_0A01750"
                     /db_xref="GeneID:59323455"
     mRNA            <334945..>344262
                     /locus_tag="HG536_0A01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281138.1"
                     /db_xref="GeneID:59323455"
     CDS             334945..344262
                     /locus_tag="HG536_0A01750"
                     /inference="similar to AA sequence:RefSeq:NP_013060.1"
                     /note="ancestral locus Anc_4.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137033.1"
                     /db_xref="GeneID:59323455"
                     /translation="MLESLAATLLNRILGSYVENFDPTQLNLGIWSGNVRLTNLKLRK
                     DSLDGLSLPVDVKFGVLGELLLTVPWSSLKNKPVKISIEDCYLLCTPRDNASMHSEEQ
                     IERDLRVKLHKLAEWELANQARSAAENPNGQGNENESFMQSLMTKIVDNLQVTIKNIH
                     VRYEDMSQVLSKGPCSIGITLSELSAVSTDAGWTPSFISMTQDVTHKLVTLNSLCLYW
                     NTKAVTIEEEDDILDHDILISKFKNAVATGGKAIPSFQYILKPVTGSGRLSVNKLGST
                     PERPHIELNVLFDELGFELDDSEYADILHTISSLHLSQKTQKFKKKRPDYSTNENPSG
                     WFKYVASCVLDEIHEKNEAWTWDHIKQRCEQRRLYIQLWMKKLQQGNIDQKLPSQEDE
                     KKLDELHRVLDFDSLILFRSVAKKEYAKKRLTTRDAASSIPQQQTSGPGGWLSSWWGG
                     GKDTNNKAEDLLLTDEQRQELYDAIEFDESNEIETQIPKDRTTVKITGLLKKGAFTIK
                     NRAHCTQLGEIIFQNCELEFLQRTGSFLASFKLHEFKIEDGSPNTLYKHIVSVKNIKS
                     DDLVDAEGNPEPLLKALFESNPLDESADSKVDITLRGMTIFYHVHFINEIIHFFNPPK
                     QHMETITAIINAAEATVEGWTTQTRMGLESLLEEHKTANITLDLQAPLIIIPLDPHVW
                     DTPCAVIDAGHIALVSDLVPKQRIEQIRQMSPEEYDKIDDLELKGLMFDRFQLYLQDT
                     QILVGPDVRSTISSLNGSAEGVQYSILSGLLLELTLDISILPRAYNLPRAKAFGHLQK
                     LDLSLNDYQYKVIMQLLEKSIPNFTDFESDIDFKEQYATMGNEDKKLQIQLKNTMQAL
                     EKMTPAQIAQKLFQLQFEVDSIQISLYKCLDNGSMSCKKLLDFLGDKVKLILVKKAKE
                     IEMKLNVHSVSVMDFIEQTNNDEFRYLISSGAAEPDKEKDLFTVDYNRKQRIVLHDDL
                     HIEVFDQDVNINMEQLRVVLTPKSILTLMNFALTTFTDPSTPEVPADVLRHNRENRED
                     APQKINLAVDMAGIVIIFNDDSLKLATLVLSAGEFTMFLLPEKMKVNMRLGGLELTDE
                     VSGGLPRDSIFRRVITMSDAELAELTYETFDPANNPNNYDSVLKYTTGSLHINFIEHS
                     INKLVNFFYKLQKLKKLFDKARELAYDQAPSIESVNNLKMDILIKAPIIEFPKLIDPR
                     NDIYDSMKFYLGEFFIQNEFHDLADSHKVNHIKLGLREGQLLSNFSLENGDHQLLHMI
                     DNMCLTFDVEHDQMAALTYPEFKIKGYFDPLKTSLTELQLRYLVSISEKVTAAFDITE
                     PTSEELGGDEIYADTFGESAVASTNLGSPSPVDVESDQKQLEGLKLDFQFEAPEVSLT
                     LFNDTAKATKLDKKGLTVLTFHDLALKAKYNNDGTGEAESHIATFAVVDIRDKKDNKH
                     TELIPKVVNENYQFMSSITAKNLSEGKLINLSVTIDSPQIILAMDYLFALQHFCDLAF
                     TSQSAQVEIDTPGYGDLNAAPTNMGTLGSETKLHYSLNVVNAAVILLADPSDLKSEAV
                     VFNVGQFLLSDQNITALSANNVGMSFVRMNSDSEQRVRLLDEFSSSIVIDKRNSTPER
                     LLTNVQVSVEPLILSISLRDIRLAMLIFNRLMSQMSDGSNAASANDEVSTYGAFSKEF
                     EKKLSRYAPSFVSSLNASSHHDVRRATQVDIVTRGEKLEADFGGLRLLLIGDVHELPI
                     LDMNVNPFQASAKNWSTDIDALATLETYVNVFNYSRSSWEPLIEEFPISFHLSKGSER
                     DALIRFDAVSRKVAELTLSSRTIAMLSQIPSTLTGDINISSRGAQKPYRIINDTEFDL
                     EIWIATDDGEERRGFTTLKARGTIPWEFEDWRTVREKLDVDSKGCNLAAVVAGSNYKT
                     TMKIDATQEGEFLFVLQPAVNHVHNRLTCELQLGDDNVKVITFRSTLVMENATSIPVL
                     LKVESHDLEPVISAIDPSKTHSVPVSYSYDSKLRIKPSTEEDYDWSEQVISWRDLLKS
                     SLSVECRSISDPNRKFYLEVNGKFDAKEPLAKIYPRMKIIVSPPLVIENLLSSDLKFT
                     LYDKRQEHRNLTLLKKSSRVPIHDVSLDNFLLLSIQPLVDDAPLSKPSIVNTAARSSL
                     KPETQITTKLAGVQTFRAALHYQTVEGTRAKILKISAPYIIFNRTDKDLYIQGDRTNI
                     AQIKVQTSGSQHYTAPKMFSFETDGHNKNRASIRFKESDWSLPLSFDAIGQSLDAVVN
                     IPNKEQESNLGVTISEGEGQYVFSKIVEIAPRYIIHNCLNLPIEICELGSTNVSQLDA
                     DHTKPLYKMRNIVNKQLMIKFLGVNCDWSAPFFIKDIGLTYLKVLKQDSTHMLLKVEI
                     ILENATVFIRLKDANNRWPYSIRNFSDQEFIFYQRDPRVIDDYYDYDSFDELDEIEYK
                     PLYYRLPPKSVMPYAWDYPAARQKKIVITARGLRREIQLAEIGNLKPMRLPAKLANED
                     TITVDLNVVADGPTQALVITKYNPAVSLYKLRSKKTSSSLSVNSSADGFEAEEEDKNF
                     QKKIMVSLKGVGISLINASLQEILYVYANGLELRYNESDLYQTFSWKLKWVQIDNQLF
                     SSPFENVMYPATVLNTAQEVENHPVISGSISKVKDDSHGLKYFKHATLLLQELSIQLD
                     EELLISLLDFGKFPGAVWNKYATQTHYSDTITLPECKDIKFAEDMYFEIFHVQPMLLH
                     ISFVRSDQHNFLESEQNRLGLESGGAILFLIDMLTMTLANVNDAPIKLNSLYMANVRV
                     PIDTLLQAVQTHYGQQFFYQIHKILGSADFLGNPVGLFNTISSGVWDIFYEPYQGYMM
                     NDRPQELGIHLAKGGLSFAKKTVFGLSDSMAKFTGSMAKGLSFTQDQEFQEKRRLQQR
                     MNANRRSLISSSAQTFVNTVGSGFTGMALDPMNGAQKEGAAGFIKGLGKGLFGLPTKT
                     AIGFLDLTSNLSQGVKSTASALDGPSSMRVRLPRYVDYHEKIIRPFNLMDAQGQYWLK
                     SLDGGLFMNDNYLTHVVLPGRELAVLVSMEHIIEMNIASQETMWVTDYYGIQGIILQR
                     GGIHIRLKSKSEYFIPISDTQERKHMYKHIAIAVTEFNKYCEATL"
     gene            <344503..>345291
                     /locus_tag="HG536_0A01760"
                     /db_xref="GeneID:59323456"
     mRNA            <344503..>345291
                     /locus_tag="HG536_0A01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281139.1"
                     /db_xref="GeneID:59323456"
     CDS             344503..345291
                     /locus_tag="HG536_0A01760"
                     /inference="similar to AA sequence:RefSeq:NP_013059.1"
                     /note="ancestral locus Anc_4.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137034.1"
                     /db_xref="GeneID:59323456"
                     /translation="MMMSGVLTKSVAGNICRRGLATAGAAPRLKTFKVYRWNPDKPAE
                     KPRLQSYQVDLDDCGPMVLDALLKIKDQQDSTLTLRRSCREGICGSCAMNIGGRNTLA
                     CLCKIDQDHTKDLKIYPLPHMYIVKDLVPDLTNFYQQYKSIQPYLQRSTFPADGKEVL
                     QSVEDRKKLDGLYECILCACCSTSCPSYWWNQEQYLGPAVLMQAYRWLIDSRDEASAV
                     RKSMLQNSMSLYRCHTIMNCTRTCPKGLNPGYAIAEIKKAMATD"
     gene            <345388..>346017
                     /locus_tag="HG536_0A01770"
                     /db_xref="GeneID:59323457"
     mRNA            <345388..>346017
                     /locus_tag="HG536_0A01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281140.1"
                     /db_xref="GeneID:59323457"
     CDS             345388..346017
                     /locus_tag="HG536_0A01770"
                     /inference="similar to AA sequence:RefSeq:NP_013058.1"
                     /note="ancestral locus Anc_4.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137035.1"
                     /db_xref="GeneID:59323457"
                     /translation="MHYDYSLPLACALCEGGVVLTFCSIYINLLALLRRTSCNTCSRR
                     RRMLTYDEYSAQLRRLCDSALKNSDLVTSIQPSLADGAVLFRTALPSSIAYSTLLCCI
                     EFKICYSHAYQEPRLLFRLWRRAASQEEGIDFLAPWFPTDVAQVLGIDRGFTVSLDAL
                     FSNSSRSQETWFAFHPCDTAEIVGDKLDFKDDYLSRWLSIFLFSWLAKS"
     gene            <346076..>346756
                     /locus_tag="HG536_0A01780"
                     /db_xref="GeneID:59323458"
     mRNA            <346076..>346756
                     /locus_tag="HG536_0A01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281141.1"
                     /db_xref="GeneID:59323458"
     CDS             346076..346756
                     /locus_tag="HG536_0A01780"
                     /inference="similar to AA sequence:RefSeq:NP_011832.1"
                     /note="ancestral locus Anc_4.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137036.1"
                     /db_xref="GeneID:59323458"
                     /translation="MSNTQSFVTVRSQIISLESQTDSLLSRYSSFAQTTSSEPTGKEK
                     NLDKLLEEKLTKRQDVLETLTHICDENPNISASKLSQVQRHKEVLQEHWKNFRSIRSS
                     IQQERNRLNLLFNVKNDIAQQQEALEAAANPGSNEDEYFQNETRRVDQSHNILDRLIT
                     QAWETRDQFSGQSGVLRSANDRVLQTLQRVPGINQVITKIGVRRRKNAIILATVIVIC
                     VLILFFTW"
     gene            complement(<346796..>348847)
                     /locus_tag="HG536_0A01790"
                     /db_xref="GeneID:59323459"
     mRNA            complement(<346796..>348847)
                     /locus_tag="HG536_0A01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281142.1"
                     /db_xref="GeneID:59323459"
     CDS             complement(346796..348847)
                     /locus_tag="HG536_0A01790"
                     /inference="similar to AA sequence:RefSeq:NP_013057.1"
                     /note="ancestral locus Anc_4.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137037.1"
                     /db_xref="GeneID:59323459"
                     /translation="MGRLSVSSKDSDHSKKDRAPKSANADTDGRKDNPQKALNDFLAD
                     PQAFPDSKRYHDGLHETDFMEGRSRSSSRHTRKSSDGNEGDEYDYEMQDYWPQPITSR
                     GRSKTSYIPQYTISNASQFQIHEVVPNTQMAISSSTDTTGGVNGSLPGTENARSELRP
                     RGQTVSSNLLHLGDIFKNNEDTNSHNASTSGPRSRHGSESHRSNVENSYAAQDVESDP
                     RNVPMMVKPKTLYQNPQTPTVLPSTYHPINKWSTVKHSYLKEFLAEFMGTMVMVFLGS
                     AVVCQVVAAGKIQQNQFNEALADLNNVPEDLVATTRTLTNIVSSVSGGTFDDIAFGWA
                     GAVVMGYFCAGGSAISGAHLNPSITLSNFIFRGFPAKKIPYYFIGQLAGGFAGALTLF
                     IFYKKVIQEAYDEWWKAESVASMFCVFPKPYLSSSRQFVSEFICTAVLQASTFALTDP
                     YTCLSSDIFPLLLFVQIYVINASMSYQTGAAMNMARDLGPRLALYAIGFDRTMLWVAH
                     RHFFWVPMVAPFLGSMTGALIYDVCIYQGHESPVNWPLSVYKDMILRAWFRRPGWKKR
                     NRGRATSDLSDFSYEDDDDDNQEQHSANPLTTPRTRTLSSASDIEEPRQKAVQFKSVQ
                     GRGKRYYGGVPTILEDEDSIATASLGDATSDSVVLSDASSSLDDHDIKTSDQHAYRKK
                     K"
     gene            <350491..>352578
                     /locus_tag="HG536_0A01800"
                     /db_xref="GeneID:59323460"
     mRNA            <350491..>352578
                     /locus_tag="HG536_0A01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281143.1"
                     /db_xref="GeneID:59323460"
     CDS             350491..352578
                     /locus_tag="HG536_0A01800"
                     /inference="similar to AA sequence:RefSeq:NP_011831.1"
                     /note="ancestral locus Anc_4.9"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137038.1"
                     /db_xref="GeneID:59323460"
                     /translation="MLGRCIQIHFPTRSIRLLRKLTVWKRPNYTVKSQYSLRNMTADE
                     NSKITVNEIIPLIAAIDVGTTSSRAILFNRLGQEVAKHQIEYSTSASKEKYAASGKRR
                     FAVDDENQPIFSAEGIAIEQNEFLEIEDLIKRTGDPTLRFPKPGWVECKPLNILNNVV
                     ECFAKTLAFAQQVNSQRIPDGLPPYRIHCIGIASMRETTLVWSKSTGLPIVEYGIVWN
                     DTRNAGIVTEKRNNTCEEEQARLRNKTGLPLYSTYFSCSKLRWLLDNEPKVTEAYEKG
                     DLMFGTVDAWLIYHLTSSKTFVSDVTNASRTGFMNLDTLDYDEELLEYWGIDRKKIHL
                     PKIVSSAEYYGDFCVPQVTKEHISPQDWELLEEFSNRNPRVPIQGSLGDQSASLVGQL
                     AFKPGSAKCTYGTGCFLLYNTGSTKLISHHGALTTFGYWFPYLEDEEARKPHFALEGS
                     VAVAGAVVQWLRDNLRLIPKAEDIGPLASRVPDSGGVVFVPAFSGLFAPYWDPEARAT
                     IMGMSQFTTASHIARAAVEGVCFQARAILKAMSSDALGVKDKDFLEEISDETYEKSIL
                     STLAVDGGMSRSDEVMQIQANILGPCIKVRRSPTHECTALGAAIAAEMAFKDPKDRLM
                     WKDLRDVKKFVFYNGVEKGQQCPLELKPDLKIFISESKNSERRKKWKIWEEAVKRSRG
                     WLSSINSIDEADN"
     gene            <352850..>353617
                     /locus_tag="HG536_0A01810"
                     /db_xref="GeneID:59323461"
     mRNA            <352850..>353617
                     /locus_tag="HG536_0A01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281144.1"
                     /db_xref="GeneID:59323461"
     CDS             352850..353617
                     /locus_tag="HG536_0A01810"
                     /inference="similar to AA sequence:RefSeq:NP_011830.1"
                     /note="ancestral locus Anc_4.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137039.1"
                     /db_xref="GeneID:59323461"
                     /translation="MAPVKKVAPAPFASKASKSSKPKNPLTHASPKSFGIGQDIQPKR
                     NLSRYVKWPEYVRLQRQKKILSIRLKVPPAIAQFQYTLDRNSAAETFKLFNKYRPETA
                     AEKKERLTKEAAAIAEGKTRQEASPKPYAVKYGLNHVVSLVENKKAKLVLIANDVDPI
                     ELVVFLPALCKKMGVPYAIVKGKARLGTLVNQKTSAVAALTEVREEDEAALAKIISTV
                     NANFADKYDEVKKHWGGGIMGNKAQAKLAKRAKAASA"
     gene            <354324..>355133
                     /locus_tag="HG536_0A01820"
                     /db_xref="GeneID:59323462"
     mRNA            <354324..>355133
                     /locus_tag="HG536_0A01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281145.1"
                     /db_xref="GeneID:59323462"
     CDS             354324..355133
                     /locus_tag="HG536_0A01820"
                     /inference="similar to AA sequence:RefSeq:NP_011829.1"
                     /note="ancestral locus Anc_4.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137040.1"
                     /db_xref="GeneID:59323462"
                     /translation="MSVEETKPVEASTVTVVDPETTIFVGNVARDCSEEDLKKVFEGE
                     FGSVEVEIPSKTKDGRTFYNRYAFVKFPQKIDVEAIKQKYDKQVVKDKGIYIRKALTQ
                     EERDAERQERMRNRRGNGRGGRAGAKFTNNRGAAVPAPPRKDKTPLEEMERSNDTLYV
                     NNIPYSATKEELAEFFGTKPELVVLPMRRMKDTKTQRVFFSKKMNRGIAFITFENLTG
                     TQDINKMVEEFQGKTLQERPIVVDVAALRAPREEPGEAAPTEEAAQTPTQD"
     gene            <355367..>360295
                     /locus_tag="HG536_0A01830"
                     /db_xref="GeneID:59323463"
     mRNA            <355367..>360295
                     /locus_tag="HG536_0A01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281146.1"
                     /db_xref="GeneID:59323463"
     CDS             355367..360295
                     /locus_tag="HG536_0A01830"
                     /inference="similar to AA sequence:RefSeq:NP_011828.1"
                     /note="ancestral locus Anc_4.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137041.1"
                     /db_xref="GeneID:59323463"
                     /translation="MHSANGFSGDHCRFWIYDDVTKCGRVLYINYYLPLCLTGSAVLF
                     LLYNVWSHYYYYDKLHLKKPSLVDEILCDGNDDEEDKPLISNLNGHRYTDGRESPTGE
                     QLMENHFSIEKLKCVKTNGEPHGKPEFVKRGFVEKSRTIVEFLLVLAQFVFHCFVYIN
                     YSKRYSEFPVQSSAMGVLQWGFLLAIVSLRLININQSIHWINKYPGNIWAISFVSYLF
                     LFVSNLLPFRSVYIGHIKNKLVRNYYLSQTYIDLILFLLLFFSSSGNKYPVIYKTDDE
                     IIPSPEPVSSIASFISWSWLDRFIWTAHKSTIENKDVWGLSLEDYSIFVVKKFKHYTK
                     RFGKKRSFAVNLLSFFTKYIALQGFWACIESILSFIPTLLLKRILEYVEDRKSAPANL
                     AWFYVFCMFFCRVFVAICQGQALFFGRRVCIRMKAIIISEIYTKALKRKISVNSGKQS
                     TDDIDPQKLNDQERIDGDEESSSSANLGAIINLMAVDAFKVSEICAYLHAFVEATVMA
                     LVAIILLYHLLGIAAILGAVLIIVMMPLNFKLATLLGKLQKENLSVTDKRIQKLNEAF
                     QAIRIIKFFSWEENFEKDIDDIRETELKLLLKRSLVWAMSSFVWYITPTIVTSAAFWF
                     YIYIQGEVLTTPIAFTALSLFSLLRTPLDQLSDMLSFVIQSKVSLDRVQEFLEEDDTQ
                     KYSQLNVAQDRKKIGFENATVTWDKDRPDFKLKNLNIEFKLGKLNVIIGPTGSGKTSL
                     LMALLGEMHLMSGKITVPSLDPRQQLAVEADGMTNSIAYCSQAAWLLNDTVRNNILFN
                     SPYNETRYEAVVEACGLKRDFAILSAGDMTEIGERGITLSGGQKQRISLARSLYSNAR
                     HVLLDDCLSAVDSHTAAWIYDNCITGPLMEGRTCILVSHNTALTLKNADLIVILENGQ
                     VKDQGEPLTLLQNGLLGEDELVKSSILSRHNSSVNLKSKSELSMKNLSKAKETAKPQR
                     TDEERAKQGKLVEEETKAQGTVGIGVYKWYLAIFGGWKMLSVLVAAFVIAQSISIGQT
                     WWVRSWVSHNITSKLIGLAQNITVSASAVFSRMGIITSSFIFPHHDVDENTSTKLHST
                     VYYLTIYFLIGVIQSILSAFKTVLSFVAGINASRKIFKRLLTRVMHAKLRFFDATPIG
                     RIMNRFSKDMEAADQELTPFIEGAFYSLVSCVSTVVLITFITPQFLSVAILVAVLYYL
                     VGYFYLTGSRELKRLESISRSPIYQHFSETLVGVTTIRAFGDESRFMRENLQKIDENN
                     KPFFYLWVANRWLSFRIDLIGALVVLGSGIFILLNIDHMDSGKAGISLTYAITFTEGA
                     LWLVRLYSNVEMNMNSVERLKEYMEVDQEPYDQSTVTPAAEWPQQGRIEVNDVSLRYA
                     PNLPKVIKNISFTVDPKSKVGIVGRTGAGKSTIITALFRFLDPETGNIKIDNVDITSV
                     DLQRLRRSITIIPQDPTLFTGTIKSNLDPYDEYPDQQIFEALKRVNLVTQEELDRPAE
                     GASSSVNSDNVNKFLNLYSEISEGGGNISQGQRQLVCLARSLLRSPKVILLDEATASI
                     DYASDAKIQQTIRKEFSGNTILTIAHRLRSVIDYDKILVMDAGEVKEFDHPYSLLLNK
                     NSIFYSMCEQSGELESLIESAKEAFVEKLNAK"
     gene            complement(<360412..>362046)
                     /locus_tag="HG536_0A01840"
                     /db_xref="GeneID:59323464"
     mRNA            complement(<360412..>362046)
                     /locus_tag="HG536_0A01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281147.1"
                     /db_xref="GeneID:59323464"
     CDS             complement(360412..362046)
                     /locus_tag="HG536_0A01840"
                     /inference="similar to AA sequence:RefSeq:NP_011827.1"
                     /note="ancestral locus Anc_4.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137042.1"
                     /db_xref="GeneID:59323464"
                     /translation="MMLKSERDVLIPKDGGKVDLENGKTADDVGYGSFSSMETEIDKS
                     GILIDAFIEVPQGRHLGLFSTMVLFVSRIVGSGIFATPSSIFVNCGGNTVIYFGVWLL
                     AALLSFAGLFLFLEFGSWLPRSGGRKNFLEQAYTKPRLMMSVTFAAFTVLTGFTMSNA
                     IVFGKYFLSAVGFQGISDHSSVSKYISIAAVVVGVIIHGTSVKTGVRIQNFLGGMKFL
                     LIAIMCLLGFYSIFYRPEAGEKTISSAPIYEFHDEGTLQVSSLAAAFINAFFCFTGWD
                     SVHAVASEIKNPVRTLKIAGPLSLFICFLCYTMMNLAYINVLTYEEIKQAGPLVGSVL
                     FAKLFGPHLGARILSLSVAISTGSNILVVLYGVSRMNQEVFREGYLPFSIHLASNKPW
                     NSPLPALLVCGILSVTWLTILPSEGASYDYLVSMEGYGNQFFLLLIAVGIFIYRRKRK
                     GEVPSTRASSIGVCAIILVSIYLMAAPFFGKQASNNIAILPPYQVTALMLILLCFAFW
                     FVKFLFLPKVLGYELKQRIVTLDDGLAVTKWIKCDL"
     gene            <362670..>364493
                     /locus_tag="HG536_0A01850"
                     /db_xref="GeneID:59323465"
     mRNA            <362670..>364493
                     /locus_tag="HG536_0A01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281148.1"
                     /db_xref="GeneID:59323465"
     CDS             362670..364493
                     /locus_tag="HG536_0A01850"
                     /inference="similar to AA sequence:RefSeq:NP_011825.1"
                     /note="ancestral locus Anc_4.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137043.1"
                     /db_xref="GeneID:59323465"
                     /translation="MKYVTLQGSWRALFFGTFRRQPSSKNYRYKYVASKIKKLVLDTH
                     TKGLTNAKSELMVIRCDRQLFTSSIHKLREVILKDISGPPEACIKILQTGRTLRRDWG
                     PTGVLSWQNIAPIFAHPLNPICATEGGDPSFEYRNTLRLSSKDDREELLHVRWADLTY
                     SNSCRGVGVTKEKFSGLGKDVEFVNPANGNLLRVYQVDEVPEGCDAIALFPAYVPSQR
                     RYFTGLELCAALIRQSPCTREEQSKLEAHISSSLKNQNDTAVTPVAEHPLDETCFVTL
                     KQLMDATNKCKPLWSSGRDKDKTCPGDVIRCSLVSEKVDFSQLVEEYCKHYILFSLVS
                     QALRMSRTVDQSASYESHKLEFSPMDTFVWQELQRINEIAPPTTVSELIGYKKQIDEF
                     LELLSSYYFSIVSEMKASSRTYFRDGINVPRAVPVLRVLLEVVCNCKGFKIFYPNLSL
                     YATKVLPEMPKLGEAKETVVANEEANLTLGSKVLAMFKHIAQFENMMFYDKFSIATGL
                     EIEPITSLKSWKIVIVSKSPLPVEIERALLFSSRVYTQCVRDLEHATLLQHATCEARR
                     MIDEDTFMFLYRLQRPPKVDREQLANAIIEKLDEASKTYHT"
     gene            complement(<364484..>365023)
                     /locus_tag="HG536_0A01860"
                     /db_xref="GeneID:59323466"
     mRNA            complement(<364484..>365023)
                     /locus_tag="HG536_0A01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281149.1"
                     /db_xref="GeneID:59323466"
     CDS             complement(364484..365023)
                     /locus_tag="HG536_0A01860"
                     /inference="similar to AA sequence:RefSeq:NP_013051.1"
                     /note="ancestral locus Anc_4.3"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137044.1"
                     /db_xref="GeneID:59323466"
                     /translation="MEASEMLEGLCERVERLEVVLGEVGPLSDDDLCEKVASVTRELQ
                     RVFREGQEYSEHLLQLLEIYALGDHERGEDHEVKLQAILSRYDEIFRSLKELRKLDVA
                     YQELSKQEMDSRIPVVEIGKVQQLPALMEACNRQLVRSLSLVQRFASWNVQTNELFCE
                     LNNRLKMLERDIDSMSDYV"
     gene            <365234..>365751
                     /locus_tag="HG536_0A01870"
                     /db_xref="GeneID:59323467"
     mRNA            join(<365234..365247,365334..>365751)
                     /locus_tag="HG536_0A01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281150.1"
                     /db_xref="GeneID:59323467"
     CDS             join(365234..365247,365334..365751)
                     /locus_tag="HG536_0A01870"
                     /inference="similar to AA sequence:RefSeq:NP_013050.1"
                     /note="ancestral locus Anc_4.2"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137045.1"
                     /db_xref="GeneID:59323467"
                     /translation="MSRSGVAVADESLQAFNDLKLGKKYKFVLFALNDSKTSIVVKET
                     STDQSYDAFLEKLPENDCLYAIYDFEYEINGNEGKRSKIVFYTWSPDTAPVRSKMVYA
                     SSKDALRRALNGVSTDIQGTDFAEVSYETVLEKVSRSAGSH"
     gene            complement(<365852..>367576)
                     /locus_tag="HG536_0A01880"
                     /db_xref="GeneID:59323468"
     mRNA            complement(<365852..>367576)
                     /locus_tag="HG536_0A01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281151.1"
                     /db_xref="GeneID:59323468"
     CDS             complement(365852..367576)
                     /locus_tag="HG536_0A01880"
                     /inference="similar to AA sequence:RefSeq:NP_011824.1"
                     /note="ancestral locus Anc_4.1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137046.1"
                     /db_xref="GeneID:59323468"
                     /translation="MPSEDQLQKFIEFCRKNGANLDERISFKITRSAGVTAVATSAIH
                     TQDPLISVPEKLLITRELAEKEFGVNSATVSSGNSNALLQLYIAKMKFEPSAKPFHKP
                     YFDILPDTLNQPYFWSLKELELLKGTDLYLLLKENLRRIIREWWKLLHKLQIDAVDKE
                     IYEGLESSEDFDVLRYVCDYREKHQSFSWKSFAGYLWATGIFTSRAFPRLVIDKACSD
                     LNEAFLYPVVDLLNHKNDTQVKWTFEHEKVCFITSETLKEGDEVFNNYGDKSNEDLLL
                     CYGFLQESNRYDRTRLTLRLDSETIEQALASNLGMTKENVIADDCAQFLITAQDPLPN
                     AVANFFGYLCKLKSEAEVSLRSFLEGQDELSSILVQKLDFFKVRSKFSPADREGCNPD
                     VIQMIKKYMSSERKLIQGSLEYLQKRQKDILKSNSALMVSFKSIFKMDRKFADSLLLS
                     FGVVKYEDLVAKNRLRESLLLWIVRAANKDSYPQKFQYTVPEFIFDTFQEVSGSIVIE
                     KNDVAEFMEFYKNLFPGLTEKIPEVFGPGNWGIRQFIVADTVMDRVVYTRKLTHEPYF
                     IVRVPFKL"
     gene            complement(<368163..>369599)
                     /locus_tag="HG536_0A01890"
                     /db_xref="GeneID:59323469"
     mRNA            complement(<368163..>369599)
                     /locus_tag="HG536_0A01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281152.1"
                     /db_xref="GeneID:59323469"
     CDS             complement(368163..369599)
                     /locus_tag="HG536_0A01890"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137047.1"
                     /db_xref="GeneID:59323469"
                     /translation="MKFVQLAAAAAVVGSGSLVSGAQVESSSASVSRTPRTYSTINPK
                     ASDIAKAASNATTNHFTSSVKGAAFDRMVVIWLENTDYDKAAGQEDMQWLASQGILLD
                     NYWGVTHPSEPNYVASVGGDYFALDDDRFIALPANVSTVVDLLDSKSISWGEYEEHMP
                     YSGFQGFNYSNQETFANDYVRKHNPLIIFDSVAQNQTRLGNIKNFTMFEKDLADKTLP
                     QFFHITPNMTNDGHDSTIKVAANWSRSFLTPLLQNEYFTNNTLIVLTFDENDTYSIKN
                     KVFTILLGGAVPEELKGTTDSTFYDQYSLISTPEANWDLPSLGRNDVNANVFQFVANK
                     TNVTNRNVDTTYMVNNATYVGYLLDDTIPLPAPNVTAINMNGKPVLKAIVDKWGAEYS
                     AQLSQSYFTSTTTTVSGSISEAPTTIKSASATITSASATTSGSTAAKNSTSSNGTRVS
                     TKSSSGGAAAIAVLPVSGLLGLIVAYLL"
     gene            <370252..>372255
                     /locus_tag="HG536_0A01900"
                     /db_xref="GeneID:59323470"
     mRNA            <370252..>372255
                     /locus_tag="HG536_0A01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281153.1"
                     /db_xref="GeneID:59323470"
     CDS             370252..372255
                     /locus_tag="HG536_0A01900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137048.1"
                     /db_xref="GeneID:59323470"
                     /translation="MNELVPKSAGEDDGAVSVRNDLEEQSPRDEKKRRFVAWLRVLLM
                     VTVPVLVLAFGLQQLVKSHGLGSLTQCVSSNFAKKSESSNDDSWRLDTNKNYTMDVDY
                     WLRQTKPRERHYYMNVTTFVEESPDGIRRNLTVVNGQYPGPLLEANAGDTLFIHVDNQ
                     MEHEPVTIHCHGLFFNNNNSFHDGAAYINQCPIPPKANYTYKIELDDRQYGTYWYHSH
                     FGAQYADGLFGPLVIHSSEEYRAMNSSYDKDIVVLVNDYYHDMASNYLPDYLGPANEN
                     TEPDPDNGLIQGQNRFDYVASTYLVPNGGNSSDVSYAPVNVSVIDLDPNSTYRLRLIN
                     AGFFLTFEFEIDSHDLEIVEADGTLVTPITVDSLAVSLAERYSFILKPRDDKKDLKNY
                     WMQARFNQFCAKVENTNFNPDVRAIVSYSKHEDPSDLQVPDSRWQYGGGDVVCNEFDQ
                     SLLHTANVTSVPRTANGSTLPDVRFDVDVSFLIKANQLTRGYLNDQTFENYKNGSTMY
                     QLAFAADNNTIKNLDVKDLLTNNDHQYMLNINERGTIVDIVINNYDDGNHPFHLHGHK
                     FWVLAIGKTGFFDQKYYTDDSGVMNFENPVLRDTVNIPGFGWGVLRFVADSPGVWPFH
                     CHIGWHMESGLMMQFNILQDEYSNWDNYPLKWYQQCQYWQNQL"
     gene            <372527..>372916
                     /locus_tag="HG536_0A01910"
                     /db_xref="GeneID:59323471"
     mRNA            <372527..>372916
                     /locus_tag="HG536_0A01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281154.1"
                     /db_xref="GeneID:59323471"
     CDS             372527..372916
                     /locus_tag="HG536_0A01910"
                     /inference="similar to AA sequence:RefSeq:NP_012351.1"
                     /note="ancestral locus Anc_1.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137049.1"
                     /db_xref="GeneID:59323471"
                     /translation="MLLPTAKYCGSDAETVKFEVNPADARYQTTDGRTTGASPYVLNA
                     GQVDRDRPSEPRRDANGKITALGELRTRLTGLQDDINEFLTQRMELAKGKKPKLQGNQ
                     AKQEERIENEIKELLDGGDGEDDADGL"
     gene            <373044..>374507
                     /locus_tag="HG536_0A01920"
                     /db_xref="GeneID:59323472"
     mRNA            <373044..>374507
                     /locus_tag="HG536_0A01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281155.1"
                     /db_xref="GeneID:59323472"
     CDS             373044..374507
                     /locus_tag="HG536_0A01920"
                     /inference="similar to AA sequence:RefSeq:NP_009957.1"
                     /note="ancestral locus Anc_1.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137050.1"
                     /db_xref="GeneID:59323472"
                     /translation="MKETFSEEEYRSREVDDGSVVATKKPVDKRRLLFKIDLFVLSFV
                     CLQYWINYVDRVGFINAYISGMKEDLHFKANDINITNTCFTVGYILGMIPNNLILLVA
                     PPRVWLSFCTFAWGLLTLGMFKVTSFKQCCVIRFFQAIFESCTFSGTHLILGSWYKEN
                     ELPIRSAIFTSSGLIGSMFSGFMQVEIHDSLDGRRGLAGWRWLFIIDFAITMPIALYG
                     FLFFPGVPENSSGSSSFSMTRFFFSERELQFARRRLPARDESTRLDWSVVPRVLKRWH
                     WWLFSFVWVLGGENLSLASNSTFALWLKNQGYSLSHRNNFPSGIFAVGIASTMLSALY
                     LNKISKARHWHVAMFLAVTMCVVAIMVRSNPISAPVMFTAQYLGGVAYAGQAVFFAWA
                     NVVCHADLQERAIVLASMNMFSGAVNAWWSLLFFPASTVPHFEKGSYALLATSIASGL
                     VSVLIRRFQNKDRYGEQELPYIDANDMPHDEDDDDDN"
     gene            <374731..>375993
                     /locus_tag="HG536_0A01930"
                     /db_xref="GeneID:59323473"
     mRNA            <374731..>375993
                     /locus_tag="HG536_0A01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281156.1"
                     /db_xref="GeneID:59323473"
     CDS             374731..375993
                     /locus_tag="HG536_0A01930"
                     /inference="similar to AA sequence:RefSeq:NP_012352.2"
                     /note="ancestral locus Anc_1.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137051.1"
                     /db_xref="GeneID:59323473"
                     /translation="MTFRPKSKLKPSAKKQWKWPSKISGKRLSGLAGESTPGSTFKRT
                     VLIFGGIGLFLYVLSSFFSLGQPPRTYPAEHGHYIHEIPALSPLIFPHVEHATVLKEI
                     GVRGLYTVRTDIDGQSSLVMKHDDEPLSDEEKKKTSDQVLLVKRSFLDHGKLVYRKSV
                     TSPEIVIVTLIDFENWDLDTIVSVVQNRVDYAQKHKYGVYVRWIQEFVPLLRNQDLKA
                     SQEYIKPLIMRAAIHAFPQAKYLFFVDQTSLIMNLELTLQQHLLDPDVLDMALLRNVP
                     IIPGSNIKTYTHFNVDTTRIIIPQSPAGELDLSSMVVSTDLYGKAFLEYLMDPLYTNY
                     DWDSFSASVAHMLQWHPQLLGKTALVVQKLIAAPYDANSKPDAASKEKVDALHYTDGD
                     FVVSLNNCKLRGTCASDIQSFYSKIRKS"
     gene            <376295..>378838
                     /locus_tag="HG536_0A01940"
                     /db_xref="GeneID:59323474"
     mRNA            <376295..>378838
                     /locus_tag="HG536_0A01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281157.1"
                     /db_xref="GeneID:59323474"
     CDS             376295..378838
                     /locus_tag="HG536_0A01940"
                     /inference="similar to AA sequence:RefSeq:NP_012354.1"
                     /note="ancestral locus Anc_1.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137052.1"
                     /db_xref="GeneID:59323474"
                     /translation="MTVGEGHWLYAKEHLANLRRLNAFCLAFEPKPASALDPMSQLCN
                     QTRTISKSVTSLIEYHSSCDPNDHLAIQSSFMNSEILNLYNEILLGSIKLIFAIETSL
                     FRLGPSLEFAICIVKLYSKLTNYQKLLGGKSTQLSSMLHSFEFQFKQGYITADNNVIR
                     LDNIHDLSSHTYDLVAPPIINLDDVVKRDFFRLSMNKFNMQRQLVEILQFTNGEIAIF
                     KVISGELPNAKDPPTQLLARLLQGDYSPLNLGRALLFPFLRDYDLDVIGESVSGIELR
                     TVTGNNVHLKLQCVDALQWEGHWKFCMKKLFDRNNFMQLTPSIRSSASLAKSSHLFQN
                     FKMKHNKLENLRPAESTGLSLTLPNQAMHVEQSSERSEPDKPSQSGLRRSKPLQGPLS
                     ILMSMDEEDDEKATVNNQSSLSDCKHPSFEDLDSLDCEKLMELDKGIQMEFSPVSLES
                     PSLQQYKSVSQHSSMDEIRPIAAKSIEVDDFESIISSADDETDCRDDSSIFNPSAEFY
                     KPALYRRKSSSLLSLFSSRNKKGLFIDAAGANSAASLTPTSKENTPLSAKSNIPVYPT
                     EKTHQLLPSTIDLNNDLAIFESEKARTSFWDGRQWMRFGSESLRLSILRSINDETVLV
                     AYESKVDGRCFFAARVSHRWTCSKAAAQDIQAIIPSSDFLCSILPPGKNTVNIRCSRS
                     EGLLNALQHCIKGNLPAFIPSSQTANTLSSFPSSSASNGITRSSTGISDFAGFKNATD
                     AIASLLLLPSVKAKIHERIDEKGWQVQNIGHVDIFSQEYKGSAVAVRFDFFGVNEIKQ
                     TARTLISRLSDIRRIGRTGLLVASGDDERLLEFVNKVIADQVYKLIKPL"
     gene            complement(<378914..>379873)
                     /locus_tag="HG536_0A01950"
                     /db_xref="GeneID:59323475"
     mRNA            complement(<378914..>379873)
                     /locus_tag="HG536_0A01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281158.1"
                     /db_xref="GeneID:59323475"
     CDS             complement(378914..379873)
                     /locus_tag="HG536_0A01950"
                     /inference="similar to AA sequence:RefSeq:NP_012355.1"
                     /note="ancestral locus Anc_1.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137053.1"
                     /db_xref="GeneID:59323475"
                     /translation="MLRLFNGCSAVGRMTSCNLRLLATQASPLGVDHSIENNLKTETN
                     RLSKTGERFWEKVSLKDDGSQYLVQLDSKTILTPLGHPLAVDRDRSLLAMLLQKEWTN
                     LTSLAVKTYSLPLTSLVSRCIDLEIVNKPGGDLESKAKIGGDRERISQDLLRYLDTDT
                     VLVFCSKSEYEGALRKAQDQVYLPIISAAEEFLSNYSGSAVKLKVLDADLHGLRGNQQ
                     LEETRSAAKKYLDTLSLWDLAVFEKTVLTTKSFICGVLLLQNKASAESLEGLKSSMES
                     IAEAATLEIIYQTDRWGEVEDTHDVDKRDVRRNIHAAAIVAYK"
     gene            <380005..>380343
                     /locus_tag="HG536_0A01960"
                     /db_xref="GeneID:59323476"
     mRNA            <380005..>380343
                     /locus_tag="HG536_0A01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281159.1"
                     /db_xref="GeneID:59323476"
     CDS             380005..380343
                     /locus_tag="HG536_0A01960"
                     /inference="similar to AA sequence:RefSeq:NP_012356.2"
                     /note="ancestral locus Anc_1.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137054.1"
                     /db_xref="GeneID:59323476"
                     /translation="MSATPFIQELTANLRASKAQLQSVEQQLGLLERQEKLAKLTTQE
                     LATYPTDKVWRSCGKAFILQEKSKYIDDLKHDQSVVQEQTKTLKIKKNYLETTVEKTV
                     DNLKAAIESK"
     gene            complement(<380407..>381219)
                     /locus_tag="HG536_0A01970"
                     /db_xref="GeneID:59323477"
     mRNA            complement(<380407..>381219)
                     /locus_tag="HG536_0A01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281160.1"
                     /db_xref="GeneID:59323477"
     CDS             complement(380407..381219)
                     /locus_tag="HG536_0A01970"
                     /inference="similar to AA sequence:RefSeq:NP_012357.2"
                     /note="ancestral locus Anc_1.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137055.1"
                     /db_xref="GeneID:59323477"
                     /translation="MKYETLLFLGLLGSRWANAFQCNKDDRLKKYRLAQGNGGGYVYG
                     SVERDTPPSTTEEKWWVNVCAENDKNDLPSECDRNDVLCGLTYVTVPGRDTLMTQEIE
                     FPHSLSGPVEEVDGKLRLSLRGTKWGSESFDAQLEFECDDNMKTDEMVSSTWQDKQIR
                     INIKGPSGCLIKNEDGNRDKDRRPHLKDPNERKKGTSWFTWLLLYALLFTLIYLLVTA
                     YVNTRGGSFQDFREEFIDRSTQLITSLPAFAKEVAARIFGSGSSQRGGYSAV"
     gene            <381811..>382365
                     /locus_tag="HG536_0A01980"
                     /db_xref="GeneID:59323478"
     mRNA            <381811..>382365
                     /locus_tag="HG536_0A01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281161.1"
                     /db_xref="GeneID:59323478"
     CDS             381811..382365
                     /locus_tag="HG536_0A01980"
                     /inference="similar to AA sequence:RefSeq:NP_012358.1"
                     /note="ancestral locus Anc_1.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137056.1"
                     /db_xref="GeneID:59323478"
                     /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELQKA
                     QKYLGQVLEHQRAIPFRRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANA
                     EAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRINKYESSPSHIELVLTEKEEAVEKA
                     AEKKVVRLSSRQRGRIAAQKRIAA"
     gene            complement(<382523..>384451)
                     /locus_tag="HG536_0A01990"
                     /db_xref="GeneID:59323479"
     mRNA            complement(<382523..>384451)
                     /locus_tag="HG536_0A01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281162.1"
                     /db_xref="GeneID:59323479"
     CDS             complement(382523..384451)
                     /locus_tag="HG536_0A01990"
                     /inference="similar to AA sequence:RefSeq:NP_012742.1"
                     /note="ancestral locus Anc_1.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137057.1"
                     /db_xref="GeneID:59323479"
                     /translation="MDLSVYRHAVDLWTKADLSSLQSQLDKDIIEIKERETQFLESRK
                     ALASETKVFKKLPSDEKLANINKIIKHYQQEIDNLTKRSKSSEVVLLDVYGKICEAPD
                     PTPLMIHSVDKLSKIDDSSALKQQVENLEDKLAKYADYDNLKARLLDLEQNAAVTLAR
                     RLTAKEQEMSSTWGEKQRNWDEREAKLLKQVENLEKRLYEGAVVEKETDEGLSHDVTA
                     RNLLEQELESAQSRVFQLERRNEELNGALAKATSTAEQESQLQARENKIRQLESENAL
                     LSASSEREHQQLKKIEKELTEKISNLQAEVNSYKSEVNSTRMKLENYSDYVQIKEELS
                     ALKRIEFGTDTNDEENVAGQSSVESGIISANKRLQGALADLRSKFGDCEEENNKLKAQ
                     ISELQNKLTESEILNRKLEADLDKIEEVDQKFNDTASMMSGVTRQMNNRWGKLSPTSS
                     IVGIPEESETAATFGNNTILPIITKQRDRLRNRNTELEKQMRQLNNDKNKLKGELTKL
                     QADNAKLYERMRYLSRSSGNTGDAAIANIDAEAQYSQIFEDSINPLTNLKKKEMEYYR
                     RNKLSIWEKMFLSFARIVLANKTTRVLFLFYCFGIHGLIFMMSIYVINLSGYMTPEVG
                     IVQSSASRASKIAANQDM"
     gene            complement(<384731..>386548)
                     /locus_tag="HG536_0A02000"
                     /db_xref="GeneID:59323480"
     mRNA            complement(<384731..>386548)
                     /locus_tag="HG536_0A02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281163.1"
                     /db_xref="GeneID:59323480"
     CDS             complement(384731..386548)
                     /locus_tag="HG536_0A02000"
                     /inference="similar to AA sequence:RefSeq:NP_012359.1"
                     /note="ancestral locus Anc_1.163"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137058.1"
                     /db_xref="GeneID:59323480"
                     /translation="MESPGLFGPEDAGGGGEAAESIEKAAANDNVEKSGGADSETETN
                     ENLFGEEDEAMSEGEEKVAQQEEAEEGLQKEEEDGDEEEPSANVDKSMLRQESQESGA
                     VKNESQEQSELKELTVPQSHEIVIPNYARWFDLRKIHSIERQSLPEFFTNRIASKTPQ
                     VYVRYRNFMVNSYRLNPNEYFSVTAARRNVCGDAAAIFRVHKFLMKWGLINYQVDAKL
                     LPKNVEPPFTGEFSTRHDAPRGLFPFESYKPSVQLPDMAKLKKMMDTNDENSALHKYL
                     ETRKRKMSNQIDSEAPEDKVKDEEKTEIEEDQASSTNPVKKAKILENVDDQWSREELQ
                     KLLKGLQEHGSDWYKVAKSIDTKTPEQCILKFLQLPIEDRFLHSPGKDSGPLKYAPHL
                     PFSKSDNPVMSTVAFLVGLVDPRVVRQMTGRAITAMEDIDKEENKDSDELKEASEIAL
                     SSLGARSHVFATNEERQINAIASELVEVQLAKAELKLKFLTKIERALELERKSLQRQQ
                     EDTLIQRLALSKHSHLVYQKLQESLEIIDDKDKLASHLAEIKQLLDCPPKLSIGAAFG
                     LSQDGSTSPSSTQRLNAKSEDEVKPVSIEAPQFYRYWSA"
     gene            <386863..>387705
                     /locus_tag="HG536_0A02010"
                     /db_xref="GeneID:59323481"
     mRNA            <386863..>387705
                     /locus_tag="HG536_0A02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281164.1"
                     /db_xref="GeneID:59323481"
     CDS             386863..387705
                     /locus_tag="HG536_0A02010"
                     /inference="similar to AA sequence:RefSeq:NP_012361.1"
                     /note="ancestral locus Anc_1.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137059.1"
                     /db_xref="GeneID:59323481"
                     /translation="MLVSIQTLFAAVLMLVTRIAVGDVQVTEPVAGAQFSGSGGTVSI
                     DLKWMDNGANPPVDDITSFTFTLETGPNNHIQAVKKLDESVPLSAITKVGDTYSYTLQ
                     FPSGIIGNGQYYIQVYSQVQGGGYTNNYSPRFELTSMGGTSSATFSDSTQPPGETLVA
                     GTGTTTASVDTRSFTLYYTQQTGVSRFAPMQMQPGSKITATTWTKKFPTSAVTYYSTY
                     RNTLAQETTITPGWSYVLSSGINFATPAPYPTDNGGWQNPKQRQSLSTRKINIKKRAR
                     VMGN"
     gene            complement(<387791..>388141)
                     /locus_tag="HG536_0A02020"
                     /db_xref="GeneID:59323482"
     mRNA            complement(<387791..>388141)
                     /locus_tag="HG536_0A02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281165.1"
                     /db_xref="GeneID:59323482"
     CDS             complement(387791..388141)
                     /locus_tag="HG536_0A02020"
                     /inference="similar to AA sequence:RefSeq:NP_012362.1"
                     /note="ancestral locus Anc_1.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137060.1"
                     /db_xref="GeneID:59323482"
                     /translation="MASETPRIDPREIAQNVCPVFRLIAQVKSQPTENTLVLSSPTDG
                     GEMVTLTNVRVSLNKQFEAESWHEFVCRSSDSGDVEFLVLDAVPCVLKENEQISVDGI
                     VALQQLCRKFPEIY"
     gene            <388452..>390182
                     /locus_tag="HG536_0A02030"
                     /db_xref="GeneID:59323483"
     mRNA            <388452..>390182
                     /locus_tag="HG536_0A02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281166.1"
                     /db_xref="GeneID:59323483"
     CDS             388452..390182
                     /locus_tag="HG536_0A02030"
                     /inference="similar to AA sequence:RefSeq:NP_012363.1"
                     /note="ancestral locus Anc_1.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137061.1"
                     /db_xref="GeneID:59323483"
                     /translation="MAMRLQDGSKSLGPKGGRSPLRRHLHGLLTVGLALAGTALYVVS
                     QRSSREGVILSGKEVSRCGKIEPIVPSFKKSVDLILHDAEFKRSSVEKLSKAIQIPTE
                     IWDVNPEPADDPEWYAHFYEFHRFLEQTFPLVHERLTREKVNELGLLYTWEGSEPELK
                     PVLFMAHQDVVPVNKETWDDWEYPPFSGHYDEKSDLVWGRGSNDCKNLLIAELEAIEQ
                     LLLDGYQPKRSVILSFGFDEESSGPLGARHLAAFLEDRYGRDGIFSIIDEGFGVLPID
                     EGLFVASPITAEKGYVDVVVTVNGKGGHSSVPPDHTTIGVASDLITVLEDNPFGPDFE
                     LDNPLFSLLTCAAEHSKRLPKDLRKHILRAPKNKASRKMLEKFLSSDVRFRDLIRTTR
                     AVDVFNGGIKANALPEVSTFVVNHRIDIHSSVEETVAADAYFAEKIAKKYGYGFARNG
                     EFSIPETELGYIDVKVAKALEPAPVSPTSGAAWDILAGTIQDVFENGVFAGRDDAELY
                     VSTTLMPANTDTRYYWNLTKNIYRFVASILDASTFETIHSVNESIKASSHLSAIAFIY
                     EYIVNVDENA"
     gene            complement(<390246..>391643)
                     /locus_tag="HG536_0A02040"
                     /db_xref="GeneID:59323484"
     mRNA            complement(<390246..>391643)
                     /locus_tag="HG536_0A02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281167.1"
                     /db_xref="GeneID:59323484"
     CDS             complement(390246..391643)
                     /locus_tag="HG536_0A02040"
                     /inference="similar to AA sequence:RefSeq:NP_012743.1"
                     /note="ancestral locus Anc_1.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137062.1"
                     /db_xref="GeneID:59323484"
                     /translation="MSIQSNVIGLCTVAFVLLVPPLAWHSQNKNVPAIVLISWLIVMN
                     LSYIVAACVWSGEDFASRWSGKGWCDVVVKLQVGANVGISCAVGNIVNNLHSVLKADS
                     VLPEAGSWRKIGRDLAVCLVPPVVIMGLSYLVQMYRFGVTRYYGCLNLLSPTWVTTVL
                     YTMWPFVASTVAAVYASMVLYIFYRKRKDVKDILHCTNSKLNLTRFARLLIFCCLIIL
                     VMFPLSIYALVEDVKSFNGHYSYKETHSSALWNVIPKIDAGGRLLTVWIYVLMSYLVF
                     FIFGLGADALHMYANFLRSIKLGFIVDALGRLIEKSKDRKIAKLLGKISSSEYKDEFF
                     SDSSMEKSDGNYSSDSPQSQAHFVVDYRTPYESSKKSRNKRGIRIGFEKTTTSDVEEG
                     TDGFNPFLSQKLSEEDSTSLDGLSQLSFGRTNTENYDLEKNGGIVMYQPRTCDSGSSS
                     DDYKTVSYTTSPNSK"
     gene            complement(<392119..>393306)
                     /locus_tag="HG536_0A02050"
                     /db_xref="GeneID:59323485"
     mRNA            complement(<392119..>393306)
                     /locus_tag="HG536_0A02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281168.1"
                     /db_xref="GeneID:59323485"
     CDS             complement(392119..393306)
                     /locus_tag="HG536_0A02050"
                     /inference="similar to AA sequence:RefSeq:NP_012364.2"
                     /note="ancestral locus Anc_1.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137063.1"
                     /db_xref="GeneID:59323485"
                     /translation="MNAAVRLICVFLACLQVARAEVSAYDQIAFSNVGFAGTYTPVKK
                     FSNIDADDCSCEVGDPQWFSGTNAPVSSYLSVHFRGPLKLHQFAYYDSPSFDVSSSAS
                     SSDFTRRAYYNASAQVGENVTFLTAAGDSSKCLGKALTYAGSDGTSKASSATLLQDNN
                     YISSDEEFIIFSNVSCPKSGVGKGCGYYRQGIPAYYGFGGVTKMFLFDFEMPRETQSN
                     SSSIEFYDLPAIWLLNDHIPRTAQYPTNPNCSCWASGCGEFDIFEAMNGTERDHFYST
                     FHTFQGIEYLGTGIQSYGYIPRDTRNAMRGGAIFDSTGNVITFLSNATKFDSSLSYND
                     IHSILSAIPSNETYSSKLMSISATAPSTTSKSSGFSLTTSANGLWYYLFTAVTALAQV
                     FVI"
     gene            complement(<393651..>394193)
                     /locus_tag="HG536_0A02060"
                     /db_xref="GeneID:59323486"
     mRNA            complement(<393651..>394193)
                     /locus_tag="HG536_0A02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281169.1"
                     /db_xref="GeneID:59323486"
     CDS             complement(393651..394193)
                     /locus_tag="HG536_0A02060"
                     /inference="similar to AA sequence:RefSeq:NP_012365.2"
                     /note="ancestral locus Anc_1.169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137064.1"
                     /db_xref="GeneID:59323486"
                     /translation="MASKPKNLNSFVEEEAQWYACECPSCQAGARYESLVPRWLAGGF
                     FLPFLWIGNILIYVYTQWHLDYEPTHAEIPPEELPTVYEVETKIDKTHLEISNDVAAE
                     IDRVNETTVTFADPASPPHGLQYHRKLFLKQAASQILDSHEAKRAYYRKWTMWTVLAV
                     VAYSVTILLLVMAYDTGYTN"
     gene            complement(<394479..>396527)
                     /locus_tag="HG536_0A02070"
                     /db_xref="GeneID:59323487"
     mRNA            complement(<394479..>396527)
                     /locus_tag="HG536_0A02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281170.1"
                     /db_xref="GeneID:59323487"
     CDS             complement(394479..396527)
                     /locus_tag="HG536_0A02070"
                     /inference="similar to AA sequence:RefSeq:NP_012367.2"
                     /note="ancestral locus Anc_1.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137065.1"
                     /db_xref="GeneID:59323487"
                     /translation="MSSRSPSPVATKKFDAYEDKTQEALATFENLEECSYALKRLGSA
                     KNNEFMECDCFEDFSEGFNHACDENSDCINRLTLIECVNGLCGSCGDDCQNQRFQKKQ
                     YADIAVFQTKLKGYGVRAESDIEENQFIYEYKGEVIAEEEFRERLVEYDERNYKHFYF
                     MMLQNGEFIDATLKGSLARFCNHSCNPNAYVNKWVVAGKLRMGIFAKRKISRGEEITF
                     DYNVDRYGATAQKCYCEEPNCIGFLGGKTQTDAASLLPQNIADALAVSSSAEKKWIKM
                     KKSQGLKIEKAEGNNFNIEFVESLHPSGCENPQDVTKVMSVLLQADDRLIAQKLFNRL
                     YEIEDESLHHQVIKLHGYTCLAKLLQIFEDDLEMGQKIVSFLLKLPKTTKNGITASQI
                     DQQVSYLKEKQKGLAEDCDELLAKWAEFETYKRIDKKDIREASNRMVDLRRIRLPPGW
                     EIVHENGKPMYYNAQQKTKLHNPPTGSSKTFNSKPYSAKDSASRRNGTNGTKRPRLDN
                     EEYEKNKQKRLEMEMEAIEQAKKEEMRALKGKMELENQKRNDLLRIIEEANKQRELEK
                     EAQIKEEKEREERKLKKKKLSQTNHLEHKWNKFFASFVPNLLRKYEHENDLSHDHAKL
                     CARDIVKILTAKELKKDLTKSPPKEPTKEKRLKVKQFTQSYMEKFLQKRKKDLRNHKQ
                     "
     gene            complement(<396725..>399052)
                     /locus_tag="HG536_0A02080"
                     /db_xref="GeneID:59323488"
     mRNA            complement(<396725..>399052)
                     /locus_tag="HG536_0A02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281171.1"
                     /db_xref="GeneID:59323488"
     CDS             complement(396725..399052)
                     /locus_tag="HG536_0A02080"
                     /inference="similar to AA sequence:RefSeq:NP_012745.1"
                     /note="ancestral locus Anc_1.171"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137066.1"
                     /db_xref="GeneID:59323488"
                     /translation="MLGNLLRKGSSHHGGFSLIDENFSSSMHSNSTITSFTPEPSSIS
                     KRPVSPCYDDHFGSLLPCPSSAPPMLDHVSDDLKYKLFGSKNIPYSASFQSDVFSSYV
                     FRVLIAEETGHMTHRDNYNVVFDYSTAESSSMDQIRPNELKEYIFGSPVRSTDASQGN
                     KFRTIPNSDSVMITRIFFFSSINKNRLAVSLCVPNILLQVISEVWDDVSYWFDQCQAY
                     VLTTIKGIRHSVSSPCSGYLPPDFESAYPKECDNIINLLQTRLIPCLRSTSEIPRLFL
                     CPESCPSFVETWFRDIFNWIEIKDGPRLNFLPALLAKIICDFQDPTAAQDNTRIVIMS
                     GNMVVANKLIFIVSGLLKPRIAGQIEIESRIKPLSDQPEQARKDNPRRDASVLEKSNT
                     DLSKYLCAGNAWEIPRENSLSSKVSLSSDESLAYVIQPSSLKSASNSIQCLSSSLSSQ
                     HGLSYGSWFTKRSNGSQATLNSPSNKTPEQWDKISNTNGASSLHKTNSGTSLHQFFAR
                     GTGVTPQPSPSISELDEYPWFNGSDSPRPEPGQNLHPVAKRCLSGAPLGELNIPRDCQ
                     RLCQDDLIEKAFNAICKPNEKKALSEGECEIIPGDSRHAAFAQIDVDYGTCHRQRPME
                     LLPKYTTYLANFNYWFQLQAFPVGPDSESKVVQAMRKGLQLGRSTRTLLVSLRSRAIK
                     EVSIMRNEETLATGSHHSIIQKTKKIFNNGKCGNISTRMANCIAFVNMSIKKAMSLYE
                     DTTLTASQREEELFKIYQSLLSYQDIKTLNRANRI"
     gene            <400731..>402236
                     /locus_tag="HG536_0A02090"
                     /db_xref="GeneID:59323489"
     mRNA            <400731..>402236
                     /locus_tag="HG536_0A02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281172.1"
                     /db_xref="GeneID:59323489"
     CDS             400731..402236
                     /locus_tag="HG536_0A02090"
                     /inference="similar to AA sequence:RefSeq:NP_012746.1"
                     /note="ancestral locus Anc_1.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137067.1"
                     /db_xref="GeneID:59323489"
                     /translation="MMVFTEQIPRWLAYSIISSLLCICGGFCVPLISFIFRSRKNIDA
                     KLVNYGLSLSAGSMMTTALYKMLPSSDPEKANQMSVFLGVLMGMSLSLFLKYLIHARA
                     SESLVQCAHDSELLHEHHEHEQITSDSDQEQGATVVDPMPTDATQTAEFIASQQVVGE
                     QGALLKANESAKDRCRENLLKTRHTLLDLLSTVDAQTAECHHSDACVPMTKGEGLACV
                     PPIVRLRPSITSLSKTDLPDEANGGTVGQQVSADLLGVPCLENEVGYDLENLSIYRQN
                     FHSQRHSHRHDHTTSHQASSHDYGSLNYTDAGGSETAYRTHHHHHHFETPFSKLLSIG
                     MQTCLVITLHKFPEGFIIFYTNQSSDVSKALGFSIFLSLCIHNFVEGFSMTLPFYAAF
                     ESKALALLVTAIFGGLSQPLGALIGYLIFRKKKTGGDMPHMDLYLSVTAGFLLVIGLE
                     MLQTGTGFSQGHHHHEGEADEEIKSNHTSVNTCLKWCCVGALLILASGVFK"
     gene            complement(<402385..>404169)
                     /locus_tag="HG536_0A02100"
                     /db_xref="GeneID:59323490"
     mRNA            complement(<402385..>404169)
                     /locus_tag="HG536_0A02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281173.1"
                     /db_xref="GeneID:59323490"
     CDS             complement(402385..404169)
                     /locus_tag="HG536_0A02100"
                     /inference="similar to AA sequence:RefSeq:NP_012747.1"
                     /note="ancestral locus Anc_1.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137068.1"
                     /db_xref="GeneID:59323490"
                     /translation="MVHEYTLLPEGIRENIAHLAPHEIFENLHTIIHDESNEVAEVYE
                     HFEYEQQLDKSLLSRSSVIGLGFGLMSPVLGMCTSMGIGLMNGGPLTIMWGFPICGFF
                     SFLCASSLGEVVSKYPMELHGASAMIAPESIKRVCSWLTGWMILLGNWFMSIGVTFAG
                     AQLIISLIAMNDSRTISDSRLGIYTVLVYYAVVTVVGVVNLSYARYVELINKVCIYWI
                     VYAVLFIDVLLLLFHRHRFRSLFYALFHFDNSLSGYKSAFLSFIIGFQQSNFTLQGFS
                     MLPALADEVKKPEKDIPRGMSTAVLISTTLGIIFLFPIMLILPDLGSLFDNNKVLPIV
                     NIFTQSTDSTFVSVFLILLILGNLFFSGIGSITTSSRAVYSFGRDHAIPFHSVWTYVD
                     PCSESKVPKYAVLLSMGVSYILGLLPLVSTAAFNAFIGCAVLCLCSATLIPLILVLLT
                     GRRTLRNAPIKIKYKIGWVVNIGSVVWLLLSMLSVCLPPQIPVTAKTMNYALVVFGAC
                     FISIVILYFRWGNVNFQLPLVDKLSKDSTTMEIGETEYGQKSHLSAGLEMFQQFEGQS
                     SAKSISCSSQQSPSDESYDLGVPKLETL"
     gene            <404539..>407418
                     /locus_tag="HG536_0A02110"
                     /db_xref="GeneID:59323491"
     mRNA            <404539..>407418
                     /locus_tag="HG536_0A02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281174.1"
                     /db_xref="GeneID:59323491"
     CDS             404539..407418
                     /locus_tag="HG536_0A02110"
                     /inference="similar to AA sequence:RefSeq:NP_012748.1"
                     /note="ancestral locus Anc_1.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137069.1"
                     /db_xref="GeneID:59323491"
                     /translation="MSDEELYDEFGNLIGEEELVREVAGAARGDEIEGGHLDKPVEQE
                     HGTTAMVKSDWKRTYGDEVEVLVETSDRQATDEPLVQVKAEHSRGPTYTVFTHLLRNV
                     PKTTFDRDYMLGMLEVPERIRNVAVIGSLNSGKTSLVDLFVMESHRNLPHMTANIRKG
                     WKPLRYLDNSRIEIERGVSMKLNGFTFLATDFDMKSIAINLLDAPGHVNFMDQMAVAL
                     AAVDCALICVDLVEGVTSPVEKLIKECYKRSVTPIFVLNKMDRLILELKLPPVDAYLK
                     IRHVVQQINSFTRERFSPELGNIIFASAKLRFTFTIEQFVRYHYSSQLSEPQIEKFVS
                     GLWGNVSFEKGQFRKLSIESAHHCSFVQFILLPLYKIFTHSLSGDRENLRRTMSKAYS
                     IDLDPDCLKYDPQPLLKEVLTKVFRDQRGLIKAIARCPDPSTGSKARLLNKSQESSSL
                     LKAHVLQTIDYGGTEWSLVRIYSGKVTSGMRVRVIDSADSQACMSDDDNQKHVDLEDY
                     PSVTIAEIALLGGRYLLPVSQATTGQIVLVKGVSEVFTKSATMLNDHFSDASVFEPID
                     YINEPALRIAIQPLKPTELPKLLSGLAKVSRYYPGVIIKVEESGEQVILGFGELYLDS
                     LLYDLRNHYAGIEIKLSNPLTIFSESCYGESFAAIPATTVNGTTALSIAAERMDTTLV
                     KDLMRGHIEESEMKDRKLLRKRLRDEYGWDSLAARNVMCFYNNNVLIDDTLPDETNKE
                     LLKSYESQIKQGFDWVTREGPLAEEPIHGVQFKILQATGLENIGIGGQLIPLVKKACC
                     IAMMSASPVLLEPIYEVDVLFKSALQPIVEELFKKRRGGRIYKCDRIVGTPLTEIRGQ
                     IPVIESIGFETDLRLATRGGSMCQLHFWNKIWRKVPGDVLDKDAPMFKLKPAPINSLS
                     RDFVMKTRRRKGISNEGFMSNDGPSIEKYVDEETFKQLKENGLVT"
     gene            complement(<407587..>408762)
                     /locus_tag="HG536_0A02120"
                     /db_xref="GeneID:59323492"
     mRNA            complement(<407587..>408762)
                     /locus_tag="HG536_0A02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281175.1"
                     /db_xref="GeneID:59323492"
     CDS             complement(407587..408762)
                     /locus_tag="HG536_0A02120"
                     /inference="similar to AA sequence:RefSeq:NP_014363.1"
                     /note="ancestral locus Anc_2.283"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137070.1"
                     /db_xref="GeneID:59323492"
                     /translation="MSSYTSIHAQTFGSDNWCLSLQPLYSHALLTSLSNGEVHHLDWV
                     TGKSKAVDQAGTSSINKLKIINADFQGGSQYAVASNDSINVFDIRSRDRLARLKNEKN
                     APFLSLDSRHNLLACGTELTGVDAEVHIYDIRNWKTPVRSFMDSHHDDVTDIRFHPSD
                     SKLLLSGSTDGYTNVYDLTQQDEEDALHQVINYASIHSCGWLAPRRIYTLSHMETLAI
                     HELNDKSDESREPQPNDFGDVRDKWGCNYVVDIYPGYIAVGGSQQDAGFLKIVPFDNE
                     KSDLNRALTITSAHGDDIVRDVLVPPQNPDILYSCGEDGTVKTWKISNSTYHPRSEFW
                     NYSIKMDLFSSEENHKEPPLTKETFEHPSSQSGEQQENKRTREKSKKHKKSHRYKPY"
     gene            complement(408871..408944)
                     /locus_tag="HG536_0Atrna1I"
                     /db_xref="GeneID:59324253"
     tRNA            complement(408871..408944)
                     /locus_tag="HG536_0Atrna1I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59324253"
     gene            <409228..>410325
                     /locus_tag="HG536_0A02130"
                     /db_xref="GeneID:59323493"
     mRNA            <409228..>410325
                     /locus_tag="HG536_0A02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281176.1"
                     /db_xref="GeneID:59323493"
     CDS             409228..410325
                     /locus_tag="HG536_0A02130"
                     /inference="similar to AA sequence:RefSeq:NP_012183.2"
                     /note="ancestral locus Anc_2.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137071.1"
                     /db_xref="GeneID:59323493"
                     /translation="MTVNPNKVVDEHRKRIIHSSITEISHAIDRSIDEAVFPIAQTSD
                     EDRFFLINPRPPYLDDLIQEARAFIELQHKLQRDRIVLVTSGGTTVPLENNTVRFIDN
                     FSAGTRGAASAEQFLAHGYSVIFLHREFSLTPYNRSFTHNVDVYFLDYIDSDGCIKPE
                     YREKVLASKKLFDKYYVQEKKLLLLPFTTVNQYLWSLKSIAKLLNATGGLFYLAAAVS
                     DFFVPYSRLPQHKIQSRDYGTDCKESAHSTTSTTTPEGKLIVNLDPVPKFLRRLVESW
                     AKQAMVVSFKLETDDAILIEKATQALDRYNHQLVIGNLLQTRNKEVVFVNQENRKGSW
                     IRTDEKHTTIEGLIIPEVIKYHEEWIKSQDN"
     gene            complement(<410577..>412061)
                     /locus_tag="HG536_0A02140"
                     /db_xref="GeneID:59323494"
     mRNA            complement(<410577..>412061)
                     /locus_tag="HG536_0A02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281177.1"
                     /db_xref="GeneID:59323494"
     CDS             complement(410577..412061)
                     /locus_tag="HG536_0A02140"
                     /inference="similar to AA sequence:RefSeq:NP_014372.1"
                     /note="ancestral locus Anc_2.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137072.1"
                     /db_xref="GeneID:59323494"
                     /translation="MDEFEKSSIEGRVIELADSSRREVEQEANEAKAEQQRYIAELLK
                     NSSKTPIVVSAVLTSDHQSIRPDVLQKYLDATILQASSFSQLCEQADLLNVKLIQHGM
                     AENVSQSLDSRGILRLPVIKRHYPSLVYESQAISGELAVIDVISRLNILPIKRFTAKT
                     GTNIGNGEGDGYLQFQLRNMFGGGEQLKLDITKGTKTHSSYLLDYGQPVTPWWMLNSM
                     LFKNSRQFGNNNSIDMLIRGFRTSLRSGFQEAGAINHELFYEAEWRTSKLLSLHASDT
                     LLFQAGDDIKSSLGHTLAVDRRNNPIAPTSGSFLKITNELALGKYWKSQVEFSQNNSW
                     LKDDFIGSCCTFRSGYIANLNSSKKTVNTYDKFHNGGANDIRSFQIMGLGPKDLYDSI
                     GGDAFISYGVSLFSRLPIKKWSHSNFRLHWFFNGGKLINHNNAPLKSVVTQLANQHST
                     SVGFGILLRHQVARFELNFTLPLTVHSGDAMRKGFQYGIGVSFL"
     gene            complement(<412260..>413783)
                     /locus_tag="HG536_0A02150"
                     /db_xref="GeneID:59323495"
     mRNA            complement(<412260..>413783)
                     /locus_tag="HG536_0A02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281178.1"
                     /db_xref="GeneID:59323495"
     CDS             complement(412260..413783)
                     /locus_tag="HG536_0A02150"
                     /inference="similar to AA sequence:RefSeq:NP_014371.1"
                     /note="ancestral locus Anc_2.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137073.1"
                     /db_xref="GeneID:59323495"
                     /translation="MPDLYGHIAHSDPEEGDQGSHEKEEEKGLHLEMPGFTGVGIEGR
                     QNERFIQTYLVSSEGQMLCEPQMSISMESEVLFSPSSTSSQRNPVTPTLKVEDSDGDT
                     WAHLMEPSRAEVEDAGASLHLQSRSYLGAFSAEHELNDMYRSDAETGYASSSYHTPGL
                     YPVDPAVSPAVSYLTIGDEELDDLLSVHSGTSAYSNISLPMSASGFRHVTNVDELDNL
                     LSASSGRFDENFSEFVQSSVTACEEQQGSRIPPVISVQEFQEKRSDEAGTSVSSTTFD
                     EQNFQRAEQKLNASLLCPNDMDVEHEDMINGRIARRRASHGSRRSRSSVRSRSLSPDE
                     RARSLSEDRDRLLLLADLQPPSPNDLQNRSASPLGDGETLQNLSGNTKRRLSQKNPAT
                     YACELCDKKFTRPYNLKSHLRTHTNERPFICSSCGKAFARQHDRKRHEDLHTGKKRYV
                     CGGKLKDGTPWGCGKKFARSDALGRHFKTESGKKCITPLYDEAARNKQTLEADFQQD"
     gene            complement(<414080..>415324)
                     /locus_tag="HG536_0A02160"
                     /db_xref="GeneID:59323496"
     mRNA            complement(<414080..>415324)
                     /locus_tag="HG536_0A02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281179.1"
                     /db_xref="GeneID:59323496"
     CDS             complement(414080..415324)
                     /locus_tag="HG536_0A02160"
                     /inference="similar to AA sequence:RefSeq:NP_013709.1"
                     /note="ancestral locus Anc_2.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137074.1"
                     /db_xref="GeneID:59323496"
                     /translation="MPYEILVDDAKLVKPIKTRLEGQRCFVKPIYRDGDRRVIRTTID
                     DEHDPLIADFCKRFYRSEVPDDTGIVGFTRRFLESEGCEQTEALLDCLPRRYTIYSPL
                     LLFNHSTHRSFEHPAWRSYFSEVGEAAKAKYFRQMLAQLFPPEISHVATNMPIVETDV
                     MRRPFNIAPLYGTLLSPQAGAVGQLRADPQPADFDRTLWCHVVQNGIHQLWAPMFTMF
                     SRGNIKEKKRVLDVFPEIEGNDVVDLYAGIGYFTLSYLKRGARRVFCFELNPWSVEAL
                     RRGLDANSFSRDRCCIYNESNETCVQRISESSVRDLRVRHINLGLLPSSKAGWPLALA
                     IVSMQQPLPVVTLHIHENVHVSAIDSGSFVAETLNQLAQLNGSYSYAAAHLEKIKTFA
                     PDVWHVCLDVDVTLSTSHIRLS"
     gene            <415491..>416564
                     /locus_tag="HG536_0A02170"
                     /db_xref="GeneID:59323497"
     mRNA            join(<415491..415518,415627..>416564)
                     /locus_tag="HG536_0A02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281180.1"
                     /db_xref="GeneID:59323497"
     CDS             join(415491..415518,415627..416564)
                     /locus_tag="HG536_0A02170"
                     /inference="similar to AA sequence:RefSeq:NP_012182.1"
                     /note="ancestral locus Anc_2.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137075.1"
                     /db_xref="GeneID:59323497"
                     /translation="MSQKHLNQDVPRKDKRRHNIESKVAKIQQSFALDRDVHYKDRLT
                     ALQADLTTLHQGNNRAYLRKLRDLEEARDLELVRLRLFEEYRVSRSRIEFQEDIESAR
                     EEHERLVKLCKERLYESIEQKIKQLQEDRLLMDVANAHSYAMDYNRTKYQKYTRSHTA
                     GGWESSSNELGRDSPSESATDTATDRRFLRKRAATKVANAVAESDFQTNSSAIALTNG
                     NGNSNGNGYARQSTHDSKADGNSDADLLQTISDYGDLHALLFGEKDLDTKSNDKKKHR
                     TSQRYTAKAAPPLQSLKPDEVTDDIAYIRHLTGQPPAPFKSRITD"
     gene            <416686..>418284
                     /locus_tag="HG536_0A02180"
                     /db_xref="GeneID:59323498"
     mRNA            <416686..>418284
                     /locus_tag="HG536_0A02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281181.1"
                     /db_xref="GeneID:59323498"
     CDS             416686..418284
                     /locus_tag="HG536_0A02180"
                     /inference="similar to AA sequence:RefSeq:NP_012181.3"
                     /note="ancestral locus Anc_2.300"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137076.1"
                     /db_xref="GeneID:59323498"
                     /translation="MFKLNVRVRRVWDRLFRCNALAICIIVAMVVTGAVVIPQFVAET
                     HGYGWPKFSDEDITTDRDGPFFRGCVDTERYLKDEQYTKMNATFVMLTRNEESEDVAK
                     TIRSIESHFNQWFQYPYVFLNDVPFTQEFKDKIQRLSRAPMQFGTVDKLDWEFPEQVR
                     NSFAFQNALRDQADRGILYGGEESYHKMCRFYSGLFYKHPLVQQFEWYWRLEPDVEFF
                     CDLTYDPFLEMARSDKRYGFTIVLPELYWTVPNLFRYTRSFIRENKLKLGSLWRLFTN
                     NYRILETDDEVLASRVNYGSDVDHKLSEKVAIEHMLASGNSEEEMGLRYLVGRSQAKI
                     PLFEDKFDDEEYNLCHFWSNFEIARLDVFDNEIYDSYFRYLEQKGGFWRERWGDAPVH
                     SLGLGMTLNVEDVHYFRDIGYRHSVIQHCPKNWNGVESGTKVAQAQLPYFEADPRAKR
                     NPLWHRYNKGVDNGCGCRCRCDTWKTDIEDTAYYCMERWTDLQLASDADLARGGHYAA
                     IASANDVESRVRDDYLAQLLQEPS"
     gene            complement(<418355..>418666)
                     /locus_tag="HG536_0A02190"
                     /db_xref="GeneID:59323499"
     mRNA            complement(<418355..>418666)
                     /locus_tag="HG536_0A02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281182.1"
                     /db_xref="GeneID:59323499"
     CDS             complement(418355..418666)
                     /locus_tag="HG536_0A02190"
                     /inference="similar to AA sequence:RefSeq:NP_014368.1"
                     /note="ancestral locus Anc_2.299"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137077.1"
                     /db_xref="GeneID:59323499"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <419005..>419415
                     /locus_tag="HG536_0A02200"
                     /db_xref="GeneID:59323500"
     mRNA            <419005..>419415
                     /locus_tag="HG536_0A02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281183.1"
                     /db_xref="GeneID:59323500"
     CDS             419005..419415
                     /locus_tag="HG536_0A02200"
                     /inference="similar to AA sequence:RefSeq:NP_014367.1"
                     /note="ancestral locus Anc_2.298"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137078.1"
                     /db_xref="GeneID:59323500"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <419543..>419983
                     /locus_tag="HG536_0A02210"
                     /db_xref="GeneID:59323501"
     mRNA            <419543..>419983
                     /locus_tag="HG536_0A02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281184.1"
                     /db_xref="GeneID:59323501"
     CDS             419543..419983
                     /locus_tag="HG536_0A02210"
                     /inference="similar to AA sequence:RefSeq:NP_012179.3"
                     /note="ancestral locus Anc_2.297"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137079.1"
                     /db_xref="GeneID:59323501"
                     /translation="MAERESTWESWYKYTGTPYPAALNSLLLLATPQVSPATPSPVSV
                     VQRASSSRFVNALSRPKYLGPSSRTALLFGAAQALGAWMVYDGDVESGSGFLAAWSAL
                     YLIVGGRGSVKALRYGKVWPLLVASVTGANAFMYGRRFIAGGFT"
     gene            complement(<419995..>420777)
                     /locus_tag="HG536_0A02220"
                     /db_xref="GeneID:59323502"
     mRNA            complement(<419995..>420777)
                     /locus_tag="HG536_0A02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281185.1"
                     /db_xref="GeneID:59323502"
     CDS             complement(419995..420777)
                     /locus_tag="HG536_0A02220"
                     /inference="similar to AA sequence:RefSeq:NP_014366.3"
                     /note="ancestral locus Anc_2.296"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137080.1"
                     /db_xref="GeneID:59323502"
                     /translation="MAGQGGTAKEAESSVIDSLIENEAEIVRLIQQDASYLRGDGKSS
                     GIHTVVNEDETLRGEFDEILERFHEKKQDGSNGLRTVEEQDGALEQSHQEVIPPENFS
                     HVVGEIYRSSFPRMENFAFLQRRLKLKSILVLIPEEYPPENEEFLKQSGIRLFQVGMS
                     GNKEPFVNIPSDLLTRALEVVLNPDNQPILIHCNRGKHRTGCLVGCIRKLQNWSLTMI
                     FDEYRRFAFPKARALDQQFIEMYNDNEIVRIAQKNNWLPIQW"
     gene            <420996..>422405
                     /locus_tag="HG536_0A02230"
                     /db_xref="GeneID:59323503"
     mRNA            <420996..>422405
                     /locus_tag="HG536_0A02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281186.1"
                     /db_xref="GeneID:59323503"
     CDS             420996..422405
                     /locus_tag="HG536_0A02230"
                     /inference="similar to AA sequence:RefSeq:NP_012178.1"
                     /note="ancestral locus Anc_2.295"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137081.1"
                     /db_xref="GeneID:59323503"
                     /translation="MEPTGTAVSSTINLVKTILGAGLLAIPFAFKNDGVLVGTLLTLL
                     AAVTSGFGLFILSKSSKTLINPRNSSFFTLCMLTYPLLAPLFDLAMIVQCFGVGLSYL
                     VLIGDLFPRLFGGEANFWILISAVVTVPLCCLKKLDNLRYSSILGLFALAYLSLLVVT
                     CFVHGTLFTHGYERYRGEVSWFKVYDAKGLMSTFSIIVFAYTGSMNLFSIINELKDNS
                     MKNISLVINRSISISTLVFLTVGITGYLTFGSNTLGNIILNYDPDSVWVHIGRLCLGS
                     MVMLSFPLLFHPCRIAINNLIVWLEIQLRKEPSITGEPENEMRSDRGEATPIRLSIED
                     EDRESLSGLENGDIESANAEEIQIHRGTNVEHTPFPDFRFYIITAVLLLSIYTIALRI
                     RSFAFVLAIVGATGSTSISFTLPGLFGYKLIGTDSLAIGEMVSPRDRFYKRCSGLLAW
                     YGVGIMAFSLYVTLKYGTD"
     gene            complement(422504..422575)
                     /locus_tag="HG536_0Atrna1E"
                     /db_xref="GeneID:59324251"
     tRNA            complement(422504..422575)
                     /locus_tag="HG536_0Atrna1E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:59324251"
     gene            complement(<423005..>423985)
                     /locus_tag="HG536_0A02240"
                     /db_xref="GeneID:59323504"
     mRNA            complement(<423005..>423985)
                     /locus_tag="HG536_0A02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281187.1"
                     /db_xref="GeneID:59323504"
     CDS             complement(423005..423985)
                     /locus_tag="HG536_0A02240"
                     /inference="similar to AA sequence:RefSeq:NP_014373.3"
                     /note="ancestral locus Anc_2.294"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137082.1"
                     /db_xref="GeneID:59323504"
                     /translation="MSGSYWSSTQRLQWQHTKESLARERQKLWLMECQLFPQGLNIVM
                     DSKQGSGKPPSTKNIPITHKDLHYDKDYNLRIYCYFLIMKLGRRLNIRQCALATAHVY
                     LSRFLLKVSVREINLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFVPPDPTKV
                     AEFEFYLIEELQSYLIVHHPYRSMEQIVNVLKEPPFELRLSQEELQNCWSLINDSYID
                     DVHLTYPPHIIAIACLFITICLTGTTKNSLANVGNKSRKSLENEPAATQAARQQEVFN
                     RFVAESQVDLEEVMNTIQDLITLYDHWDKYHEPWIKFLLHSLYLRPSASS"
     gene            complement(<424899..>426362)
                     /locus_tag="HG536_0A02250"
                     /db_xref="GeneID:59323505"
     mRNA            complement(<424899..>426362)
                     /locus_tag="HG536_0A02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281188.1"
                     /db_xref="GeneID:59323505"
     CDS             complement(424899..426362)
                     /locus_tag="HG536_0A02250"
                     /inference="similar to AA sequence:RefSeq:NP_012176.1"
                     /note="ancestral locus Anc_2.293"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137083.1"
                     /db_xref="GeneID:59323505"
                     /translation="MTSISKSFLQGTRMALAGFYLLSVLVTIPISFKVGGLYCGLSFT
                     VTLFNLYLITTTLSMIARSYGGRFYIICTTFIYYLQHFIIASLLYLFLSGFSNEELTK
                     VLEDGSQPEQSLVDVLRNSVFSTHSSWMLYYYYYRYIVQPWQFVLTHSTAFFALSEGF
                     FTVLGIQAIGETNRWLLYEINSNTWIITSLLTSGGIITASLYYLYRIYVTPIWNLSVQ
                     TASLLGFTLSLVCGLGLYGIVSKSGSVIESSLFFAYIVRCIYEISPKLATTATDEILE
                     MIKITWQKHQKNLSTTNNLLSYYHDVVLKNAEMVWESIVSKTKNTEASAFNGAQHLGK
                     LWYLFKPIWKLFRDFAMSVPSSIGGIFQITLKLGSESVSPAIVINLCFRVLVFYSATR
                     IIPALQRKDHRELRKSRRIMSILYWYSPCILIAMYTHLILQYSGALNSNMCLWGCNER
                     WFGDQPKIEIDTWVFWNWCNIFWTIIIYGSELISGKR"
     gene            <426704..>428842
                     /locus_tag="HG536_0A02260"
                     /db_xref="GeneID:59323506"
     mRNA            <426704..>428842
                     /locus_tag="HG536_0A02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281189.1"
                     /db_xref="GeneID:59323506"
     CDS             426704..428842
                     /locus_tag="HG536_0A02260"
                     /inference="similar to AA sequence:RefSeq:NP_012175.1"
                     /note="ancestral locus Anc_2.292"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137084.1"
                     /db_xref="GeneID:59323506"
                     /translation="MVGSEREGERTRKNGFSKRGRKDLRSIRRAQRNEPRNGSNGSEE
                     AIEAVHSPQEVQTGAPKHLSDVDEEADDEMSKRRKVYGALLTILKSEHPSTERESRRE
                     KVNAVAVAESEEEENQENEVEQLEEQLLNVEADPSDDELDGPVDDSEDEHDPFESHFN
                     QVPEKLIDEMDAAFKQKTVSYKSAKIPIGDNRTWIYSKPVLPDRKDEKLEKPTGHGSL
                     HQYAIKQRLKIQNDLDTAELTALQKILVDPMFQYNDLLYEYESYEKDEEDYRDLYALH
                     VLNHVYKTRDRILKNNQRISENADAEYSDQGFTRPKVLIVVPTRDSAYQVVSKIVAKS
                     GVDQVDKKSKFQDQFFEDSVPPASKPKSFQHIFKGNTNDFFVLGMKFTRKAIKLYSNF
                     YQSDIIICSPLGIHLILENTDKKKRQDDFLSSVEITIIDQLHSIEYQNISHVLTIFDH
                     LNKIPREQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNRCQNISGRWK
                     NHRMIEPTGSSIGKLGLKVRQIFQRIDMGSASVIEEPDLRFKFFTSVIIPSIVKSTGY
                     EDGILIYIPDYADFLRVRNHLKEKTTVLFGDINEYSDQRQLNSNRALFQQGRVKVLLY
                     TERLHHFRRYEIKGAKSIVFYQPPGNSEFYGEVVRFLAKSALLGTADLNISTVRTIYS
                     KLDGLRLERIVGTKRAAVLTRGQNEVYEFK"
     gene            complement(<428999..>429217)
                     /locus_tag="HG536_0A02270"
                     /db_xref="GeneID:59323507"
     mRNA            complement(<428999..>429217)
                     /locus_tag="HG536_0A02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281190.1"
                     /db_xref="GeneID:59323507"
     CDS             complement(428999..429217)
                     /locus_tag="HG536_0A02270"
                     /inference="similar to AA sequence:RefSeq:NP_878158.3"
                     /note="ancestral locus Anc_2.291"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137085.1"
                     /db_xref="GeneID:59323507"
                     /translation="MSALFNFKSLLQVILLLICSCTYIHAQWPSLLDRYKDHSAFGAF
                     WKMARVGERASPYVSLACILMAISQLNN"
     gene            <429657..>430442
                     /locus_tag="HG536_0A02280"
                     /db_xref="GeneID:59323508"
     mRNA            <429657..>430442
                     /locus_tag="HG536_0A02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281191.1"
                     /db_xref="GeneID:59323508"
     CDS             429657..430442
                     /locus_tag="HG536_0A02280"
                     /inference="similar to AA sequence:RefSeq:NP_012173.3"
                     /note="ancestral locus Anc_2.290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137086.1"
                     /db_xref="GeneID:59323508"
                     /translation="MKIQTNAVNVLERTSAYLRSGLLKNTPAWYDVVASVPPRTRFAR
                     EPRLLNPSNMKKLTELREQMGELNGKGLYKTRASSLDRKINTSKLYRAPKLQFFEDQL
                     REVFYQQHPWEFSRPKMLVENDAEEEYDWSRIQQLGKPLDGESVVQRTLYLLKESPGK
                     SVVEAYDQARFEFYRLRMQQEVEQQVAQEECEMFGSVYGTSAIDFGVEQEQKVIDVWK
                     QKALEETDLLAARRANPSETWAAAEDEEGKKGPEDQNTEEIVL"
     gene            complement(<430512..>433334)
                     /locus_tag="HG536_0A02290"
                     /db_xref="GeneID:59323509"
     mRNA            complement(<430512..>433334)
                     /locus_tag="HG536_0A02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281192.1"
                     /db_xref="GeneID:59323509"
     CDS             complement(430512..433334)
                     /locus_tag="HG536_0A02290"
                     /inference="similar to AA sequence:RefSeq:NP_014375.1"
                     /note="ancestral locus Anc_2.288"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137087.1"
                     /db_xref="GeneID:59323509"
                     /translation="MVSTELNSHSLVLEFSEDDSDFSTDSRLEDGVSDVTDEHEMAYY
                     ERAVVEIARGDKYICMICTVEMDYSCKMYACEGCYRVFDFECIREWALKSTKKTAERI
                     WKCPNCYRVNSRVPPSGRPTCWCGKVVNPEPNPLDPNSCGQTCDAPICPHGCSKQCHL
                     GPHPQCERTSTIRCRCGKHSKEVFCYDLSSMKGRHKFECRETCGLPLACGIHTCEKLC
                     HSGLCGPCPAKLYSKDEEHRIRCYCGLESKDSIECKNVKVAGELSKNKAGDSWIGAFS
                     CSRKRKLEYRCHKHSFVQACVPSPSISGTLPCPYSPKLLKTCPCGRTPLKDLGSPRKA
                     CTSPIPNCDSICGKKLACGKHTCPFRCHDGPCMDPCSQIEVRRCACHQRLFSVSCQFQ
                     GEPRCNIKCESLMSCRRHRCTERCCSGRPDAERRRKIAYSSRELLDESLVESQHICLK
                     ECNLTLSCGIHKCQMKCHPGKCPPCLESDSNDMVCPCGKTVVEAPVRCGTKLPPCRYP
                     CIRVVEGVSSCAHRPTPHACHSLAEPCPPCTAIVFKPCKCGKRTKVRTLCFQNDVSCG
                     TTCNKQLENCPHLCQKSCHLPGECQKSCKQICNRQRTHCQHKCPLRCHGNSECPDLPC
                     TVVVPVTCQCGLTESFVTCGANSEAVSSQATAVLPCTEECEIHKRHLQLKEAFGISDC
                     SDPVSRARTESCESLALTATTFEQLELPYSEQALGTFARQQAWCAQIEETLNKFMNDD
                     EKTSLHFKPMKPAQRLFVRHLAKSYNLYSESQDPEPKRSVFIKKLDNGSSIIPKIRLA
                     DSLVIYQSFKQMEKEKKAQRMESQTTTRLINFPSVEEAKLKRAENNAFMLTNLSAGTA
                     EEDLVRLFAEHLKPTLVKNPLFKVVKSRKTAYIYPEDYTDISANVERDLEALVGHFDY
                     ICKECFIGDGVELCHIDVSTFEEPAE"
     gene            <433593..>434702
                     /locus_tag="HG536_0A02300"
                     /db_xref="GeneID:59323510"
     mRNA            <433593..>434702
                     /locus_tag="HG536_0A02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281193.1"
                     /db_xref="GeneID:59323510"
     CDS             433593..434702
                     /locus_tag="HG536_0A02300"
                     /inference="similar to AA sequence:RefSeq:NP_012172.1"
                     /note="ancestral locus Anc_2.287"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137088.1"
                     /db_xref="GeneID:59323510"
                     /translation="MLRSTVGRLVARRAYASAPKSMTIGLIPGDGIGKEVIPAGKQIL
                     EKLTGKHGLSFDFIDLQAGWGTFQETGKALPQETVQVLKNQCQGALFGAVQSPTTKVE
                     GYSSPIVALRKELGLFANVRPVKSVEGTKDRPVDMVIVRENTEDLYIKVEKTYVDEAT
                     GTRVAEATKRISEVATRKIATIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREI
                     CKDVYESNKDKYGQVSYNEQIVDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVG
                     SLGVVPSANVGPEIVIGEPCHGSAPDIAGKGISNPIATIRSTGLMLQFLGHNEPAQDI
                     YRAVDANLREDKIKTPDLGGNSTTQEVVDDILSKL"
     gene            complement(<434782..>436236)
                     /locus_tag="HG536_0A02310"
                     /db_xref="GeneID:59323511"
     mRNA            complement(<434782..>436236)
                     /locus_tag="HG536_0A02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281194.1"
                     /db_xref="GeneID:59323511"
     CDS             complement(434782..436236)
                     /locus_tag="HG536_0A02310"
                     /inference="similar to AA sequence:RefSeq:NP_014376.3"
                     /note="ancestral locus Anc_2.286"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137089.1"
                     /db_xref="GeneID:59323511"
                     /translation="MNFYRDATWVLEYVEEEDKKDRLSGSMQTLVLKSCQRFKLKSDP
                     KHLYAVLDSCWRYKPYLETIMRKSEIYRDIPKKKGKPLYSKLTLLLLCHDLLVSKQKR
                     IQMGKLPIKEFVLKHKARLNSELVKLKLKLGVKDLSELVDKDEIGNDVTPVRWIRINP
                     LRCADYDTTNVLVELKRKFPNRADHWADIQPGSLYHDEFIPNLFGVHPRDKITSHELY
                     RQGKIIIQDRASCFPAHILNPGKDDVVIDACAAPGNKTTHIAAHLQPRAGNDQSPRIY
                     AFEKEPARAKVLKKMINVAGCSSFIEINVGDFTKLAIPEKFKDVTGLVVDPSCSGSGI
                     FGRKSVDSHNVAKKKADGELQVPEEEEKMVEDDVKDRLNKLASFQFQVVKHAMSLPKA
                     RKIVYSTCSVHAEENEQVVIDLLLDKKVQQWGWRVAPRDKVIPTWPRRGIVEEFEQVF
                     RDDSEKCQRLAEGCIRALPRKDGGIGFFAVCFER"
     gene            <436528..>438660
                     /locus_tag="HG536_0A02320"
                     /db_xref="GeneID:59323512"
     mRNA            <436528..>438660
                     /locus_tag="HG536_0A02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281195.1"
                     /db_xref="GeneID:59323512"
     CDS             436528..438660
                     /locus_tag="HG536_0A02320"
                     /inference="similar to AA sequence:RefSeq:NP_014377.1"
                     /note="ancestral locus Anc_2.285"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137090.1"
                     /db_xref="GeneID:59323512"
                     /translation="MSTEVVKIENGDSLPEKRRIEEPEDGAALKRIQTPVAQGDSVGR
                     KVIVPTCAPKLHYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILA
                     ENGLINDPTLSGLDDIGNLMLKIPVREATDEEILQVHSKEHLEFIEKTSKMTRDQLLK
                     ETETGDSVYFNNDSYFSAKLPCGGVIEACKAVVEGRVKNALAVVRPPGHHAEPEAAGG
                     FCLFSNVAVAAQTMLKSYPESVRRILILDWDVHHGNGTQKAFYNDDRVLYISLHRFEL
                     GRYYPGTINGQYDQTGEGKGEGFNCNITWPVAGVGDAEYMLAFEQVVMPMAREFQPDL
                     VIVSSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNICVALEGGYDLDSIARSAL
                     SVTKVLIGEPPDELPEPTKDPKLEAIEMIDKVIHIQSKYWKCFKRKYGNAGCNFSEPV
                     TDSIVSKNFPLQTAIRQEQFHQLSRENGFVELPIEKLEIPDDSILCSSDLYERSTIII
                     LVHNTPEIWAKRDAITGAIDPASSVIVDSPLDVIKWALDRRYGVIDINIPQSLFEQDN
                     FSAVVTSQEVVLYLWDHYIKYIPSLSRVAFVGVGDAYAGIVHLLGHRDTRAIVKAVIS
                     FVGRKQLRPLVPLVDESLSDWYFKNSLVFTDKNHPCWAENENKKPRKKYGRVLRCETD
                     GLNSNMEERFEEATDFILDSFEEWSDSD"
     gene            complement(<438946..>440898)
                     /locus_tag="HG536_0A02330"
                     /db_xref="GeneID:59323513"
     mRNA            complement(<438946..>440898)
                     /locus_tag="HG536_0A02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281196.1"
                     /db_xref="GeneID:59323513"
     CDS             complement(438946..440898)
                     /locus_tag="HG536_0A02330"
                     /inference="similar to AA sequence:RefSeq:NP_012171.1"
                     /note="ancestral locus Anc_2.284"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137091.1"
                     /db_xref="GeneID:59323513"
                     /translation="MNRPDIGTYSPGVVLTVGSHYAKVLKYLTSGGFAQVYTAEIQPA
                     DSFAQSNIACLKRVIVPDKSSLNTLRAEVDAMKLLKNHKHVVSYIDSHAAKSSFQDGS
                     YEVLLLMEYCAGGGLIDFMNTRLQNRLQEFEILSIMSQVTQGIAAMHALVPPLIHRDI
                     KIENVLISHNGDYKVCDFGSVCGAIRPPKNPQEFAFVQHDVLKNTTAQYRAPEMIDLY
                     RGDPIDEKSDIWALGVFLYKLCYYTTPFEKGGELAILHSRYQFPAHPIYSDRLKNLIR
                     MMLMVEPSQRPNVCQTLEEVSRMQGVQCPIKNFYLIRAMQQHADQKQLHYSKTQPVLN
                     VPIMNQPMMNQSLGSNLQAAIPVSTHLTISKSGPQLSNRPNSTAGTGVGMALLQPDVR
                     PLSQKSGETYGILTRASKKPPVSSPDVFPSGRGDVNKIVSANVTSFDRPVYVDSVTQT
                     TEPETGVITSAVSTNSQQKKIFPSSSGPAATKPLSSSSKKTLKEEQDHISSRSRSGGS
                     VSTGTEFTSRAGNFAPQMSQASMGNREVKESIQKRVHDLLTSSEDLPASKVEHDQTKQ
                     EARCNDDRHIRHNANGDSDKGARKTKERPRPPPKPAHLRLSQSTKPTQFMAKRITRAG
                     SIKEERENSIIDGKADNFRKKVSGVL"
     gene            441563..441636
                     /locus_tag="HG536_0Atrna2I"
                     /db_xref="GeneID:59324262"
     tRNA            441563..441636
                     /locus_tag="HG536_0Atrna2I"
                     /product="tRNA-Ile"
                     /note="codon recognized: AUU"
                     /db_xref="GeneID:59324262"
     gene            <441988..>443259
                     /locus_tag="HG536_0A02340"
                     /db_xref="GeneID:59323514"
     mRNA            <441988..>443259
                     /locus_tag="HG536_0A02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281197.1"
                     /db_xref="GeneID:59323514"
     CDS             441988..443259
                     /locus_tag="HG536_0A02340"
                     /inference="similar to AA sequence:RefSeq:NP_014382.1"
                     /note="ancestral locus Anc_2.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137092.1"
                     /db_xref="GeneID:59323514"
                     /translation="MSEQQSTQEVPPAAEVGNEEKSSEEPSVVPANAIKGGRETSDKV
                     LYVGNLDTSINEEVLRQYFQVGGAIANVKIMVDKNNSNANYAFVEYHRSHDANIALQT
                     LNGKQIENNVVKINWAFQSQQASPDDKTFNLFVGDLNVDVDDETLRNAFKEFPTYLQG
                     HVMWDMQTGGSRGYGFVSFGDQEEAQKAMDAMQGHELNGRPLRINWAAKRENSSGSHP
                     RRNGGPRNGFRYNNGGFGPGGRDVHMPPPNSMGLPIGAVPAPQAPSGPLVPPPVNPQA
                     VDSMIRRAPLRVTTAYIGNIPHFATEADLIPLLQNFGFIIDFKHYPEKGCCFIKYDTH
                     EQAAVCIVALANFPLQGRNLRTGWGKERSSFMPMKQQAPQPPQQEQQEQQEHQKQREQ
                     QEQQEQQEQQEQAQQQDFSASEAAEPDQNSQ"
     gene            <444017..>446344
                     /locus_tag="HG536_0A02350"
                     /db_xref="GeneID:59323515"
     mRNA            <444017..>446344
                     /locus_tag="HG536_0A02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281198.1"
                     /db_xref="GeneID:59323515"
     CDS             444017..446344
                     /locus_tag="HG536_0A02350"
                     /inference="similar to AA sequence:RefSeq:NP_010161.1"
                     /note="ancestral locus Anc_2.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137093.1"
                     /db_xref="GeneID:59323515"
                     /translation="MSLFWELLQKKIASVFIEPSNRNQGTSFVITVVIIVATGAYLIF
                     KSRKFVMASLPSIGDITSYNASNAIRRWMPRGGQMDAEVLKRGGYIAGLVNDGNTCFM
                     NSVIQSLASSEELVKFLDNVIAKKQRIDAGGESEEEEKAVLEENNLQGRKSKGKIYGR
                     AKKHANRKLANGKHEEETEPDVTFSLALRDMLDKLNFKYYKDRPCFKTNKLLKVMSKS
                     PNKNMLLGYDQEDAQEFFQTILSEIERNAKSVDAKEPERQPIAEEDLPEGAVIGQAHL
                     NVVGDVFLPAEQIDPNLLLTKGGKKFYTPYRLVTPFDGITAERIGCLQCGENGGIRYS
                     VSSGLSLNLPNEDIGSTVKLSDLMNEWIKPEIIEGVECNRCALEAVREHLLEQLKQYE
                     SKGDSIPEKLLKAFQARVEELDRSLAQPVVSDEDYKRLHTENMVRKCSKSKQILFLRP
                     SPLLSIHINRSVFDPRTYMIRKNNAKVLFKSRLNLSPWCCDIDEINLDARLPMSKKGD
                     IAADSSDEENVGNEYYTRLHQTYEREFEDEDEDEDEDEEEEEEEGDSRYVNRDVSNYD
                     PLNGEADSASSFSNIDHEDRSDEEYLEETDALGNTITKRIPKDRIDGGLDESKEAIHI
                     DGEQDGANHISSESDDEEEEQTAPPPPAMAAPIRSTVPSGPLTYVLRSVIVHYGTHNY
                     GHYIAFRKYRNIWWRISDETVYTVDEAEVLSTPGVFMLFYEYDYDESSGEMKEDMADE
                     EDIDEKSLGQVEDNCASDVSPESDAGKDNDGETAE"
     gene            complement(<446435..>446851)
                     /locus_tag="HG536_0A02360"
                     /db_xref="GeneID:59323516"
     mRNA            complement(<446435..>446851)
                     /locus_tag="HG536_0A02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281199.1"
                     /db_xref="GeneID:59323516"
     CDS             complement(446435..446851)
                     /locus_tag="HG536_0A02360"
                     /inference="similar to AA sequence:RefSeq:NP_010162.1"
                     /note="ancestral locus Anc_2.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137094.1"
                     /db_xref="GeneID:59323516"
                     /translation="MEIYVYLIVFAVVLLFVVLLPMVSGIGSFSIDKPVKKSSGSTKE
                     SKMKEPFKFKLRKEDNEPENASAFSSARKTGKFQVDPKTGLKRRVIGKFDEDPNNYDY
                     DLDDLLNEDRVEEEKAQVRRLQKFQGSTEKAYEELV"
     gene            <447046..>447582
                     /locus_tag="HG536_0A02370"
                     /db_xref="GeneID:59323517"
     mRNA            <447046..>447582
                     /locus_tag="HG536_0A02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281200.1"
                     /db_xref="GeneID:59323517"
     CDS             447046..447582
                     /locus_tag="HG536_0A02370"
                     /inference="similar to AA sequence:RefSeq:NP_010163.1"
                     /note="ancestral locus Anc_2.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137095.1"
                     /db_xref="GeneID:59323517"
                     /translation="MLKRSAARLFSRRFGAITRPTAARNASLIRHLTSPVLQPQGRFL
                     RSLRLYSTASTDGHDIPPEVLNLSAQEYQAEADRCLETLLDDLEALSDDYPDRIPDVE
                     LTQGVMTLQVANVGTYVINKQPPNKQIWLSSPVSGPNRFDLYKGDWISLRDGSSLLDI
                     LSSELDDAIPEQEIQLRH"
     gene            <447856..>448089
                     /locus_tag="HG536_0A02380"
                     /db_xref="GeneID:59323518"
     mRNA            <447856..>448089
                     /locus_tag="HG536_0A02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281201.1"
                     /db_xref="GeneID:59323518"
     CDS             447856..448089
                     /locus_tag="HG536_0A02380"
                     /inference="similar to AA sequence:RefSeq:NP_014383.1"
                     /note="ancestral locus Anc_2.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137096.1"
                     /db_xref="GeneID:59323518"
                     /translation="MSGKSYIVTLKDTVPEGEVSKFKQFIDSLGGAITHEFSLIKGYT
                     VHLPEALHIDKLKDGFGSIIANVEEDKEVSIQK"
     gene            <448313..>451543
                     /locus_tag="HG536_0A02390"
                     /db_xref="GeneID:59323519"
     mRNA            <448313..>451543
                     /locus_tag="HG536_0A02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281202.1"
                     /db_xref="GeneID:59323519"
     CDS             448313..451543
                     /locus_tag="HG536_0A02390"
                     /inference="similar to AA sequence:RefSeq:NP_011359.1"
                     /note="ancestral locus Anc_2.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137097.1"
                     /db_xref="GeneID:59323519"
                     /translation="MAEHRINYDPQFKPVQGIYESRLRQFIDEGDYRDLNLPKLYDKE
                     RIELDQDRVKVWWYQVKFEPGSSPVSPDKRPPWKSIIEADRKGKLEFREASKGQPFGP
                     SWSTTWFKIELNVPQHWADSKEQLVFQWNCENEGVVIDPDTLIPKTAFSGGERTEYLL
                     PTNGSNKHFFYIEAGNNGMFGCGMGSDINPPDDNRYFTLRTADIVWPDWEARALRIDF
                     WMLGDAARELPDDSWQKHRARHLGNKVMDMFDPNDRSTIKECRDYLKKEYFDALTDSE
                     KVYSKGDLTVLTNVYGMGNCHIDTAWLWPFAETRRKIVRSWSSQCTLMDQYPEYQFVA
                     SQAQQFKWLLEEHPEFFKKVLTPKVQQSQFFPIGGSWVENDTNIPSGESLARQFFFGQ
                     RFFLKHFGLKSTIFWLPDTFGYSSQVPQICQLSGIDRFLTQKLSWNNINSFPHSTFNW
                     SGIDGSQLLTHMPPGNTYTAAAHFGDVLRTAKQNKSSEFYGSGLMLYGIGDGGGGPTA
                     EMLEKMRRIRSLYNRNGNIIPKLQVGSTIDEFYDDICSKTNKTQDLPTWSGELYFEFH
                     RGTYTSQAQTKRLMRLSEVKIHDLEWLATKASVLFPNDYKYPINEINALWENILLCQF
                     HDVLPGSSIEMVYKYEAVPMLKAVVDKCGDLIDKALEVLKGPSSDEITEARTWVWPGV
                     SETENEASESSVNIQVHDDEFILTNAELKVTIGKKSGTIKSIVDIKSGTEFLDLEHGR
                     NKLGANQFVIFDDKPLSWQAWDTELYSVNQYKYLDKPESVKVVEHSKATCAVEVVICI
                     SDQCKLRSRISLNAVKPGTEGESTVDISTIVENWDATNKFLKVEFPVNVRNEFASYET
                     QFGITKRPTHYNTSWDVAKFEVCHHKFADYSEFNKGVSILNNCKYGFSTHGNLMRLSL
                     LRSPKAPDAHADMGTHEIKYAIYPHRGPLSSKTIKLGLQLNYPDKYPISSKLSKRYED
                     IIKIEGDDNVILSNLKRGEEDQQLNSDYALKPCEETTIVVRVYEALGGESNATLLTCL
                     PIKKVVRIDNLELKALESVKYEAGNKINKIPLKLRPFEIASYKLFF"
     gene            <451697..>452788
                     /locus_tag="HG536_0A02400"
                     /db_xref="GeneID:59323520"
     mRNA            <451697..>452788
                     /locus_tag="HG536_0A02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281203.1"
                     /db_xref="GeneID:59323520"
     CDS             451697..452788
                     /locus_tag="HG536_0A02400"
                     /inference="similar to AA sequence:RefSeq:NP_011360.1"
                     /note="ancestral locus Anc_2.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137098.1"
                     /db_xref="GeneID:59323520"
                     /translation="MASIPNHAKHVRFLERHLSLLPGSQQEHDVNKMAVVFYSFTGLM
                     ALGIDVAEKYRSSLDWIHRHYITIKLPGWQQTISGFTGSLSVQIPGVNTVSLPNTLFA
                     LLVLKLMKDETFWDNHLDRQNIMTFVAKCQSPENGSFSSTLDYKNLKPSPVDPKDLRF
                     CYIAISILYLLGCRNHNEFARHINLDKLLNYILSQQCEMGGFGSYNEAHAGYTSCALS
                     ALYLLGKLDQLSDEFKERTISWLCQRQVSREGCMSLLEPNANYDHDDHGGFQGRENKF
                     ADTCYVFWCLNSLRILGTQGCELPARLDLAEQFLLHRTQNTLIGGFSKNDQDDPDLYH
                     TCLGIAALKLIEGSFDGVLFMPKNDAGLC"
     gene            complement(<452826..>453719)
                     /locus_tag="HG536_0A02410"
                     /db_xref="GeneID:59323521"
     mRNA            complement(<452826..>453719)
                     /locus_tag="HG536_0A02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281204.1"
                     /db_xref="GeneID:59323521"
     CDS             complement(452826..453719)
                     /locus_tag="HG536_0A02410"
                     /inference="similar to AA sequence:RefSeq:NP_010164.1"
                     /note="ancestral locus Anc_2.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137099.1"
                     /db_xref="GeneID:59323521"
                     /translation="MVERSVKTRAHLVGGFAGGLASALTLQPLDLLKTRIQQSKDITL
                     WSAIKQVDSIKGLWRGTLASSIRTSVGSALYLSSLNLMRTALASSRKAGSSLGRSSKL
                     PQLSMYENLLAGVLARGLVGYITMPVTVLKVRYESTLYQYRSLGEATKDIYVKEGVRG
                     FFRGFGPTCLRDAPYAGLYVLLYERSKVVVPKLLPKTVISYDPQGNYSTYTSTFVNAL
                     SAIFSASLATTITAPFDTIKTRMQLEPTKFTSFLRTTVVISKEENILQLFSGLSMRLA
                     RKALSAGIAWGIYEELIKKFM"
     gene            complement(<453897..>454724)
                     /locus_tag="HG536_0A02420"
                     /db_xref="GeneID:59323522"
     mRNA            complement(<453897..>454724)
                     /locus_tag="HG536_0A02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281205.1"
                     /db_xref="GeneID:59323522"
     CDS             complement(453897..454724)
                     /locus_tag="HG536_0A02420"
                     /inference="similar to AA sequence:RefSeq:NP_011361.1"
                     /note="ancestral locus Anc_2.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137100.1"
                     /db_xref="GeneID:59323522"
                     /translation="MDDLASIRKLDRDWEGILALDVKHANLTDDFTFERAIRFLPLSQ
                     QAKIYQLRTLQGKYAAVCNRLLQLFGCSIASGIGFGEVEFEHSSYGKPRMKNCPQISF
                     SMSNGQDYVVQYICRRNDGDPAELGVDIASRDDYLGGHDLETFCEVFSDTEYKHLQSL
                     DDGMRRKAFAFYWSLKECYSKYTGLGLNCDLSKLDYGGMQVPEVGSGSQRLIDNDSML
                     FYSVWIPRHGKEIVTVCRQDDLKEPALSRWLKSGPPVYRITLEDILGFLEAGDARRP"
     gene            <454873..>455880
                     /locus_tag="HG536_0A02430"
                     /db_xref="GeneID:59323523"
     mRNA            <454873..>455880
                     /locus_tag="HG536_0A02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281206.1"
                     /db_xref="GeneID:59323523"
     CDS             454873..455880
                     /locus_tag="HG536_0A02430"
                     /inference="similar to AA sequence:RefSeq:NP_011362.3"
                     /note="ancestral locus Anc_2.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137101.1"
                     /db_xref="GeneID:59323523"
                     /translation="MSKVKDDRKDLFESAVSFLGDASVKEAPLTKKIEFLQSKGLTQE
                     EVELALREAQEKSGGKRTGTTYRELSGARHDESVYEAMPPPIPRRDWKDYFVMATATA
                     GLLYGVYEITRRYVIPNLLPDSKSKLEQDKEEIQSYFDKVDKVLNAIEEEQEKARARD
                     DEKLEELEATIYQLQTCLEKTAKTRDKMEDEFKMLKLEIMNLQSTIDKHILNKENVRE
                     LEKVNNELSSLKNLINSTMSDNANDEHGRGHKSPLSKNAIPGADTIPSAADILTKLNL
                     DKKEGTPAWKKARDESLGSAGSSIPEWQKSSLNEVNIPNWQNTLERAELEEDNENSEP
                     N"
     gene            <456281..>459523
                     /locus_tag="HG536_0A02440"
                     /db_xref="GeneID:59323524"
     mRNA            <456281..>459523
                     /locus_tag="HG536_0A02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281207.1"
                     /db_xref="GeneID:59323524"
     CDS             456281..459523
                     /locus_tag="HG536_0A02440"
                     /inference="similar to AA sequence:RefSeq:NP_011364.1"
                     /note="ancestral locus Anc_2.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137102.1"
                     /db_xref="GeneID:59323524"
                     /translation="MEDETAYKLALGCAERQITAPDFLNLYKEFYTERLATSGENDES
                     PAADSTAKELCDTLAVDFLRLLNSQKHLIIVDYLVQVLFVNYNTILVHAFLPRLYSVG
                     NSVMLLHFFSQSSAFLANLSDSLIADEVSRDAPGCIIPNVLNANINEISDELVVAIAR
                     FLQLILKNMNGNATIASERTREGTYTLMSRLSKLNRLLHRKISVSLDAKIGFKDANIP
                     ATKDATHDFMSSPTISSPQFIPSPFSTSKVPTSKAFTPKYGDMKLLRFYKNIWLNNKI
                     MNWEPIDSSFLSNYTMIAPTIFQDKGNPAKTVDTELTDLIETSFTCFAQFVSNKQYHQ
                     ANSYFNLLERQWIIFIVKHIPLLILEHSSGNPQVVTNALENIDDKVVKAIRTYYSEKD
                     DVKKANEDLFDDYPSASLDIRHDFIKNLIKLGLQPSALINDYLGEDQMIDTKGLSVTD
                     ELVVTNLQGVQEVISDIASFISTSLDSLDPELITGQATEQAEGLLQILNNFDNISPTK
                     QRELSTSLIGMLQKALVDFDFNRITKICLLLSFNFSHSLTAILSFVTPTKVCEMLMRF
                     IDISWDGCVETKKKEAADSEFETMNIFSSFAWSLLLLIVISQNYDFSLVDVVLQSSDL
                     DLENSFVVPFISKLPEIPDAFFKDVRKAADPNMRAESLLMVEGWLKGLFINGSISDSL
                     VQNVDAKELAMLCPFIFKQVLLALEAQALNDLSNLIGGFEYFLQPFMQIGLIKIVYWL
                     EQYLYSLKSDTIADDVLGNIFTLLDSIFNPSSLNEDSRSFHNAVLRLNAIRLLKVLRK
                     FRVQSQSNYGIYSSEASGHPKLESLIKNLTAALQISPNYNVDPRITSSDNAFPQKQLN
                     YGNIMILNENPINKIMTNQINSFWNLHSSTYYNLDYLREIINLVTPRNFLIDVFRTLE
                     YKLSTYGVPGARNRMSSAESEHVLDYLFYFMALFDIKSQTHAMHLLSLMESNEEQEEP
                     SVSMRLQIKADPVPKQEVAQDDDFDMLFGENDTSTHGADEEIQIINVEEVPKFNHSAA
                     FHRQSFGLILHELKTNYEAALPAGFITQEAYKRIERYHQKYIDILKKCIF"
     gene            complement(<459686..>463960)
                     /locus_tag="HG536_0A02450"
                     /db_xref="GeneID:59323525"
     mRNA            complement(<459686..>463960)
                     /locus_tag="HG536_0A02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281208.1"
                     /db_xref="GeneID:59323525"
     CDS             complement(459686..463960)
                     /locus_tag="HG536_0A02450"
                     /inference="similar to AA sequence:RefSeq:NP_011365.1"
                     /note="ancestral locus Anc_2.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137103.1"
                     /db_xref="GeneID:59323525"
                     /translation="MSLASLLNKEDRDTPSVASREPVMNGNVSKDDRLKAYFLRELNE
                     NFKRLGQRDLLEQQYQDWKFINLQEFELISEWNNQSKEWGNSDASFEQLYREMQTIRD
                     EWDQYDRYKKNKLSLIRELDVANGTNGVEVAEVPSRAKQRRSVKQVTARPQTPPPPSP
                     PPQVERRPQFTTPVRRKRKLDQEEPVQDVVEDQHPKKELDDGSEDIEDDLAEQEESQS
                     DEVDETGDQEADHDSEDLKESEQEELALDGEESSSDEQLDTETAEVEVEVPANFDDDE
                     NDKDFSPDDDVKSITSSKKDKSVNMESDRTRIVRELVKMCNKNRNFKAKKRKFTNANV
                     TEYNPLDKKLVVRITLKQLHVRKLKKAINEAKRAAAMEEAAKEKAENPDFEALSPSGK
                     RRKLLPGANGDLPDGSSLTSSPTKHGLPTYGLKMTAKEARAIQRHYDNTLFTIWKDMA
                     RKDSAKVARLVQQIQSIRAANFKKTSSLCAREARKWQFRNFKQVKDFQTRARRGIREM
                     SNFWKKNEREERDFKKKAEREAMELARKEEEARENKRQAKKLNFLLTQTELYSHFIGR
                     KIKTNELEGNMADHQLSQPGSMMSGMSGHDKIDLDNMIANKNEFHNIDFDNEDDEQLR
                     IRAAQNASNALAETRAKTKEFDDDANGEELNFQNPTSLGEISIEQPKILACTLKEYQL
                     KGLNWLANLYDQGINGILADEMGLGKTVQSISVLAHLAEKYNIWGPFLVVTPASTLHN
                     WVNEIAKFVPQFKILPYWGNANDRKVLRRFWDRKNFRYGKDSPFHVMITSYQMVVSDV
                     AYLQKMKWQYMILDEAQAIKSSQSSRWKNLLSFHCRNRLLLTGTPIQNSMQELWALLH
                     FIMPSLFDSHDEFNEWFSRDIESHAEANTKLNQQQLRRLHMILKPFMLRRVKKNVQSE
                     LGDKIEIDLLCDLTQRQAKLYQVLKSQVSTAYDAIENAAGSDEASSDQSLINTVMQFR
                     KVCNHPDLFERADISSPFCFSEFGQTAALIKSDELAEVMYSSTNPIKYHLPRLIYEDL
                     ILPNYHNNIASFAKLVNYTMNIFSLADNQELCEELSHITGLELSQFSRIAHESIVNRA
                     MRFYTEKDMMKGNQSIAFGDDEIRSDIRDLRIPERITRLEKLSNMTTGGVLQSLLNIK
                     EKVYEDQYFGSMRPASCPAASAPPISIEVLGSSHVVNELNRELFDPTISQALSEISPV
                     TQYNMHIEKGIPIDNFPASALYPDSLNKYFSSHISMPSMDRFITESAKLKKLDELLVQ
                     LKKDGHRVLIYFQMTRMMDLMEEYLTYRRYKHIRLDGSSKLEDRRDLVHDWQTRPELF
                     VFLLSTRAGGLGINLTAADTVIFYDSDWNPTIDSQAMDRAHRLGQTRQVTVYRLLVKG
                     TIEERMRDRAKQKEHVQQVVMEGKMQEKKVQTVETNVEELNTKLKQ"
     gene            <465371..>466501
                     /locus_tag="HG536_0A02460"
                     /db_xref="GeneID:59323526"
     mRNA            <465371..>466501
                     /locus_tag="HG536_0A02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281209.1"
                     /db_xref="GeneID:59323526"
     CDS             465371..466501
                     /locus_tag="HG536_0A02460"
                     /inference="similar to AA sequence:RefSeq:NP_011367.1"
                     /note="ancestral locus Anc_2.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137104.1"
                     /db_xref="GeneID:59323526"
                     /translation="MSTFGHIFRVTTYGESHCKSVGCIVDGVPPGMSLTEGDIQPQLS
                     RRRPGQSKLSTPRNEKDKVEIQSGVEFDKTLGTPIAMLIRNEDQRPHDYSDMDNYPRP
                     SHADFTYMEKYDLKASSGGGRASARETIGRVAAGAIAEKFLNQVSNVEIVGFVSQIGS
                     IKMNRDPFDPNFHHLLNTITREKVDSVGFIRCPDVALAGEMVKEIEKHRGNKDSIGGV
                     VTCVVRNLPTGLGEPCFDKLEALLAHAMLSIPASKGFEIGSGFAGVSVPGSKHNDMFY
                     YDEETKRLRTKTNHSGGVQGGISNGENIYFSVAFKSVATIAQEQETCTYEGKPGVLAA
                     KGRHDPAVTPRAIPIVEAMTALVLTDALLIQKSRDYAKSITH"
     gene            <466860..>469403
                     /locus_tag="HG536_0A02470"
                     /db_xref="GeneID:59323527"
     mRNA            <466860..>469403
                     /locus_tag="HG536_0A02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281210.1"
                     /db_xref="GeneID:59323527"
     CDS             466860..469403
                     /locus_tag="HG536_0A02470"
                     /inference="similar to AA sequence:RefSeq:NP_010166.1"
                     /note="ancestral locus Anc_2.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137105.1"
                     /db_xref="GeneID:59323527"
                     /translation="MSVSVPLAPPFKVKARYGWSGQTKGDLGFLEGDVMEVTRITGDW
                     FYGRLLRNKKCSGYFPNNFVNILEEQLNKSSRSATTEVARPAAKISVPPIPARSRGRA
                     SESSAPKEKPSSKLYEHSSRSTSDLAQDTINTRKTFHYRSRPSHEVADRYGRLGNSQD
                     DLPPLPPIPNMQCDKTSRRLPKSYSSSDVPSSSDSRSYNHYRGNQAFYDGYKPEKSSL
                     NGNSNASGIFSDSRYLATSSASSEESFALMSDFSATSAGSFARHRYAQSFTDSLERSQ
                     SPSSNEFIQAESNSKMSGILKRITPKSNPATGKSITTQSVQYPRLPDIQNLSISASHD
                     EARDWLAVKTHLNRSRSLTKYEKHPRYMRALERNRDLVLHPQDAIYNGLNTNEVTSHG
                     QPGLIDIELSAMNFDYIDKMTRNRCVKDGSLRLDNWAQTTFSARYSTTIEKLRGIYVF
                     CAETFELIDDHGSTDFSHFSKTPKIYDSILHRKHCTPYQLTCLYKALTNALGITCELV
                     FGFLKTPTANDYDFKYNHCWLRVLVNKEWRFIDVILGNTSNPIHEFVKNRKITKADDD
                     YFLVEPLRFIYTHIPQKDFEQHIVPSIDRLSALYLPLVFPSFFTNGLKLYKYSTALAF
                     LEDSEIFECSLEIPSDIELFASVVIPSTGTKVSHEYRKMELALVQVKRHKTDNSQRIA
                     VVKAVLPPGANEGTLYIHSGVRGIQTTVANVHPLSMMVPLKHVGSEMKYEFAVRKPSE
                     SVQKVEMYIIGPQNKFLFANNEYDFEVIQHPFDSVIYSPTALAKNRRQPMAIKSPSGK
                     IYELRKNDPHFAYGTWKTAVHVRETGTWTGLVTADSGVGWCAFAEWLCV"
     gene            <469520..>471832
                     /locus_tag="HG536_0A02480"
                     /db_xref="GeneID:59323528"
     mRNA            <469520..>471832
                     /locus_tag="HG536_0A02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281211.1"
                     /db_xref="GeneID:59323528"
     CDS             469520..471832
                     /locus_tag="HG536_0A02480"
                     /inference="similar to AA sequence:RefSeq:NP_010167.1"
                     /note="ancestral locus Anc_2.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137106.1"
                     /db_xref="GeneID:59323528"
                     /translation="MTNIFFYEVEFIQDKGTYIVNKEDLLKALEGFIVAFLVAIILYL
                     RMEADGEAVQGPNCAVDFANALKDFIAGEFDEEKASDPFDIVREFRSIAAKCAIAVTD
                     KRTETFRDWELEVKLWHLFEILLSFRTADQELESMDVRHFNSSAVFEKQLLHENRELY
                     QIWLIMVWIQTNMTPPSRPSGLPTTKWSNTMMSGGLKSCDLDYPLRNELAQLDPKDKE
                     EDCIFFKYVYELLIAGKIEEALEECKLSDNLTISMILCGMQVYVDPRIDTQVSDDFES
                     RQGIKKHALWRRTVYSLSRDPKLNQYERAIYCFLAGDIPPEGVTDTAGWDSGLLLYLN
                     QILQIEVENYLKSQNKISKDELILLIPSHALDLQTVLNLLSSRYPAESEHPIRVLMGG
                     IILDTLQSVLHSAVKLLLQMIQGQTTENDMADKPYLLRIVTHMSIVLDLVSPGIITPR
                     DKSKLITAYLSIMKLHNLYEVIPVYISFLEEEDVIEAYSFILSTLEDQNVRAEQLEIS
                     NFLRLPTSNILRKTTERVFAETEPDYTPKGEVTVTYDITSVDKHLISSVEWLLQGRLY
                     IDAVDSVIALSRRFLITGKIKSLEYFMNHNSLDDLLKNYKLDMLSQRSGSDDNDVKMK
                     EIQEYQRLIAELKKFDEWRKTVSQLNSESNVPSLIERFQEYSKGTFELIRSFFVELYE
                     QEDHPDRNIYFEIRSLYTPYLIIELHKELVEAALLLKIPTFIREALKFANLVANETDK
                     IYLLFQSSGKLQEYLKLVAQTATLSGDSSL"
     gene            complement(<471922..>472497)
                     /locus_tag="HG536_0A02490"
                     /db_xref="GeneID:59323529"
     mRNA            complement(<471922..>472497)
                     /locus_tag="HG536_0A02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281212.1"
                     /db_xref="GeneID:59323529"
     CDS             complement(471922..472497)
                     /locus_tag="HG536_0A02490"
                     /inference="similar to AA sequence:RefSeq:NP_011368.3"
                     /note="ancestral locus Anc_2.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137107.1"
                     /db_xref="GeneID:59323529"
                     /translation="MKYIQTEQFVEVPQGVTVNIRSRVVKVTGPRGTLVKNLKHIDVT
                     FTKVNERQIKVAVHNGDRKHVAALRTVKSLVDNLVTGVTKGYKYKMRYVYAHFPINVN
                     VVEKDGKKFIEIRNFLGDKKVRLVPVREGVNVEFSTNQKDEMVLSGNSVEDVSQNAAD
                     VQQICRVRNKDIRKFLDGIYVSEKGVINEEA"
     gene            complement(<472786..>473430)
                     /locus_tag="HG536_0A02500"
                     /db_xref="GeneID:59323530"
     mRNA            complement(<472786..>473430)
                     /locus_tag="HG536_0A02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281213.1"
                     /db_xref="GeneID:59323530"
     CDS             complement(472786..473430)
                     /locus_tag="HG536_0A02500"
                     /inference="similar to AA sequence:RefSeq:NP_010168.4"
                     /note="ancestral locus Anc_2.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137108.1"
                     /db_xref="GeneID:59323530"
                     /translation="MIEEHLRLSGTSIEIGLGRKRKPSRKHFTGTAAEVLTIPSTDYV
                     YDIYHLESVPDKEFDAYKEASDVGFVKIVYADMDLVPEEDDDLAEKPLSDDEDSNEEN
                     YYRNDYPEDEDDDRSILFGSEGEEIAIAEKLAGNQTEPYDDLFARLGDSNNILSSLNA
                     MNFVDLDADEGETDSDDKVGDPEMFQNDQDSDEDAMIAYRDRIFGKLQRMIDER"
     gene            <474214..>475155
                     /locus_tag="HG536_0A02510"
                     /db_xref="GeneID:59323531"
     mRNA            <474214..>475155
                     /locus_tag="HG536_0A02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281214.1"
                     /db_xref="GeneID:59323531"
     CDS             474214..475155
                     /locus_tag="HG536_0A02510"
                     /inference="similar to AA sequence:RefSeq:NP_010169.1"
                     /note="ancestral locus Anc_2.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137109.1"
                     /db_xref="GeneID:59323531"
                     /translation="MNLFHQEQTEWLRFRMGHFNMDFSDLTFRNSSQRPSFHKNTVAL
                     VTGGSRGLGLELVLRLASCGIKVINVDVMSPTHKLREADNVYFYRCDITDHDEVKALH
                     EKISSEHGPVTILLNNAGITRINTVDIITHEEIKAVIAVNLIGAYIMINTFLPDMIAE
                     KHGFIVNIASVLGEIAPARLTSYAASKGGLIAIHNSLARQLCRHSKGSRSIKMLLVCP
                     GKINTSMFARVKTPSKILAPDIDPGKLADRIVTAIRCNNITTLRYPYYVNIVPFFKQL
                     SWPYMRLLKKCSGIDKATAVSYSYGDVSPHGHKYNCT"
     gene            complement(<475222..>477096)
                     /locus_tag="HG536_0A02520"
                     /db_xref="GeneID:59323532"
     mRNA            complement(<475222..>477096)
                     /locus_tag="HG536_0A02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281215.1"
                     /db_xref="GeneID:59323532"
     CDS             complement(475222..477096)
                     /locus_tag="HG536_0A02520"
                     /inference="similar to AA sequence:RefSeq:NP_010170.1"
                     /note="ancestral locus Anc_2.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137110.1"
                     /db_xref="GeneID:59323532"
                     /translation="MGNSETAESSQSLSKEAVETAVEAQQSGEEKGQWQEEDGKRNGS
                     DSEEDDARGSSVDPSMIHTAITEKDNPFMQLQDDERDLENRDAKQVSRSRIKPLLNPN
                     EVYQDDMDDILPSKTAEAKERRDSGESSSLNGKFELPKDLNPGRESSGSNSKVQILEA
                     NKLSEGQGRTYIAYTIRYKDALVRRRYSDFESLRNILVKLFPMSLIPPIPEKQSIKTY
                     GKAIAASKPSYLLPSDGTRSVDLSLSVINGSVNNSDERLIRHRIRMLTGFLNKLLLDS
                     EVTKTTIISDFLDPNNTNWSDFITSSATFSSLPRSVLQCNPLDPTATTRIHASLPIPH
                     LTSQSLLHKDNSSRGLEVKDSFQAIEKDYKRYENILSNGIYKYSRRITRNMYDMKHYM
                     KELSEAYAQFAATQSRGAELAEEFSHISNAFDESASELESTVGKFYYNIDEPLSECVR
                     MAGSARDLIKFRKLKRMQLEMIRKYLASKRNQLEKLEEHEKEMKKVDSDVDREMSKSN
                     KINLEHPQPKTYSGKLLNKFNKLASMVKESVNYQDPDLNTSIPTLKAEIQQLKESLEV
                     SENDVEVISTVIKDTKLKEFSSQREKELAEILKNYAKYLREYAQSNLKIWQDIKSTQS
                     "
     gene            <477385..>481632
                     /locus_tag="HG536_0A02530"
                     /db_xref="GeneID:59323533"
     mRNA            <477385..>481632
                     /locus_tag="HG536_0A02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281216.1"
                     /db_xref="GeneID:59323533"
     CDS             477385..481632
                     /locus_tag="HG536_0A02530"
                     /inference="similar to AA sequence:RefSeq:NP_010171.1"
                     /note="ancestral locus Anc_2.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137111.1"
                     /db_xref="GeneID:59323533"
                     /translation="MSCGGLVSKYLPVEAQISLLSELVLKRSFDEVVGLVEATQLSSD
                     NLEEIEKQILEVLKDDLATLSVEGRDASTPDRELRFLAQLIGKMSSLRKLFESWIGSV
                     MIAYAYEYRARLFPDEAHQELLFGFLGAKQSDDLEASAPQSSFDIILLLEFLESACLF
                     SDSTVGVCDFELDAILIGLMGCNDEVVSSKSSNLMRWRINVIAEKCSADTKFDHFCWS
                     LVQQMLASDSTCSWKQANGHAFLLRFLTVSGFTAGLEAFVQTDEYWTAVQAALNESIQ
                     ESRKIGLSILRLTIKKIPDTMRPFSTHLFRWNSLNSGLVKSWQAFTTLYEIVSLDTAL
                     NQIEAASEDILNLFKDPNIHSTWGLLLFSTGLRASMESVRKYMVALLLRIEVKSVFAK
                     DLRNLRNIFLPSTMEAHFFNTDGKSCRYGERLTQFISEVLHESGEDASLVIETILRTL
                     VDQGGSFDPARIYMSLGILDYLEQGKQKPLTSAHLDLITKLCEFENEDAVFETTIQTI
                     FLKYLLHISPSVSPVEWTKCVVSHIKRKQGNYEYISPLLGSFKAFTSSQFTLNVARKE
                     LEPLIGEDPTTDLLALVLFDFKEVPVTQELLIEIAISQENVPELSGNAQSCLLSLAAA
                     RDVDSHLYRSSELLLEYPGLDFSTLKIVKLSPLFDSLIMNFTGDKFKFFVAIYKKFAN
                     NCSDSFTLSWPLLVNLYQTIKANNSDPKTTSFKMKDEIYGTFFELLYFFLVSSPTKVA
                     VKPTELIDLLHENINKDNGNFEGNKAVAKLCAHILGNCKPQHEDEEDWSNVLRIFEML
                     TTIWDNFSCERLVLKQKSLHLATINGLFHPTILLYASSRSENGRNLSKRVHLYGKRII
                     EQAYNRRSILPLISENILSFVEKHGDKLGNADQDYGWLIDSMTGIFTCEQTSVNIFRL
                     KTVIADLFECKLSKNNGLYERIYGVEEVAAKIRIIASLLKAPQQFKDCFISYTFHSTN
                     LLSAKKRTDGAEEIQRLLKWQLILLCLKDSNRRDLISSIPELILNNILDEISPIIRIY
                     MEWTIALLLSDANQNIEEFTSKLFPLMDDHSRPIVVVSAQRILFLILKALAFNKSQTF
                     ENLLSKFTSVLIPNATSSKPLVRHFSNSLMLLFWPSFQEFVKDPTFRLTIKGLYDKAV
                     ATKMSGKYRAGDANVWDINADLTLTGIFGGVLKKTIDHQLPYISKGTFIKFLPSQVSL
                     AVGLDDTSLWLSKRSTKESETEVQQSLSNGLSQLQTKSGAWEALMTIETDGQNKAVKR
                     SDLIVISSLVDKPPNLGGICRLCDVLGVGLLTVHDIRVKNHPQFKNVAVTADKWMPMA
                     EVPVQEISNFMREKKREGYVLIGLEQTDKSVKLDTRYKFPRKSLILLGTEAHGIPGEL
                     LNQLDLCVEIQQFGVIRSMNIQTATAVIVHSYTIQHM"
     gene            complement(<481642..>482439)
                     /locus_tag="HG536_0A02540"
                     /db_xref="GeneID:59323534"
     mRNA            complement(<481642..>482439)
                     /locus_tag="HG536_0A02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281217.1"
                     /db_xref="GeneID:59323534"
     CDS             complement(481642..482439)
                     /locus_tag="HG536_0A02540"
                     /inference="similar to AA sequence:RefSeq:NP_010172.1"
                     /note="ancestral locus Anc_2.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137112.1"
                     /db_xref="GeneID:59323534"
                     /translation="MVLSVTEKLYLYDSLTSVPSVRPDGRKPHQFRPIEIYTDFLPSS
                     NGSSRIIASDGSECIVSVEGKVVDHTAEGELIHVEIDIAGQRDDSPEVESLTSLLKKV
                     LEPRGGIDVSKLRLTKRYSFKLFIDVLVISSCSSPISLISMAIYTALNTTYLPKLVSS
                     FDDLEVEELPTFHDYDLEKLDLSPPVVFVAAVVGDNILMDAAASESEVSNNGLVITWS
                     HGKVVAPIRSVGLSGSGAKGFSFGVLQKAIKMVEDHAPEVLQALNNS"
     gene            complement(<482590..>483366)
                     /locus_tag="HG536_0A02550"
                     /db_xref="GeneID:59323535"
     mRNA            complement(<482590..>483366)
                     /locus_tag="HG536_0A02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281218.1"
                     /db_xref="GeneID:59323535"
     CDS             complement(482590..483366)
                     /locus_tag="HG536_0A02550"
                     /inference="similar to AA sequence:RefSeq:NP_011369.1"
                     /note="ancestral locus Anc_2.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137113.1"
                     /db_xref="GeneID:59323535"
                     /translation="MERFWWIVSMFAFVAGSSVPSDHVGFVLEAVKSAYRSGEQDLDR
                     FCFELESPFVEPTSEFLFVIDVVDTLPFHTDPSRFGGTNVDRDKQSLDMTIHDCANGD
                     LIRSRRRLASGTSVIEVSPSGSRKFCFCFVNLSYDSSWKFIDVIKTITVRMAAHDSIQ
                     KRQRKSQLVKEMALESLQQTERSIRTLLGLADSGERSELLELESERRDLNEEVFNRLL
                     CGEAAFTVAVIASNLLLTRHFIRRHRDRIRDARRNKRFNH"
     gene            complement(<483525..>483887)
                     /locus_tag="HG536_0A02560"
                     /db_xref="GeneID:59323536"
     mRNA            complement(<483525..>483887)
                     /locus_tag="HG536_0A02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281219.1"
                     /db_xref="GeneID:59323536"
     CDS             complement(483525..483887)
                     /locus_tag="HG536_0A02560"
                     /inference="similar to AA sequence:RefSeq:NP_010173.1"
                     /note="ancestral locus Anc_2.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137114.1"
                     /db_xref="GeneID:59323536"
                     /translation="MSAGGIRRPVQIEEFKTAISDMSADELAHLKQEIENSILHLNRS
                     NARLNKYVAKLEGKAKTVEEEDEDDEELQNIEEGDLQLYHDSLRENEILLKNYDERLE
                     ALHQENLYRASAGKKPSS"
     gene            <484263..>486293
                     /locus_tag="HG536_0A02570"
                     /db_xref="GeneID:59323537"
     mRNA            <484263..>486293
                     /locus_tag="HG536_0A02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281220.1"
                     /db_xref="GeneID:59323537"
     CDS             484263..486293
                     /locus_tag="HG536_0A02570"
                     /inference="similar to AA sequence:RefSeq:NP_116577.1"
                     /note="ancestral locus Anc_2.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137115.1"
                     /db_xref="GeneID:59323537"
                     /translation="MSSHQDHYKRRKEGEIAMLTSVEDLLEIDDRIASIESERSQLAA
                     QLELARQAAEKKSSVARKIEVLASEIAQRATDLDSVRQLKAQYGDLKVLCDLEKLYVL
                     QEEQQMAQDQLRQVGDELSELSLVEPGQISLDTLSRLHAELSRIRRLLNTPSPVYDSF
                     ESVLRSSANDLSNKFNRQLLESKWDTPAFVPISTQTIETMRGMSTTLYRLSQLRFTIE
                     EEQTWNFKCIANNFTIRFTYHFHDGNFKLETYFKFLNDYLTENLHKCIGIFHDESFGL
                     TKEYVLDQFIDHVLFPIRREVRSNLMKDDRSVKFALISQILTTDRSLTKNFHYHGDGL
                     VPLIPAEVWDIWLSYEVSTATRQFQQITKDPKDMAKSATDFVRLVNKIYDSLSPFYSF
                     EAESLKRYKLLTCSQIFISLSSAYMDYLLAVDALDEHRTAENELYQTLIKLQNFNVVY
                     RRIFELSQEFVMIQLTETVNLKEGTKYQSLFQNILGEYKKVIDEEIQPSVVRRIKKLL
                     KETLRNYFKIGSWSTLTRDSSVMSAEIVNAVKLLSRIIKRLDALDISLEACLGIKNEL
                     LNIIVNYFIESILKLNRFNHAGLKQLEFDFHALKESLNLPETVSNCQDTILRELLKVL
                     FAKYDDSCRGFFDSSYIKTSEFSALRDMLSISALKDSEIQDALYRVAYGSII"
     gene            complement(<486355..>488376)
                     /locus_tag="HG536_0A02580"
                     /db_xref="GeneID:59323538"
     mRNA            complement(<486355..>488376)
                     /locus_tag="HG536_0A02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281221.1"
                     /db_xref="GeneID:59323538"
     CDS             complement(486355..488376)
                     /locus_tag="HG536_0A02580"
                     /inference="similar to AA sequence:RefSeq:NP_010174.1"
                     /note="ancestral locus Anc_2.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137116.1"
                     /db_xref="GeneID:59323538"
                     /translation="MSRAAEPQILFNYTSAVGVGELERYVITYDLYEGDEIPPDVPLD
                     SLWLRVKNMESLSYRAAYLMGPFILYCDVRTEDYHHSQKIIASVDQPKFEPTLQAQQS
                     CIAELSVHRIKPRYVWIVDIVSQILFTTNTQVTFQIVLGNSKEAVSDKFIHGTTTAAS
                     SDKITVSRLTTLDIWNLPAQINSHYKKKHLVVLTHGLHSNVSADMAYMMEQIYKAQGK
                     HLDEQIVVKGYTENICQTERGVKYLGTKLAKYIIEELYDDSVTKISLIGHSLGGLVQA
                     FAIAYITVKYPWFFDKVQPINFVAMASPFLGIVTDNPAYINLLLSFGVIGKAGQDLSL
                     EKEPETDSPLLALLPGEPVKNIMARFKRRTLYMNAVNDGIVPLYTASMLFLDYEEVLK
                     ELKKLEGKELNAESSNIDMVRGDFLNRTVVSPFTKMLGLLAPQKFPQSRSTIPKVSFL
                     ESAVSLLIPPLPDKSYILDPSSRDPVIIHDKIYTADDIPPEPAKLESTFEGNTNILLS
                     SFTMARGNTGESQKMEESIARQWHDGLSWRKVVVALKPDAHNNIIVRRRFANAYGWPV
                     LDHLVDVHFSGDTFDESIALDGDGCDEQTASGDPKVDMKEPNKRYAWITRLDNPKLFD
                     EGPTGMISTIGEMLGTFVKDRLASFISSETSVPANEDKLISYEYMNGEI"
     gene            complement(<488556..>489770)
                     /locus_tag="HG536_0A02590"
                     /db_xref="GeneID:59323539"
     mRNA            complement(<488556..>489770)
                     /locus_tag="HG536_0A02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281222.1"
                     /db_xref="GeneID:59323539"
     CDS             complement(488556..489770)
                     /locus_tag="HG536_0A02590"
                     /inference="similar to AA sequence:RefSeq:NP_011372.3"
                     /note="ancestral locus Anc_2.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137117.1"
                     /db_xref="GeneID:59323539"
                     /translation="MNFTKTLRLMRNTTLLRQPSFVARRWSTTTSPTIDDVEELHPSL
                     ISRIKQYVEQLHGLEQMLAAGGSFNAASQILYAKASSIKDIYERYQDQLEGLKALREM
                     MDDDPSLKEDAEAEYAKLVPQLAKTSSELLRKLIPPHEFADKPCILELRPGVGGIEAM
                     IFAQDLLNMYAGYAQSKRWKYHLTSKTENQSGSGIVDAILSIDEPGSYDVLKHEAGVH
                     RVQRIPATETKGRTHTSTAAVVVLPQMGNESEKAADAYERSFKPDEIRIDVMRASGKG
                     GQHVNTTDSAVRLTHFPSGIVVSMQDERSQHKNKAKAFAILRARLAERERLEREEKER
                     SARKDQVTTTDRSDKIRTYNFPQNRITDHRCGFSMHDIEGVMSGERLDDLINAMEAYD
                     SDLKARKILQEV"
     gene            <490141..>490914
                     /locus_tag="HG536_0A02600"
                     /db_xref="GeneID:59323540"
     mRNA            <490141..>490914
                     /locus_tag="HG536_0A02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281223.1"
                     /db_xref="GeneID:59323540"
     CDS             490141..490914
                     /locus_tag="HG536_0A02600"
                     /inference="similar to AA sequence:RefSeq:NP_010175.1"
                     /note="ancestral locus Anc_2.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137118.1"
                     /db_xref="GeneID:59323540"
                     /translation="MSAIREVKYLQEIQHENVIELVDIFLAYDNLNLVLEFLPSDLEK
                     VIKDKSILFTPADIKSWMLMTLRGIHHCHRNFILHRDLKPNNLLISPDGQIKVADFGL
                     ARTFPSAQEMLTSNVVTRWYRAPELLFGAKHYTSAVDIWSAGVIFAELMLRIPYLPGQ
                     TDVDQIEVTFRALGTPTDKDWPDVSFFPAYNKLQIYPPPSREELRRRFIAASENALNF
                     MCGMLTMNPQKRWSAVECLESDYFKEAPAPSDPSTIQIS"
     gene            complement(<491005..>492237)
                     /locus_tag="HG536_0A02610"
                     /db_xref="GeneID:59323541"
     mRNA            complement(<491005..>492237)
                     /locus_tag="HG536_0A02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281224.1"
                     /db_xref="GeneID:59323541"
     CDS             complement(491005..492237)
                     /locus_tag="HG536_0A02610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137119.1"
                     /db_xref="GeneID:59323541"
                     /translation="MFRLQGRDLMRLSSIQSVRRFSQTAVAAAADYSHIIIGGGVVGL
                     AIAAELSKVPTNNVLLLDKNERFGMETSSHNSEVIHAGIYYPPNSLKSQLCVEGKHII
                     YKELTPAKTGVSWLNCGKWIVAQTDQEDAVNETLFRRCREELDIEVEMLSSQKAAKLE
                     PFINVQRSALSSPSSGIINSHSLIEYLAAIIQQNGGDMVHGSKVIGLEYSKNGGYTVT
                     CKDNYSDDTQPVEITAENIVNSGGLYADQICNMLLPKDRHKRLYFAKGNYYKLNNAGF
                     PPVNRLIYPVPPQDGKSLGTHLTIDMDRQIIFGPDLEYVDSRTDYKPNPQNMPAAFEA
                     ISRYYPHIDAADLEVSTCGIRPKLSGPDVKVFDDFYIKEEEEFPGFVNLLGIESPGLT
                     ASVAIGKYVMRIYHAQVG"
     gene            <492459..>493592
                     /locus_tag="HG536_0A02620"
                     /db_xref="GeneID:59323542"
     mRNA            <492459..>493592
                     /locus_tag="HG536_0A02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281225.1"
                     /db_xref="GeneID:59323542"
     CDS             492459..493592
                     /locus_tag="HG536_0A02620"
                     /inference="similar to AA sequence:RefSeq:NP_010176.1"
                     /note="ancestral locus Anc_2.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137120.1"
                     /db_xref="GeneID:59323542"
                     /translation="MMYRSIYGCVRRYATISQQVSRPPFEEIFPRKRMINRILFELDS
                     RLSFKKLYPLFESSYNDMDEDTISLGSNVSASDVMLMKKVLEKVRSRTKSANLHLLKL
                     ESALLDKAAEMGDKDAIALVAFDVLKDPSRNSQEDVDYAKLLIKDLYKREHHLTLKLT
                     GDLALRGGDSLQAADYYQHFLRLEADTYLAGEVYGQLGQMSFQDTDLLSAERYFRKAI
                     ALSPLEYSVHSYYYLAQIYMNSDPLKARTLMESCATQGYRESFKALGFLEMHYFGDLY
                     KAQEWFKLGMELYELECFIGYFDCCASLGEWTLAKKCLKSLEKMGDANETYKTIVGQF
                     MEARKEKIEKALSFQSDPLLYPNTMKDGSKQSELSIKQNKWGL"
     gene            complement(<493595..>495391)
                     /locus_tag="HG536_0A02630"
                     /db_xref="GeneID:59323543"
     mRNA            complement(<493595..>495391)
                     /locus_tag="HG536_0A02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281226.1"
                     /db_xref="GeneID:59323543"
     CDS             complement(493595..495391)
                     /locus_tag="HG536_0A02630"
                     /inference="similar to AA sequence:RefSeq:NP_011373.1"
                     /note="ancestral locus Anc_2.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137121.1"
                     /db_xref="GeneID:59323543"
                     /translation="MKPIRALLQRIPKLLIVLTAFRLINAISTRTFFQADEFWQALEP
                     AHYKAFGFGQLTWEWEYGLRSYAFPLIFEVAYRLVSAACFLCSILTWGLSACIASIAQ
                     HMLPDEKLSNIDALLRPIQELPTILEYNGVIYAPKAAMAVIAAVGEYYTVKFIQKLHI
                     MTMEKSDDEKGMKLSQITKISTVLTLTNFFNCFLITRTFINSFELCLTSIALFYWDWT
                     GGELIHGADFTKSLVVAIFACLQRPSNALIWLVLGFFLVCQLVERKGFPSLVYLLCKI
                     SSVLAAVTLFNCIIDYYFYGELVFPVFRFLKFNFTSPLSNFYGVAPWHFHLTQSVPIL
                     LGLNIPLFLYGLFIGSNKRNKPTQVIDPLKQIKTVILISLLSFSSLAHKEFRFLYPLQ
                     PLFTLISSFALLALAARHRIKSRTLNNLFWALPFVSVFAALFLNSFNEAGVVSVMNFL
                     HNEPAIDSVGFIMPCHSTPWQSHLHRNDIEQLWAITCEPPLHLLNDPDAHEKLPNYMD
                     ESDYLYEDVPDFIYKNFPPLFRKNLRSPGKQYKYEWPEYLVIFEHLKNLYFDSLLKDS
                     TYIEVARFFNSFTHWDSRRQGDVLVYQKINDK"
     gene            <495548..>498298
                     /locus_tag="HG536_0A02640"
                     /db_xref="GeneID:59323544"
     mRNA            <495548..>498298
                     /locus_tag="HG536_0A02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281227.1"
                     /db_xref="GeneID:59323544"
     CDS             495548..498298
                     /locus_tag="HG536_0A02640"
                     /inference="similar to AA sequence:RefSeq:NP_011374.1"
                     /note="ancestral locus Anc_2.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137122.1"
                     /db_xref="GeneID:59323544"
                     /translation="MLNFTGQARRRTVNLGNRSATTKQDILLKAQRERERRAKEHQRE
                     AACAIIQFHIRRYLADRFNIRLFSSTWDRQEVGYLVLVFGPKLIEHLDYESVSRILND
                     SKDMLEHYPGNRGNLKLCGMMAQLKDDVLIQEIVSCLNLARPVANEFVAGVRSLLMRT
                     QKLSQQSITLLLEVVCRWNLNHSEALEPLFEIRSKETANSSVLWMFYQICGSLNVLPA
                     SDSRSSVLLENLAYIYCHVDDRTTISRCIASCFRGMHYIEQDGHLQTYVTQLYEKPFL
                     DFLTNLVENEEDVDVTMENFVSYIESAPNDNLRDSAMISLLSRPSFLKKLYSGIHESR
                     FGELEFEPTASFSIFVRLLEMYLLVSTDHELLSEYSGFTVKDLVAFTTSLKDFVFHNL
                     WHIAAESRPKIVEDTLPLLQKLYLRDSRLHFCSKNKDLDYWSSKDVDFLQVSPFKYIE
                     DYERLYREYADKRDELLADSNELSTADEASAIKFQILARLSSMYKSSVSTRQFKKLEI
                     LIKTPFFIPFEQRVDLFYLFIALDKQRLHLDEDSALMGMFMPWHVNGAMGRQSATISR
                     ENILDDACNAFNSIGERFKAKLAVTFVNEFGPEAGVDGGGITKEFLTSVSEEGFNSEK
                     YSLFQTNSQHELYPSTAVDAQRLRYLWFLGKILGKCLYDHVLIDVAFADFFLKKMLNP
                     SSQFASSFDDLQSLDIVLYSNLVKLLTMTPEQIASLDLAFETDSLDGRGTVVPLIPDG
                     NNIAVTKENVLLYIIKVADFRLNKSLFRQIQNFHGGMSMIIAPHWMEMFNSVELQMLI
                     SGGGKDIDLADLKANTEYGGYQETDKTINDFWSILQELESQERLNFIKFVTSVPRAPL
                     QGFRSLEPRFGIRNAGRDLERLPTASTCVNLLKLPDYQDKELLRQKLLYSINSGARFD
                     LS"
     gene            <498647..>500293
                     /locus_tag="HG536_0A02650"
                     /db_xref="GeneID:59323545"
     mRNA            <498647..>500293
                     /locus_tag="HG536_0A02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281228.1"
                     /db_xref="GeneID:59323545"
     CDS             498647..500293
                     /locus_tag="HG536_0A02650"
                     /inference="similar to AA sequence:RefSeq:NP_013894.1"
                     /note="ancestral locus Anc_2.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137123.1"
                     /db_xref="GeneID:59323545"
                     /translation="MSNDGMAAVMILMLAAARQTLGYVIPRGMIAINEETGAVYSVKD
                     DNDPFNKYPEGYGEDELDMDIMLFSLITMVLMYVFVCFLYIFIKYIVNKLMRDNSSIS
                     LLNDGDTNRRLRRTTEQLNARWPSALDNEEYVKDKLAKLSPEEQFYYKQGEEYIRQNP
                     PLIIPHASSSDEQVEDPIVNESTRQFINEEGAYAWEFQPDSNLPNDTVIVENKTEVTF
                     LNYNYEASVMTNLPIPRINRVYYCEFKIFELRGNSGTTSSGSHHLEDDETISFGLSTC
                     PYPYFRLPGKHHHSIAYDSNGSRRFNDSFALDPALRTLFPRLEKGDVVGIGYRSNSGT
                     VFFTRNGKKLKEDSVGGHIKGWKFKYLYPIIGANVPCKIHVNFGTYGFVYIEANVKKW
                     GYAKTSGMKLPPPSYEEYGQDTLLESGCEEDLTDNESTSSINGDIVDSQGELLPPPPG
                     FEYSTSPIDSTNAMEEAINLNSLPAEPPSYSDDEISSRIKSDAPRIGSSSSQLVEEGD
                     SNDQNGYVHDEEEDDEMNIEESGHSRKTNGNTLSNQFIQD"
     gene            complement(<500539..>502038)
                     /locus_tag="HG536_0A02660"
                     /db_xref="GeneID:59323546"
     mRNA            complement(<500539..>502038)
                     /locus_tag="HG536_0A02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281229.1"
                     /db_xref="GeneID:59323546"
     CDS             complement(500539..502038)
                     /locus_tag="HG536_0A02660"
                     /inference="similar to AA sequence:RefSeq:NP_010177.1"
                     /note="ancestral locus Anc_2.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137124.1"
                     /db_xref="GeneID:59323546"
                     /translation="MSEFHQYADSFASRFGADEFNFLSPGKQEHQGNKDTESQGSGTA
                     TVSGGESMAHEGVVSGESYEGGSTNEERSRGEIASQSSTVDSKKVSKPKRTRATGETL
                     DILKQEFEVNPNPTTQRRKKISELTGLPEKNVRIWFQNRRAKLRKSGGQHKSGADNST
                     DSGAAPMMRDDSHDCATYFDRIPVNINNNYYFIDVCSITVGSWNRMKSGALRRENLPL
                     IRDLSNLSPISINHIMSNATDLMVLISKKNFEINYFFSAMANNTKILFRIFFSLGSVV
                     NCSLTLETGDITEGGTRRESDENHDHNESNDTDKDCNQSESFAELKLAVSRPPNFAVF
                     FLDNSEEGNGNQWSICEDFSEGRQVNDAFVGGSNMPHALKGSESSLKFMNSLILDYNS
                     ANQILPPPPTHLHNPSMAGQQSLALHEHPQTFFDQYDAANDILALNRDTSAIDEKNRL
                     SDNNNANSLNQNQAENSATLLSLSHDSHIPNMPDFFKNTQELTDDHRWL"
     gene            <502982..>504496
                     /locus_tag="HG536_0A02670"
                     /db_xref="GeneID:59323547"
     mRNA            <502982..>504496
                     /locus_tag="HG536_0A02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281230.1"
                     /db_xref="GeneID:59323547"
     CDS             502982..504496
                     /locus_tag="HG536_0A02670"
                     /inference="similar to AA sequence:RefSeq:NP_013893.1"
                     /note="ancestral locus Anc_2.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137125.1"
                     /db_xref="GeneID:59323547"
                     /translation="MSMFETITIPQVGFTYSLPIGLFINNKYVASKDGKKIDTVNPST
                     GEKITSFYAASEEDVDDAVKAAREAYENVWSMMAAEERGLLLYKLADLIERDKYKLAA
                     LETLDSGKPYHSNAVNDLQQIIQLTRYFAGSADKYTKGETIPLNHDKYAMTFKVPYGV
                     VGQVIPWNYPLAMASWKIQGCLAAGNTIVIKPAENTSISLLYMAQLFVEAGFPPGVLN
                     VVPGLGATAGTALAAHPDVNKIAFTGSTQVGQKIMELAGKSNLKAVTLECGGKSPAVV
                     FADAALDNAVEWIANGIYYNSGQNCTANSRVYIQERVYDEFISKFRVFVRKMWTFGEK
                     LDPFDEKCTVGPVISETQYLRILSYLEHGQNEERLKMETVGDFQKDSRGYFLPPLYFL
                     DVPQSSKLNQEEIFGPVAVFSKFKDYEEAIKLANDTMYGLAAAVFSENVRTVNQFVRD
                     IKAGTVWVNSSNDEEISVPFGGFKMSGIGRELGQSGVDSYAQLKAAHINLSNYT"
     gene            <504832..>506676
                     /locus_tag="HG536_0A02680"
                     /db_xref="GeneID:59323548"
     mRNA            <504832..>506676
                     /locus_tag="HG536_0A02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281231.1"
                     /db_xref="GeneID:59323548"
     CDS             504832..506676
                     /locus_tag="HG536_0A02680"
                     /inference="similar to AA sequence:RefSeq:NP_013891.1"
                     /note="ancestral locus Anc_2.340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137126.1"
                     /db_xref="GeneID:59323548"
                     /translation="MEHSEIQKSKHPCAICAKRKVKCDRLIPCTNCVKRGFEKECLER
                     SVDGKESQRTDRNSAVLRFWQSYEYWVTDIGLFKSQDVDPANTFVDLKEEVDECEHWC
                     EFLTRETSFQLLDHCVERLGCLYFGCLSDISDLYLLLEEYWQRRNERNVVFSVDDYYS
                     NALLWSLFALTVYYMPLELLSSVFPKKPPSHIFKYADFDSDFWTEKAQLQLSQCFTHC
                     AVIQLQEANLLANPDVRLLQVYVILSAMGYPHREVSTSNALLLVCFNVAKLCHVDDFR
                     PLITDSTAMRLTKITCEKIWYSLCSCDYLQSGPRKPTVFHTEISSLLQHAAYLEDLPN
                     TDVYQSEDSFEALYWKIISLDRDLNQYLIKGTKPPLKTLDAIQRQTDIFTRKITSSED
                     SPALASDFARFLASFLLNAISWKLHKMYFIYFEIASGLAKSVHYTKNLVALVVKNIKN
                     RRDTLFNKHPVVIQSFARIAVFYAFYEMVSGSAEIRDLNLDIKEMLQNLSDELEPHLS
                     GLFYLLSRFRLLKTLWENMESETLGNILEHPVMTILQNDINAFSQQMIERPSMIRGSA
                     RLIMKRRVPQDQGAVENGNAVFDSIVAEFESQYAIDYLIRRKTEDGEF"
     gene            complement(<506673..>508865)
                     /locus_tag="HG536_0A02690"
                     /db_xref="GeneID:59323549"
     mRNA            complement(<506673..>508865)
                     /locus_tag="HG536_0A02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281232.1"
                     /db_xref="GeneID:59323549"
     CDS             complement(506673..508865)
                     /locus_tag="HG536_0A02690"
                     /inference="similar to AA sequence:RefSeq:NP_013890.1"
                     /note="ancestral locus Anc_2.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137127.1"
                     /db_xref="GeneID:59323549"
                     /translation="MVASIKALDESVVNKIAAGEIIISPVNALKEMMENSIDAGAKSL
                     DILVRDGGIKLLQVTDNGCGINREDLPVLCERFTTSKLTKFEDLESIATYGFRGEALA
                     SISHIARVTVTTKTQDDKCAWRVSYAEGKMIGEPRPMAGRDGTVILVEDLFYNMPSRL
                     QALRSPGEEYTKILDVVGRYAIHRQDVAFSCKKFGDSQFSLTIRSDLSAEGRIRTVFG
                     NAVAKSLLAFDMASVEELDIAKVSGQVSNLEFNFKKSITPVLFINDRLVTCNPLARAL
                     RQVYANFLPKGNKPFIYLSLLINPKVLDVNVHPTKREVRFLHQDEIIEKIALQLNEVL
                     SKVDTSRTFKASTVLTSKPVHSASISRVTATSSINKSYQNNNNGQTQNGQTPAKRYEN
                     KLVRTDASQAKITTFLKSSQSQATSPAVVLQTIDRQEINENHSEGAAKENLPIPSSPA
                     AAVIEKSSKYQIHAQERIEVNLSSIKRLREAVDESIHRDLTDAFANLTFVGVVDVERR
                     LATIQHDLKLFLIDYGAVCYELFYQICLSDFSNYGKIILESANNKGLRLIEILSSFEH
                     LTDDFILGIVQRLWDMREMLTEYFAIELTAEGDTDKPAQESIQLRSIPLLLKDYTPPL
                     AKIPFFIYRLGTRVNWEVEEPCLEGIMRQIALLYIPEIIELVDLSGKDVDEERKAEFV
                     ARNEEMSYSLENVVFPCIKRRFLAPRSLSKDVIEIANLPGLYKVFERC"
     gene            <509434..>510609
                     /locus_tag="HG536_0A02700"
                     /db_xref="GeneID:59323550"
     mRNA            <509434..>510609
                     /locus_tag="HG536_0A02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281233.1"
                     /db_xref="GeneID:59323550"
     CDS             509434..510609
                     /locus_tag="HG536_0A02700"
                     /inference="similar to AA sequence:RefSeq:NP_010178.1"
                     /note="ancestral locus Anc_2.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137128.1"
                     /db_xref="GeneID:59323550"
                     /translation="MSSRRAGRVRGPEDETDVEGPTVRRRRVDDGTPESSESSARQQI
                     LQGYRALEGEMAKEKAKAARTGDIHIALKNLDAAESLFSKASGSRNLELFAHDAKAMV
                     NISELAQMSVRNLKFDDSRSLVNLDDVLNSCKKYMLKEYFLLNDISEPVTSLMNNAEE
                     EESELPLHDGAMEDQQETVAGTSSSRLRANTLRRSYLQQFSTYDQFHQFNWFRMGSLF
                     DTLSRGAATVDHLSGPFSLEKRPRVTMNPRTRQIDSGASLTTAQRDLPASRGTEELTT
                     PMLVKRCYEILRRKKGYEPINLFKLIINPSSYAKSVENLFYISFLLKEGKLILEEDEE
                     GFPSIRIKEELPREAAAAELEAQRRRDAHQNHIIFQLDGASWKKLIDKFSISSSFLD"
     gene            complement(<510610..>511776)
                     /locus_tag="HG536_0A02710"
                     /db_xref="GeneID:59323551"
     mRNA            complement(<510610..>511776)
                     /locus_tag="HG536_0A02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281234.1"
                     /db_xref="GeneID:59323551"
     CDS             complement(510610..511776)
                     /locus_tag="HG536_0A02710"
                     /inference="similar to AA sequence:RefSeq:NP_010179.1"
                     /note="ancestral locus Anc_2.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137129.1"
                     /db_xref="GeneID:59323551"
                     /translation="MRRLLPRACLVSPRRAYKVLAIETSCDDTCVAILDRHSEELAPR
                     TLIHLKETLDSASQGGIVPTRAHLHHQLKIGVLTQKALRTTGTSAVDLVCVTRGPGMP
                     GSLSGGLDFAKGLAVAWQKPLLGVHHMLGHLLVPRLSTNGKAPAYPFLSLLVSGGHTT
                     VVLTRSVTDHEIMCDSMDIAVGDSLDKCGRELGIRGTMIAKEMEKFIDEDPSCKFDAG
                     IRMTLPNPLRNKNNRIDVQAFSFAPFLTAVRNNIDRPIEEYTRDQIRSMAYQTQEAIF
                     KHILSRLTKVIELNADKLVGVRHFVCSGGVGANKRLRTLLEENLSGRFTEFFYPPTDL
                     CTDNAVMIGWAGIELFESRSLCTDLEVSPIRKWPLSELLGVSGWRQLEGKDPCK"
     gene            <512285..>513364
                     /locus_tag="HG536_0A02720"
                     /db_xref="GeneID:59323552"
     mRNA            <512285..>513364
                     /locus_tag="HG536_0A02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281235.1"
                     /db_xref="GeneID:59323552"
     CDS             512285..513364
                     /locus_tag="HG536_0A02720"
                     /inference="similar to AA sequence:RefSeq:NP_013889.1"
                     /note="ancestral locus Anc_2.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137130.1"
                     /db_xref="GeneID:59323552"
                     /translation="MWQFTSSIPVVHKHHENAHGPPASTHGGGGAGEEAGKGSETAAN
                     EEDTGSILNCAIAGGLGGGIGDTAMHSLDTVKTRQQGAPSNGKYRSMLSAYRTIFVEE
                     GVRRGLYGGYCAAMLGSLPSAALFFSTYEYSKKKMIDDWQINETATHLTAGFLGDLVS
                     SVVYVPSEVLKTRLQLQGRFNNPYFDSGYNYRNLRDTVKTVIKTEGVGALLFGYKATL
                     ARDLPFSALQFAFYEKFRQWAFRIEGKDTGLDDLSLVSEIYTGACAGGLAGVLTTPLD
                     VIKTRVQTQQPSNDFSKSRTHAVKLSGSLFGSLKTVYNSEGFLGFFSGVGPRFVWTSV
                     QSSIMLLLYQMSLRALNNSSSKLLR"
     gene            <514074..>516509
                     /locus_tag="HG536_0A02730"
                     /db_xref="GeneID:59323553"
     mRNA            <514074..>516509
                     /locus_tag="HG536_0A02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281236.1"
                     /db_xref="GeneID:59323553"
     CDS             514074..516509
                     /locus_tag="HG536_0A02730"
                     /inference="similar to AA sequence:RefSeq:NP_013888.1"
                     /note="ancestral locus Anc_2.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137131.1"
                     /db_xref="GeneID:59323553"
                     /translation="MQYFGRAIDTVSKTWSSINPATLSGAIDVIVIDHPDGTLACSPF
                     HVRFGKFQILKPSQKKVEVIVNGKSTNIPMKLGDSGEAYFVFETTSDLDGIPQDLLSS
                     PIVSATSSPSQSPHSNNMYLDSDSATEAGNTRPFQGDHKVLEEPDFLDINDTGTTDEQ
                     QISPNISNSSSPTPVSKTKTFQEKLNKRLTQIHIPSKLDNNGDLLLDIEGYKPNKDKV
                     HDADNQLKQLLQDELGGDLDISKFLKEDDKGNVRIVNPYEHTHLAPADSPPFTSDESG
                     SNLDSRPDTSDSLTAASDAESQNESKHEIEGSSGNHYIKTLRLSSDQLKCLDLKYGEN
                     DLMFSVDQGRASVTSKLFVWRWDVPIVISDIDGTITKSDALGHVMTMFGKDWTHSGVA
                     KLFTEIARNNYNIMYLTARSTGQADSTRSYLRSILQDGNRLPSGPVILSPDRTMAALR
                     REVILKKPEVFKIACLNDIRSLYFRAPQKTSKDYHSDGAEERKIHEDENVVEDPDERP
                     TPFFAGFGNRITDALSYRTVGIPSSRIFTINPDGEVHMELLELAGYKSSYVFINELVD
                     HFFPPVILDNDDLGSITSMTPGSPANNTLDMDSNCDSNILLRKKQEKKFTDVYFWRDP
                     ILDINDLSDISHSDEEKDNGALPMKSQRFSPNNKAKDALLKTDDHERFAKNVKSRSLS
                     KEEQESFLARNNAQEETYARNFSTPKKNPRPSSKEELGRQIYLELGSPLTSPKLSHID
                     VQDIDSHLKNFSITRPTHPIAGVSKVNVMEDGHQPGDINSPTSGRSLNQADDLDDDID
                     SMDDEFDEDEFID"
     gene            <516870..>517538
                     /locus_tag="HG536_0A02740"
                     /db_xref="GeneID:59323554"
     mRNA            <516870..>517538
                     /locus_tag="HG536_0A02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281237.1"
                     /db_xref="GeneID:59323554"
     CDS             516870..517538
                     /locus_tag="HG536_0A02740"
                     /inference="similar to AA sequence:RefSeq:NP_013887.1"
                     /note="ancestral locus Anc_2.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137132.1"
                     /db_xref="GeneID:59323554"
                     /translation="MVQVKREKKRMVSDAMAKNSRQLLNAHIYNYLIENKRYETARQF
                     LLEADVPLSEERSDEEAGYSQARQNARLEAGVDLLPASMMMDCADTFLHEWWECFNCL
                     QKYVDSTPLEDLKEDSRHREPIVPLVPLNPNAFGNMGSRNTTASRVPGSMNANQFPQQ
                     VRAGMTTNPSPNMPFNGQYTNFESNQSMPVNAYPQDSMPFTMQQQPPQTQQYPGQFPQ
                     QLQR"
     gene            complement(<519870..>520322)
                     /locus_tag="HG536_0A02750"
                     /db_xref="GeneID:59323555"
     mRNA            complement(<519870..>520322)
                     /locus_tag="HG536_0A02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281238.1"
                     /db_xref="GeneID:59323555"
     CDS             complement(519870..520322)
                     /locus_tag="HG536_0A02750"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137133.1"
                     /db_xref="GeneID:59323555"
                     /translation="MRVRAPRITRKRKKDMSPLVGKRKEIGVMRDGKCIKLLLDTGAA
                     TSLISSRRANDLRLKTYDTSPVTIRGATTNARGVPYTKATVLTFTYNAFQYDIPIYVG
                     DELHTDIIIDNPVLEFYPELGQLTTNMSPVTLEPSTPQTCQTIDPTEP"
     gene            521185..521258
                     /locus_tag="HG536_0Atrna3V"
                     /db_xref="GeneID:59324269"
     tRNA            521185..521258
                     /locus_tag="HG536_0Atrna3V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59324269"
     gene            <521534..>523651
                     /locus_tag="HG536_0A02760"
                     /db_xref="GeneID:59323556"
     mRNA            <521534..>523651
                     /locus_tag="HG536_0A02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281239.1"
                     /db_xref="GeneID:59323556"
     CDS             521534..523651
                     /locus_tag="HG536_0A02760"
                     /inference="similar to AA sequence:RefSeq:NP_013886.1"
                     /note="ancestral locus Anc_2.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137134.1"
                     /db_xref="GeneID:59323556"
                     /translation="MKEELIDPHVQFPGLQIFSSWKNSSKNVRNLQNTSKRPAFNQHY
                     LPSEETLVLAVHNDPNQFGSWVKFPERRSTDLHDYSPTVVGSDCFEKYEIPQKPETAK
                     FWSKIISEIFRELPDDSNDQFIEEFQYTVISSDSLNDPNGFRFSFSAKKSIMDFHKSS
                     SSLQRHDLATLPTKYGRLRIFSPSRFTLIRTLDILSTVLCAWKLLRCLGKPRINTMRC
                     RRILAAVLIALYLATQQEYFHSQYARYKALVTLKKMLTSLQKLSTLIHNYGIKLKELS
                     IYKPLSTSKPGTSPDPTIAKIKDLLSSCLDLLYYKLKSTTENLIPLCSTASLTKYCAM
                     YNLEMSDLFHYLNEAAPELEDKSERMSIMRKFTLCTLLSLSCYNSSSDETMMSFLSRL
                     FPDSILEMHETSPAKDADRYRAVSENLQQFDDFAIQLTSSLVNHKHILRSYGDLSEIT
                     DDNATARCRAELPKTNQQLNETLQSLKRLESFLVACQEEEISKETRDVVTYSLQEITS
                     AWRNYDTPNNQCDRPFLTSPKTGFSLKVLKKPSWQSLKSIPKNGNMRLKDEIAFEQVD
                     DMQSDMEFDSDLERHNSYEKLCYESARSESDNLIEPKAKSDGRQDLRELTDDELRHKL
                     NEGISRLAVENRQGRDRIRTQKSFELLRQKDITKRVHRHASIMSKDSMTIVQSRPPNE
                     SNFSSEDSIPVLYELKELLEKQQ"
     gene            complement(<523724..>525166)
                     /locus_tag="HG536_0A02770"
                     /db_xref="GeneID:59323557"
     mRNA            complement(<523724..>525166)
                     /locus_tag="HG536_0A02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281240.1"
                     /db_xref="GeneID:59323557"
     CDS             complement(523724..525166)
                     /locus_tag="HG536_0A02770"
                     /inference="similar to AA sequence:RefSeq:NP_010180.1"
                     /note="ancestral locus Anc_2.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137135.1"
                     /db_xref="GeneID:59323557"
                     /translation="MEVKKLYEEAGQLQLFDHWETLSAEDQQSLLENLSAVAKRTTPQ
                     ELVSKCRDALTLSAANASDGTQIEPLPTTSYQTVIGNEEAQKAYWNLGLEAIVKGEVA
                     VILMAGGQGTRLGSSQPKGCYDIGLPSGKSLFQIQADKILRLQDLSGSQHAIPWYVMT
                     SVPTRAATEEFFAKHKFFGLKPSQVTFFNQGTLPAFDLEGSKLLLGSPTELVASPDGN
                     GGLYRAMKDNDLLSDFTAKGIKHVYMYCVDNVLSKVADPTFIGFAIQHKFELATKAVR
                     KRDAHESVGLIATKQGKPCVIEYSEIPKELAEAQDGSGLLKFRAANIVNHYYSVELLQ
                     RELDNWCATLPYHVARKKIPVYDNKTGQFCKPTSPNGIKLEQFIFDVFPTVPLDKFGC
                     LEVERAEEFAPLKNGAGSSNDNPETSRVAYLTLGTSRLKAAGAKIASGVDIEVSGRMS
                     FSGENLSQYSGKTFDRSGVIIESDPFLLCH"
     gene            <525476..>530374
                     /locus_tag="HG536_0A02780"
                     /db_xref="GeneID:59323558"
     mRNA            <525476..>530374
                     /locus_tag="HG536_0A02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281241.1"
                     /db_xref="GeneID:59323558"
     CDS             525476..530374
                     /locus_tag="HG536_0A02780"
                     /inference="similar to AA sequence:RefSeq:NP_013885.1"
                     /note="ancestral locus Anc_2.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137136.1"
                     /db_xref="GeneID:59323558"
                     /translation="MANGSARRKRAGSLRTQMFNKRLFDKFNRSENQNIELAEISEGT
                     RTAGETRDTELDEVEAQQDIYEHQGDRRISLWDKLVDVLLNRSREVSTKEGRHIPIIL
                     DHGTAEYKRYASPDSDLLIDERLGAPYCDNQITSSRYSIISFLPKQLYAQFSKLANAY
                     FFLVAILQMIPGWSVTGKYTTIIPLCVFMGISMAREAWDDIKRHRLDREENEKIASVL
                     VKNHQIKGDVSVQSKEEELSPGLRPTNSASNRLISDGDGQSIQARSPTRFNNFELLAQ
                     RHGVYAEKRQWKDLRVGNFVLLKQDDWIPADLLLLASDGENNECFVETMALDGETNLK
                     SRQPHPELSKLACAASGLANINARVTTEDPNIDLYNFEGNLELQGHRNECLQKFPLGP
                     DNIVYRGSILRNTQNVVGMVIFTGEETKIRMNALKNPRVKAPKIQRKINMIVAFMVFV
                     VATVSLFSYLGHVLENRKFLDQNQAWYLMKQDAGTAATIMSFIIMYNTMIPLSLYVTM
                     EIIKVIQSKLMEWDIDIYHAETDTPCESRTATILEELGQVSYIFSDKTGTLTDNKMIF
                     RKFSFAGTSWIHDVEPGDSPIKREGSDLDVISYDGPEMLNNFRTEDVHDGASSVNISN
                     LARKSVEYKGNSAATYTGRPSMRSLRAHNVPSLNSTIGSTSRSTEDHHTLKSSYELIR
                     YIQQHPDNLFSQKAKFFILSLALCHTCLAKRSEDSFDDGDTVEYQSSSPDELALVTAA
                     RDLGYVVIGRNGKFLSIKSYPNGFDEEPQVDDYEILNYIDFNSQRKRMSVLLRIREQP
                     NRVLLICKGADSIILERLQNREMAYEKLDEINSTTKERKEAEAELILQKKLSLERLTA
                     DDDVVSNRLRPSVSSNPRGSLSLKAVRKSMSRKASGQQDPEMQIGSIDQFLNNIRRTD
                     NELDEVITQSRKSLHKQQLERYGPRISSEQRHRQSPLINQQPSQVRSSGTSDGGSDML
                     HYIGSEELLQNEEYVIERTLQAIDEFSTEGLRTLVYAYRWIDIEEYNKWQDRYHQAKT
                     SLNDRKTKIDAVGAEIEESLSLLGTTAIEDKLQEGVAEAIEKIRRAGIKMWMLTGDKR
                     ETAINIGYSCKLIYDYSTVVILSANEENMIAKMNAVIQEIDSGNVAHCVLVIDGATLA
                     LFEDNPNLMSVFIELCTKTDSVVCCRASPSQKALMVSKIRKTNRKLVTLAIGDGANDI
                     AMIQSADIGIGIAGKEGLQASRSSDYSIGQFRFLLKLLFVHGRYNYVRTSKFVLCTFY
                     KEVTFYLTQLIYQRFTMFSGTSLYESWSLSMFNTLFTSLPVLCIGMFEKDLKPITLLT
                     VPELYSTGRSSQGFNLFVFLQWVILGAGSALMVTFLNVKIWGETALSDNTIYPLGLVN
                     YTAIVFLINIKCQFVETHNRNWLAFASAAISCFGWLVWCALLPQVRKEDPIYDVPNGL
                     YQQFGDDLTFYCAVLVLMVLPIMIDIIYKTFHVMMWPSDTDIFAQLEKKSEVRKKLEL
                     GAYNEMKQGWTWKRDPGTFTTYKDKVLSRSRASSRASGKNEGTANNDKNQTNNSSTSE
                     SDGIILGQDEEEGAKYDYDKYEMLPSGKLIKRQSADHPSKQEGSTRISALIPKKLRFT
                     LKDDQEEEDIRAIVEQRMQDLE"
     gene            complement(<530598..>531275)
                     /locus_tag="HG536_0A02790"
                     /db_xref="GeneID:59323559"
     mRNA            complement(<530598..>531275)
                     /locus_tag="HG536_0A02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281242.1"
                     /db_xref="GeneID:59323559"
     CDS             complement(530598..531275)
                     /locus_tag="HG536_0A02790"
                     /inference="similar to AA sequence:RefSeq:NP_013884.1"
                     /note="ancestral locus Anc_2.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137137.1"
                     /db_xref="GeneID:59323559"
                     /translation="MSSPSYTEEQEKIALEVLSKDKQAFYDVLRVDRGANDVEIKKSY
                     RKLAIKLHPDKNPHPRASEAFKVINRAFEVLSDDEKRQIYDRLGRDPDDRSMPTASGS
                     SFRSAGFPAGFENSFYNRQAARDPREDIFDFLFNMGGGGPFGGHPFGGNAFGGHPFMD
                     GGATSFTFGGPGGFKVYTNVPRRARHQQQRQAQQNEQPDLYQNLRVLLPLLLLFLVPL
                     LERLLFG"
     gene            <532476..>535763
                     /locus_tag="HG536_0A02800"
                     /db_xref="GeneID:59323560"
     mRNA            <532476..>535763
                     /locus_tag="HG536_0A02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281243.1"
                     /db_xref="GeneID:59323560"
     CDS             532476..535763
                     /locus_tag="HG536_0A02800"
                     /inference="similar to AA sequence:RefSeq:NP_010181.2"
                     /note="ancestral locus Anc_2.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137138.1"
                     /db_xref="GeneID:59323560"
                     /translation="MSSDLKRPGEEDDTQGTPVMEKKLRLQSADHGVGSEPVSTLDII
                     PIEDFTKYKSQGYKAKSDEKHGTELKSSFEEELSQMDHELAASQERETSVYARAPLPE
                     DFSSETHDISFQQLDAEQSTLPGFTDENTSTVVRFFGVTNQGNSILCNVTGFRHYLYV
                     PAPNFPEAQDRGQLDNFLKYLRDNYDNLVDDIEVVPKQSIWGYSGDSKLLFWKIYVTH
                     PSGVNKLRTAFERGHLTYKSWFEGGITTYDNIVYPLRVMIDCGIVGMSWITLPKTKYI
                     EIPEEERVSSCQLEVRINYKDLIAHSAEGEWSHSGPLRILSFDIECAGRVGVFPEPQH
                     DAVIQIANVMSIAGARKPFIRNVFTVGSCAAITGSQVFPHDSEEEMLRHWRDFVVTAD
                     PDIIIGYNTSNFDFPYLIDRAKALKIDTFPYFGRLKFVKQEIKDSVFSSKAYGTRESK
                     TVNIDGRLQLDLLQFVQREYKLRSYTLNAVSAHFLGEQKEDVHYSIITKLQNGDSETR
                     RRLAVYCLKDAYLPLRLMEKLMALVNYTEMARVTGVPFSYLLSRGQQIKVVSQLFRKC
                     LQIETVIPNMQSQGTDEQYEGATVIEPIRGYYDIPIATLDFSSLYPSIMMAHNLCYTT
                     LCNKATAERLNLKKDEDFIVTPNGDYFVTPKLRRGILPIILEELISARKRAKKDLKNE
                     KDPFKRDVLNGRQLALKISANSVYGFTGATVGKLPCLAISSSVTSFGRDMIMVTKQSV
                     EEKYSIKNGFKHDALVVYGDTDSVMVKFGTTDLKEAMELGAEAAAYVSGLFKDPIKLE
                     FEKAYFPYLLINKKRYAGLFWTNPEKYDKLDQKGLASVRRDSCPLVSIVMNKVLKLIL
                     IERNVDGALDFVRKTIDDILHNRADISKLIISKTLAPNYTNPQPHQVLTERMKKRDGV
                     GPNVGDRVDYVIMGGNDKLYNRAEDPLYVLEHNIQLDSRYYLTNQLQNPVISIIAPII
                     GEKQANAMFVVKSIKINTGSMKGGLMGFIKKVDSCKSCRSPLKPGEGPLCSNCKARSG
                     ELYIKALYNVRDLEEKFARLWTQCQRCAGTLHNEVLCSNKNCDIFYMRVKMKKELQEN
                     VNQLSKW"
     gene            complement(<535855..>537120)
                     /locus_tag="HG536_0A02810"
                     /db_xref="GeneID:59323561"
     mRNA            complement(<535855..>537120)
                     /locus_tag="HG536_0A02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281244.1"
                     /db_xref="GeneID:59323561"
     CDS             complement(535855..537120)
                     /locus_tag="HG536_0A02810"
                     /inference="similar to AA sequence:RefSeq:NP_010182.1"
                     /note="ancestral locus Anc_2.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137139.1"
                     /db_xref="GeneID:59323561"
                     /translation="MLEMDVDGVKRTLLNIVDKSRNGTFINGNRIVKKDSILKNGDKL
                     VFGKSCSFLFKYISGQGDPSRPQNTVGTRSEEGVFKKPKVGLSSSEAGTRKLLKPKSQ
                     SVFDKYIIGKGLGVGHYATVREGVNKSTEEVVAIKIFHPQQNDDQKKNKQFREEIDIL
                     MRVNHPNIVKLLDSYVEPVSKAQIQKYLILEKIDDGELFDRIVRKTHLRQDETKALFK
                     QILTGLQYLHGLNIIHRDIKPENILLDIKRRKHPEELQNGPWDDDEIDIQVKIADFGL
                     AKFTGEIQFTNTLCGTPSYVAPEVLKKTDYSSKVDMWSAGVLLYVCLCGFPPFSETLG
                     PPSLKEQIAQGSFAFYSPYWDDIEDSALHLITHLLVVNPADRYSVDDTMVHPWFDHSA
                     QSSTISSDIERLQVSPAKIPKTYSELSQV"
     gene            complement(<537523..>539814)
                     /locus_tag="HG536_0A02820"
                     /db_xref="GeneID:59323562"
     mRNA            complement(<537523..>539814)
                     /locus_tag="HG536_0A02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281245.1"
                     /db_xref="GeneID:59323562"
     CDS             complement(537523..539814)
                     /locus_tag="HG536_0A02820"
                     /inference="similar to AA sequence:RefSeq:NP_013883.1"
                     /note="ancestral locus Anc_2.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137140.1"
                     /db_xref="GeneID:59323562"
                     /translation="MNEEPSVTEGQAGWRLWWNSRGIKTQQQDCPNQDAHDTTNTEVA
                     SSNAAGVTETALNNTQDVKNESHNADQTADNKSWYANLMSKVSSIGLGNHEDAFIIEA
                     GIHYSQLNEVQLRRVKEDSLQKVARRANSWCWFEDLTAINDNSKSWLQRSGLISVQGT
                     SSEHCPFPLEHYPAITATGYEVYLQDSLIMPSRSPLDILHTQSLKSKVAAAVKSYYNF
                     PSEKHLYLKENTDGLLRSKNVLIISVVGSLPDKYEKFSLGEQRSAYYLARKLAQSVDH
                     EVPSAISSLSFECPLDSKELDTVLKETIALLDNWKDIFKDVSSIFFIGVYHSVPLVIS
                     LAQYILKNHDVLGFAASIPVGLLAIESILQGYRFWDHSTDAINSDERSYQKIQQAREK
                     QLFQGVGKEEKEILLKHRHYRKLDSEESKLVQKNLDWLLYNWDSFRLNFCGKIYDNFM
                     TASQKLAIDYVHPKILRNLWCDGRHLGCDLKHPDKWDIPDVDIKTPKFECTIRIPGNR
                     AFEITLLNCLLLALNLGYTEFVPIMKLLSPFFISRSFNENTMSPSLKKQKLSEMKTWL
                     QEIDAKSRPDTEGPHDELPKSVSTVHKFMEFALYHNSRSPEVLKVHSEIYDDDTVYSA
                     FIENTIKTRSPLIKKHLRLLDDHSAPQSILNAVNQFDLVWKFHEFISDYAKLRNLPHQ
                     EHPEGLNFSISLGYSLWQQSYADPTMFQRNNQEAICRLKQIWESYQDWDPPTRGLKQL
                     KNILSVLSLYNEFSHLLQDITGK"
     gene            <539955..>540335
                     /locus_tag="HG536_0A02830"
                     /db_xref="GeneID:59323563"
     mRNA            <539955..>540335
                     /locus_tag="HG536_0A02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281246.1"
                     /db_xref="GeneID:59323563"
     CDS             539955..540335
                     /locus_tag="HG536_0A02830"
                     /inference="similar to AA sequence:RefSeq:NP_013882.1"
                     /note="ancestral locus Anc_2.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137141.1"
                     /db_xref="GeneID:59323563"
                     /translation="MDELLIERLQERDETESRFSELFEEVVLSSKGIAKKSSSEDSLR
                     RAVSQLRKELGDKDAEIRKLKEVINVRNKDFEKLNDEIISLTIENNLTNRRFTELEAE
                     HNKLVKRWVAKVQQEVDRLNAGFG"
     gene            540816..540888
                     /locus_tag="HG536_0Atrna1M"
                     /db_xref="GeneID:59324256"
     tRNA            540816..540888
                     /locus_tag="HG536_0Atrna1M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59324256"
     gene            complement(<541012..>542073)
                     /locus_tag="HG536_0A02840"
                     /db_xref="GeneID:59323564"
     mRNA            complement(<541012..>542073)
                     /locus_tag="HG536_0A02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281247.1"
                     /db_xref="GeneID:59323564"
     CDS             complement(541012..542073)
                     /locus_tag="HG536_0A02840"
                     /inference="similar to AA sequence:RefSeq:NP_010183.1"
                     /note="ancestral locus Anc_2.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137142.1"
                     /db_xref="GeneID:59323564"
                     /translation="MDLVSEPNLHSLITSSTHKWVFVGGKGGVGKTTSSCSIAIQMAL
                     AQPQKQYLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAV
                     SRANQNGGGEDDGLGNLLQGGALADLTGSIPGIDEALSFMEVMKHIRNQEKGEGESYD
                     TVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITGKLGPMLNSLAGVGNVDIAGKLAQL
                     KENVETIKQQFTNPDLTTFVCVCISEFLSLYETERLIQELMSYDMDVNSIIVNQLLFA
                     EFDKEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLKNLQKFSQFLD
                     KEYDPATDGSIIYELEEKN"
     gene            <542281..>543096
                     /locus_tag="HG536_0A02850"
                     /db_xref="GeneID:59323565"
     mRNA            <542281..>543096
                     /locus_tag="HG536_0A02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281248.1"
                     /db_xref="GeneID:59323565"
     CDS             542281..543096
                     /locus_tag="HG536_0A02850"
                     /inference="similar to AA sequence:RefSeq:NP_010184.1"
                     /note="ancestral locus Anc_2.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137143.1"
                     /db_xref="GeneID:59323565"
                     /translation="MSEEDDKRAKQLEEARKRVEELKKRNKKDKKKKKQTKETEKASE
                     SKTGSLEIAEESSKEPEVTEEENVVEASTEEVPQSQDDTAAQSAGEKLESNSQKPKGE
                     SPSNDTSQLFSDEDEKESDFMTTIQKQNEEEEIRRLQAELDAKASECKTLKFVNMEQE
                     TTIEELEAEVKRLLEQVAASQQELSDTAEKLRETETRLAAAEQLASNAEPSRLHLSQF
                     STVGPVGSTEESTQHHVSSHVMNIDREALDRWRNWNVDMSSWRSIGAGPIVEF"
     gene            complement(<543161..>543628)
                     /locus_tag="HG536_0A02860"
                     /db_xref="GeneID:59323566"
     mRNA            complement(<543161..>543628)
                     /locus_tag="HG536_0A02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281249.1"
                     /db_xref="GeneID:59323566"
     CDS             complement(543161..543628)
                     /locus_tag="HG536_0A02860"
                     /inference="similar to AA sequence:RefSeq:NP_013879.1"
                     /note="ancestral locus Anc_2.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137144.1"
                     /db_xref="GeneID:59323566"
                     /translation="MSLVKLANTCAHIQNCSRVRTSLTSIPYTRLHLQFAYNLYRHGF
                     ISSLQKGSTKGPDEVPVEVTPDNISTRRLWIGLKYRENKPILSSCRLISKPSTRVYLS
                     HNDMRKLCSGITVRLIKPLQPGELMLVRTKESVVDINEAVAKKLDGEVLCRVK"
     gene            <543796..>544512
                     /locus_tag="HG536_0A02870"
                     /db_xref="GeneID:59323567"
     mRNA            <543796..>544512
                     /locus_tag="HG536_0A02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281250.1"
                     /db_xref="GeneID:59323567"
     CDS             543796..544512
                     /locus_tag="HG536_0A02870"
                     /inference="similar to AA sequence:RefSeq:NP_013878.1"
                     /note="ancestral locus Anc_2.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137145.1"
                     /db_xref="GeneID:59323567"
                     /translation="MLCLRNIVKYRTRLSSRNLPSCLGGTAIYNGVGIRSYASPTAGK
                     KTEDAPSFKKIFLVAILGTLVFMQTANSLDKNKPKTSYSEEEFENVMSGLKRRVSLFP
                     AGALEVKLIPRTSEEILKKVREGSEIVIEPKEVVEYFRGQKDGTYEALLEEVKSKHGA
                     DYFEKLPNGMLVMLIGKYMKEKCRTNDRVIIADFPHSIADAIKFENDVCTVSKVVTDK
                     ANANSEVCQYYETVRKVQQV"
     gene            complement(<544559..>545122)
                     /locus_tag="HG536_0A02880"
                     /db_xref="GeneID:59323568"
     mRNA            complement(<544559..>545122)
                     /locus_tag="HG536_0A02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281251.1"
                     /db_xref="GeneID:59323568"
     CDS             complement(544559..545122)
                     /locus_tag="HG536_0A02880"
                     /inference="similar to AA sequence:RefSeq:NP_010185.1"
                     /note="ancestral locus Anc_2.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137146.1"
                     /db_xref="GeneID:59323568"
                     /translation="MSESYGRRTWDREEYAKLAKEGQKSYQESLKSSLTDDQLRLLKA
                     KYTDHRSLMETSMKGLNQKVLATGVSSYKKGRQFGFYCELCNLTFKDNLQYIDHLNHK
                     THQIKFEAIFDEPIVLDVRGNDDVSVQELEEQYQALVKQFVKENRSREVKESRPRKKR
                     IQQKPEQSPPSLIAQTMGFASFGSVKK"
     gene            <545227..>545973
                     /locus_tag="HG536_0A02890"
                     /db_xref="GeneID:59323569"
     mRNA            <545227..>545973
                     /locus_tag="HG536_0A02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281252.1"
                     /db_xref="GeneID:59323569"
     CDS             545227..545973
                     /locus_tag="HG536_0A02890"
                     /inference="similar to AA sequence:RefSeq:NP_013877.1"
                     /note="ancestral locus Anc_2.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137147.1"
                     /db_xref="GeneID:59323569"
                     /translation="MSHKLTVLPHLIKHTPKVHNPVKGPFNVYAFDLDHTLIEPTSPG
                     ARFSRTADDWRFMRFTPGKTTLEKLGDIIQEDPSAHIVIFSNQGGVVAVPPSSKSCTK
                     YTTKIQLILDEISRSENGLNLLGRLWIYASPKRPASSVSVKSKGKIKQSVVRKNTRTK
                     QLKLQNFYKLETEQTEVEDQFVKMRKPEIGMAEEFKKDLSASYESAPQITWCHYCGDA
                     AGRPKDFSDSDKEFAEKLGVLFKLPEDVFI"
     gene            complement(<545999..>547267)
                     /locus_tag="HG536_0A02900"
                     /db_xref="GeneID:59323570"
     mRNA            complement(<545999..>547267)
                     /locus_tag="HG536_0A02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281253.1"
                     /db_xref="GeneID:59323570"
     CDS             complement(545999..547267)
                     /locus_tag="HG536_0A02900"
                     /inference="similar to AA sequence:RefSeq:NP_010186.1"
                     /note="ancestral locus Anc_2.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137148.1"
                     /db_xref="GeneID:59323570"
                     /translation="MSQLERARELVNNKEYAEAEKAYLELLNDTENASSSKRKNELES
                     CLIELGHLYVTTNDKAKLREYIPNTTGYMMQFAKSKTAKVLKALIEDFEQVPDSYDDQ
                     IYVCQKSIDFAKKEKRVFLQHSLSIKLATLYYLKKQYKDSLDLNKELLREFKKLDDKP
                     SLVDVHLLDSKVYHKLRNLAKAKASLTAARTAANSIYCPTATVAELDLMSGILHCEDK
                     DYKTAFSYFYESFENFHNLSTHTSYEKACTVLKYMLLSKIMLNLIDEVKTILNAKYTK
                     ETYQSRGIDAMKEVAKAYNSRSLLDFNAAMRQYKEEIMGDELIRSHFNALYDTLLESN
                     LCKIIEPFECVEVSHISNMIGLDPQQIEGKLSQMILDKVFFGVLDQGNGWLYIYDTPH
                     QDATYDCALELIGQLDTVVDQLYEKASVLY"
     gene            <547552..>550008
                     /locus_tag="HG536_0A02910"
                     /db_xref="GeneID:59323571"
     mRNA            <547552..>550008
                     /locus_tag="HG536_0A02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281254.1"
                     /db_xref="GeneID:59323571"
     CDS             547552..550008
                     /locus_tag="HG536_0A02910"
                     /inference="similar to AA sequence:RefSeq:NP_010188.1"
                     /note="ancestral locus Anc_2.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137149.1"
                     /db_xref="GeneID:59323571"
                     /translation="MPVGEEKRSLGVENEPVVPLQIKQGPVRPFVVSEPPKELHFARS
                     FHSTKERLLVAGLAIFTSAVRLYNLSQPNEVVFDEVHFGGFASKYIKREFFFDVHPPL
                     AKMLFAWVAAFAGFDGSFEFKNIGDVYPASVPYVLMRSLAAVAGSVTVLLLYFTLRAS
                     GVRIWVALASAVCFAVENSFVTISRYILLDAPLMLFVAASVYCFKKYELLPTNSLQSF
                     KYLVLTGVALGLSASAKWVGFFTIGWVGLLCVWRLWFFLGDLSKPVSSTIKIAALKGA
                     VLLGIPMVIYVFFFYVHFQTLTMDADGAGFFSSEFRTTLEGNKIPGNVLAEVGIGSTV
                     TIRHVGTMGGYLHSHDHQYPAGSQQQQITLYPHLDGNNEWIISLYNETEPLTSFQNLT
                     DGTKVRLQHSITKRRLHSHDHKPPVSENSDWQKEVSCYGFDGFEGDANDDWIIEIDEN
                     LSTPGPAREHVRALETKFRLKHAMSGCYLFSHEVKLPKWGYEQQEVTCAHSGRPDLLV
                     WVVEGNTNEFLPENAERISYKPSSFFQKLMESHEKMWKINKNLVESHVYESLPSSWPF
                     LLRGIGYWSSKYRHVYLLGNAILWWSVSSFIGIFAMIIMFELGSWQVGKPILQDADVV
                     NFHIQVTQYLLGFIIHIAPSFLMKRQMFLHHYLPAYYFGILAFGHALDIFVNYIFRNR
                     KAIGYALVFGFTASTVYFFNFYSPLAYGSLWTKDLCKKSQWLSGWDYTCDTYLDSYDE
                     YDKIDFSSSSAAPAVTPYADIDTPVEDENHEEIDSFEAIMNKPGDKKFLDQNGNPLQP
                     EEVERILKEGGGKIQKVEDN"
     gene            complement(<550425..>552302)
                     /locus_tag="HG536_0A02920"
                     /db_xref="GeneID:59323572"
     mRNA            complement(<550425..>552302)
                     /locus_tag="HG536_0A02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281255.1"
                     /db_xref="GeneID:59323572"
     CDS             complement(550425..552302)
                     /locus_tag="HG536_0A02920"
                     /inference="similar to AA sequence:RefSeq:NP_013876.1"
                     /note="ancestral locus Anc_2.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137150.1"
                     /db_xref="GeneID:59323572"
                     /translation="MESKASKRAALAWCFVGSNIVALGAGTPYMFSFYGPQLLSRCQL
                     PISRLSMLSLSLNVGSALLGFLAGVVIDRSVMASCFIGTIATFTAYSILDYCYIHELS
                     SLALICLGLALVGFGSVSGFYAAVKCCTTNFPHHRGTAGAFPVALYALSGMLLSFFCT
                     KMFGDDIDKVFKFLTFVCSGMIFVGCLTLRILVNPSHKKSKRKNSNHIVGTCGSLGSA
                     AQITRPIDIQGAQKNAEIGSSAHHRQSVVSNSSSSSLASSFHSMVSGIRSPSFIWSKE
                     LTGSLSFWGWGKVRECDVPSSEAPAAKAPGPMYSSTSIHPQSKRRESFPMGKHDTFVR
                     DDLSEPILSTIGNHGFQSKDDEAVEFLPKGKRFGFWANNHVAQTIKKPRFIAYLIVLA
                     TLQGIGQMYIYSVGFIVRTQIASTPSSEGRLNAEEIQSLQVSIISVLSFLGRLSSGPV
                     SDILIKKLKAQRLWNVVMAAALMSWASSRMLGRSSDLPDYVVSSVPKNISNVSHCSAI
                     FGFAFGILFGTFPPIIADSFGTDNFSSIWGLITSGGLITVKVFCSILGADLSRNTLPD
                     QFYCDKGTLCYRYAFHTTAMSSLFAMVLALLIIAVTHNRRNKRRLVDGELSVSTDTAS
                     I"
     gene            <552702..>553106
                     /locus_tag="HG536_0A02930"
                     /db_xref="GeneID:59323573"
     mRNA            <552702..>553106
                     /locus_tag="HG536_0A02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281256.1"
                     /db_xref="GeneID:59323573"
     CDS             552702..553106
                     /locus_tag="HG536_0A02930"
                     /inference="similar to AA sequence:RefSeq:NP_010191.1"
                     /note="ancestral locus Anc_2.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137151.1"
                     /db_xref="GeneID:59323573"
                     /translation="MVNEGCLNNEDFLAKVPEFFNNDDELVVHLTTKRLVVRDPVDGN
                     AEFDSAKQPQFDVSKKAQSLKVAESSSEMYPVLIRMRYGKRKCSTTVTADALDKFWQD
                     YSSVVKSSMKGLVKKKKKKTKGSGVKSKRQRK"
     gene            complement(<553159..>554469)
                     /locus_tag="HG536_0A02940"
                     /db_xref="GeneID:59323574"
     mRNA            complement(<553159..>554469)
                     /locus_tag="HG536_0A02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281257.1"
                     /db_xref="GeneID:59323574"
     CDS             complement(553159..554469)
                     /locus_tag="HG536_0A02940"
                     /inference="similar to AA sequence:RefSeq:NP_010192.1"
                     /note="ancestral locus Anc_2.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137152.1"
                     /db_xref="GeneID:59323574"
                     /translation="MMDLIRRVLHGGEVPFTPIPGSFPEEQLSGENGNDEQASQTNEP
                     QRLLSRKRFLSLLLQIPFVFLYHIISLIILMLSILSPLCAINGYYRKKQRRFLDPKSR
                     LNNLLESLNNESQRTLVIESEDRMAYSFGSLYNLESGSLSQDIVQGSYTELLATCSEQ
                     CKFAIIYLHDPLLDNCMDYVNKILCSEKFTTMIRKYQIMLWFSDVTTSEGLQVANALK
                     VRQFPFLGVLCLKAEKRIEVIGRMEGDVRRYDPDYLENIVSKGYSRLIQIRQQRQNIA
                     LQRIIREQQDSRFEESLRADQQRQREQEAERTREAEEQHRERQRKQWLLWRKTRLHPE
                     PPNTADSCRVAIRIEGDGRRIIRKFDASLTVEEIYAYVELYTKGLLDSSETFSGNEPP
                     AGYNHDFKFVLTTPVPRTELDPAATIRDVPGLYPSGNIVMETLD"
     gene            complement(<554594..>555871)
                     /locus_tag="HG536_0A02950"
                     /db_xref="GeneID:59323575"
     mRNA            complement(<554594..>555871)
                     /locus_tag="HG536_0A02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281258.1"
                     /db_xref="GeneID:59323575"
     CDS             complement(554594..555871)
                     /locus_tag="HG536_0A02950"
                     /inference="similar to AA sequence:RefSeq:NP_010193.1"
                     /note="ancestral locus Anc_2.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137153.1"
                     /db_xref="GeneID:59323575"
                     /translation="MVNPAARVKFVRKNLLGRKREPTVRVVSAEEGQDQEGEEEDIVS
                     IMKEIETDTTIARDEVIAKCQSLYREAQGEPELDREQLKRYLDSAFSNDFPPQMVALD
                     ASQPWILYWTANSLKLLDEGYLSDRCKRRICEKLFAISESGGPFGGGVGQLPHLASTY
                     AAVSALALCDNVEGYWDRINEKAIYDWLLSLKQPDGGFRTCRGVGETDTRGVYCALSI
                     ASLLNILTDELCEGVANFLVRCQTYEGGFGGCPHGDEAHGGYTFCSVASLAILGELDK
                     IDLSSLMQWCSQKQYEPEKGLSGRTNKLVDGCYSFWVGGAAAILELYGHGECIDKLAL
                     RKYILYCCQSGARPGLRDKPGTHPDLYHTNYVLLGLAITENLLGFSSDRQLNPAIKPI
                     PISVPSRLSSINPIYGLPVKDFEKFTQHFRYED"
     gene            <556047..>558158
                     /locus_tag="HG536_0A02960"
                     /db_xref="GeneID:59323576"
     mRNA            <556047..>558158
                     /locus_tag="HG536_0A02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281259.1"
                     /db_xref="GeneID:59323576"
     CDS             556047..558158
                     /locus_tag="HG536_0A02960"
                     /inference="similar to AA sequence:RefSeq:NP_013875.1"
                     /note="ancestral locus Anc_2.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137154.1"
                     /db_xref="GeneID:59323576"
                     /translation="MNHWQLLNDVRKSVYCSRNDDYSIELKELVSLASKSNDSEFIKC
                     VLLLREDITSANAKVKLLWLTSLVGKNFYAPLDVDLAGPLPWNGPHILDTRSARLQSK
                     YAKRSPLRPEDTPELRQCQDINNCSFVASLIGLKVHNVRQPKIKQLSPDVFSVNLHFN
                     GASDRVVTVSTSQIPTDGQSNQLSIHSGDLADKVVELAYLQITAGSYDTHGSNCAIDT
                     FRLTGYLPEVKAANRIDIKRLIKYFRSGLCIIALGTGADASMLVAPLITDHDYAVVAV
                     DDDRESLTIRDPLNPETCVEVRQNDLWNHYEQVYLNWCQTKLFYYKTCIHFFYKAECC
                     NRFNSITDKPLFIIKNRSKSKQPVRVLLETNLREEVSPGKRIAYLKEVPNDILSSIHD
                     EPTGACDIGLQLLKLELLPGQSVRLFCHSSHSESFTTHMFYNSELVSFNREIKSGDYR
                     SIIFDAPDNGISNSCQFYRNPSIMLKVKSPLSEEVPLNLQLLSESSKDMINAQVYHAS
                     DHKMSRPLREEANFEQQKLDIRYLHLITNTPYKVVCSSYSKALSHKFKLNVKPSSSEE
                     SIYSECKLKQVYFEFGGFPHHLEKRFGWPSNSNRIRIRLTSKSNNLCFIRISPMASSP
                     SLSIRCNIFDEETHGQLHTMTQYEKPGLGGLVIDQLSIDDCTSIVLLIEKDEALLSGI
                     PLRPIECELLIGSQTTVSFNE"
     gene            <558784..>560229
                     /locus_tag="HG536_0A02970"
                     /db_xref="GeneID:59323577"
     mRNA            <558784..>560229
                     /locus_tag="HG536_0A02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281260.1"
                     /db_xref="GeneID:59323577"
     CDS             558784..560229
                     /locus_tag="HG536_0A02970"
                     /inference="similar to AA sequence:RefSeq:NP_010194.1"
                     /note="ancestral locus Anc_2.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137155.1"
                     /db_xref="GeneID:59323577"
                     /translation="MSYRVSKERYIPLNASIREDDELFDDNVDKNTSSIRRTLLILIT
                     APSDWHILLNEWIQSIDLDAKAYSFAQPLGHSLTFLLYVIRLLQDNLIRPESYKIASN
                     QDAFDLSRSEKLREYEYLNRYSVNREANSTATFYASFLSGVSKFFNLLTAALLIVNLG
                     LTYQFFFGHFRSYSLFSSKERPVSKHVTKRSLRNLNDEYLENIYNGSLWSMLKYIFRG
                     SLTADEKTDDDEIYYSLEKWVPSKFTTHFFACFCPTGVFFLLLCDISFTTAIPVVLHQ
                     IILHYMVIDRYEERLVDEAVIHQALMTDYEAKVVKPYTNKMMQDVQVDATTYGEGYVR
                     FWPAISSSKSPIFKTHSVMGDTILEKFNSRTQEFEDVVGAGESHNLIMETPHFYPTCP
                     YHNAMECRSSPRYHKNISGPGKMSTSSGFYSPYVYTASGMSSPLHAGGNSPIHLGSSQ
                     LHHQRQSPSMGQHLKRKSTSPLRRSVTPNDA"
     gene            complement(<560458..>561912)
                     /locus_tag="HG536_0A02980"
                     /db_xref="GeneID:59323578"
     mRNA            complement(<560458..>561912)
                     /locus_tag="HG536_0A02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281261.1"
                     /db_xref="GeneID:59323578"
     CDS             complement(560458..561912)
                     /locus_tag="HG536_0A02980"
                     /inference="similar to AA sequence:RefSeq:NP_010195.1"
                     /note="ancestral locus Anc_2.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137156.1"
                     /db_xref="GeneID:59323578"
                     /translation="MFGTNSQPSTSSDRFANLTVNFNQQQQQPQPQQQPNQASTYTSQ
                     QFQSVPQTQQQAFFSQGSQNQLGSSQREAEWYNNPRKRAIPQAIVKRTTKRSPSVDPS
                     QAVTDSNASTQRSGFNSLSFGSKKDIRGLPSTQSIKTGKSGEHNTSILSSNEAPPTVS
                     LYDWQREDDFGAMVPLGSQIGSELGKPSSEEKTESLPSSISAARKDGTQPNVFDRNSI
                     LESSRSGVNKIDKNGALSPTAPSIEESAVIVFGYPESISNLVIRHFSKFGSILEDFEV
                     LRNSSGINAASLRLRRRKSDNFEKKYPIFTGDGWVKLTYDSSSAAVRALQENGQVFGG
                     SLIGCVPYNKNLVEQLASCKIEKMDDIGGVNFSVKQSSLDESIENPLSSSASPLSGER
                     DEQIIGTRTPLGGSSNQVSASGNILEHPKITYLNRRLHLKDGKKLFAHSGSPGSNNFL
                     QNLELKMRQQEESNKQQAGLLSKVNNWLFGWNEL"
     gene            complement(<562119..>563198)
                     /locus_tag="HG536_0A02990"
                     /db_xref="GeneID:59323579"
     mRNA            complement(<562119..>563198)
                     /locus_tag="HG536_0A02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281262.1"
                     /db_xref="GeneID:59323579"
     CDS             complement(562119..563198)
                     /locus_tag="HG536_0A02990"
                     /inference="similar to AA sequence:RefSeq:NP_013872.1"
                     /note="ancestral locus Anc_2.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137157.1"
                     /db_xref="GeneID:59323579"
                     /translation="MVVNRAVTFISHSTPASLVQKELDLDTCYREDEIVVQVYAASLN
                     PIDLLVHSFACWPFIGSYEKTYSRDYSGVIVKRGDKVDPKWKVGDKVNGLYNHLYGYH
                     GSLTDYLVLNPKQQPAITHMPKPADSKYNDFVVNAAWPLVFGTAYTALFNYGQKLGPD
                     SKILIIGASTSVSYAMLQIAKHEIGVKTVVGVCSSKSIDYNKRLGYDYLATYDQGPIV
                     ESVGKILVGDLNNEKFDLIFDSVGNSEFFPVMDKFLKPKKDNSYYISIAGDRKMDYSN
                     PRLRDVFSTMARILRPFKSYNYAYFFLKPQSDYMDLGSKMITEGTYEPIIDSVYALKD
                     FQAAIDKQKSNRAKGKLVIKVKDDL"
     gene            complement(<563536..>564273)
                     /locus_tag="HG536_0A03000"
                     /db_xref="GeneID:59323580"
     mRNA            complement(<563536..>564273)
                     /locus_tag="HG536_0A03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281263.1"
                     /db_xref="GeneID:59323580"
     CDS             complement(563536..564273)
                     /locus_tag="HG536_0A03000"
                     /inference="similar to AA sequence:RefSeq:NP_010196.1"
                     /note="ancestral locus Anc_2.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137158.1"
                     /db_xref="GeneID:59323580"
                     /translation="MGVAAAEQKKLLEQLMGKESTHGRRNQSSFNNQRRNLGLHDPRI
                     CKSYLVGECPYDLFQGTKQSLGRCPQIHSAKFKIQYEKEKKRGVSFTEFEREYYAILA
                     KFVNDCNGQIAVALKKLEHTPEEKEKIQQVTEELTVLDSRIGLMIQEIQSLLKANEVS
                     QAMVQSIKLQAMQERRQEVAKKVRNITEKVGQSAQQKLQVCEVCGAYISRLDTDRRLA
                     DHFMGKIHLGYVKMRKDYELMRKRLNR"
     gene            <564745..>565617
                     /locus_tag="HG536_0A03010"
                     /db_xref="GeneID:59323581"
     mRNA            <564745..>565617
                     /locus_tag="HG536_0A03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281264.1"
                     /db_xref="GeneID:59323581"
     CDS             564745..565617
                     /locus_tag="HG536_0A03010"
                     /inference="similar to AA sequence:RefSeq:NP_015292.1"
                     /note="ancestral locus Anc_2.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137159.1"
                     /db_xref="GeneID:59323581"
                     /translation="MSRKLFSVANALYGLLGAGVTLEDGIGVLIMGGSSEGLGIEICL
                     ALAIDWNLYVVNVDTKDMEVILDDREAIIMDRNYSFVQCKDFTKPESVLEALTKVQAL
                     QLPLKLLINNMQHGLNTTFCPSFLLGNNAVSRLQEYTDSNVISVMVTTKYFMNVLVPQ
                     TRRLLNGKTSFYIINLTSILTLTTPGLAIEYISSKAALNRFHDGLTSELALSLDKSYF
                     KTLLIFLPYVRDGHTWENVSTELCRQVIKHLKLGQRGCAKLHLGGYSSERWHGKIKEN
                     YRYKSGGWRPEWPS"
     gene            <565749..>566357
                     /locus_tag="HG536_0A03020"
                     /db_xref="GeneID:59323582"
     mRNA            <565749..>566357
                     /locus_tag="HG536_0A03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281265.1"
                     /db_xref="GeneID:59323582"
     CDS             565749..566357
                     /locus_tag="HG536_0A03020"
                     /inference="similar to AA sequence:RefSeq:NP_013870.1"
                     /note="ancestral locus Anc_2.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137160.1"
                     /db_xref="GeneID:59323582"
                     /translation="MTTIARTWGKTFSYAIRAVCFVHIVHNHVYEFTETRGESMLPTL
                     AATNDYVHAIKKYKDGRGCQIGDCIVAVKPSDPDHRVCKRITGMPGDIILVDPSMKSK
                     VFGSETVGNEKLHLPEDPIGCSEDYDESFDSYIKVPKGHVWVTGDNLSHSLDSRTYNA
                     LPMGLIKGKIVAANDFNEPFWGGSKGNFWGFRKIENIYVDEK"
     gene            complement(<566405..>567247)
                     /locus_tag="HG536_0A03030"
                     /db_xref="GeneID:59323583"
     mRNA            complement(<566405..>567247)
                     /locus_tag="HG536_0A03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281266.1"
                     /db_xref="GeneID:59323583"
     CDS             complement(566405..567247)
                     /locus_tag="HG536_0A03030"
                     /inference="similar to AA sequence:RefSeq:NP_013869.1"
                     /note="ancestral locus Anc_2.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137161.1"
                     /db_xref="GeneID:59323583"
                     /translation="MRLAGVLFAVCTLVSNCLALQARDAHLAFPNSGKRGIMIGKIDS
                     NTQEMQKPLVIDNSTGEIDFSFAIEARDRPSQVALLLGLPERDLEVVMEPKVTEHGEL
                     IMYKFKIDQSTVPKALLYFAQAEEQPLTASVILAKPENHKNNVLASPFKIRVDLDEAV
                     EYRRPARYGAKPEIIHEFNPEPKTAPWKLVQFFIILIALATFGLVIAWMSSGALNFNS
                     VPTNFNVVYLLFFILSIIGFEYIFVRYYAGTSIFDTLFAVLYLAIPSLWLGTKFLRNF
                     GETI"
     gene            complement(<567498..>567875)
                     /locus_tag="HG536_0A03040"
                     /db_xref="GeneID:59323584"
     mRNA            complement(<567498..>567875)
                     /locus_tag="HG536_0A03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281267.1"
                     /db_xref="GeneID:59323584"
     CDS             complement(567498..567875)
                     /locus_tag="HG536_0A03040"
                     /inference="similar to AA sequence:RefSeq:NP_013868.1"
                     /note="ancestral locus Anc_2.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137162.1"
                     /db_xref="GeneID:59323584"
                     /translation="MALLSSLYFLTYFVVFVSMGFFASVFIVPLLTVSFVFASCVVIF
                     GFLSDITFKFAQVIYFKTDHRLKSTLGKMGDHTTKADSRRPQVMKNYSSARLKSAHSF
                     SQPSTATSAIARPLEVRPDQACG"
     gene            complement(<568401..>568892)
                     /locus_tag="HG536_0A03050"
                     /db_xref="GeneID:59323585"
     mRNA            complement(<568401..>568892)
                     /locus_tag="HG536_0A03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281268.1"
                     /db_xref="GeneID:59323585"
     CDS             complement(568401..568892)
                     /locus_tag="HG536_0A03050"
                     /inference="similar to AA sequence:RefSeq:NP_013867.1"
                     /note="ancestral locus Anc_2.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137163.1"
                     /db_xref="GeneID:59323585"
                     /translation="MGTVVNSRTRIRDRPFRSFPRHNGLNWDNEIFSVESSYNHRPGG
                     GGGFGTLPVLGGSSDFKEQRVFKLEPIKETPGDHSTPELQVQDSALAETGARSPEIAS
                     LTAFKGNLRKRWTDKMCAITKKLDFLQSKMFDLIWVSILYLNYLYPQISRFVEYVSQG
                     VPF"
     gene            complement(<569124..>569699)
                     /locus_tag="HG536_0A03060"
                     /db_xref="GeneID:59323586"
     mRNA            complement(<569124..>569699)
                     /locus_tag="HG536_0A03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281269.1"
                     /db_xref="GeneID:59323586"
     CDS             complement(569124..569699)
                     /locus_tag="HG536_0A03060"
                     /inference="similar to AA sequence:RefSeq:NP_015291.1"
                     /note="ancestral locus Anc_2.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137164.1"
                     /db_xref="GeneID:59323586"
                     /translation="MYDAILEGGRRELPWLLVDDSVLSPATAVARRPWSNHTHILCKI
                     GMTTNRSVSARLQQWQHACKHPVVNLTPETVEPLLSTQRNRETTLSRLLSKLTISRSK
                     TPTCRRELNVPSYKDGGFWVAARGSLSLPMVENAIHRHLWARLGQGLVYCYGCDSDGP
                     KRHKEWFRLPISELPRLFRTVDSFCRGVSDS"
     gene            <569994..>570815
                     /locus_tag="HG536_0A03070"
                     /db_xref="GeneID:59323587"
     mRNA            <569994..>570815
                     /locus_tag="HG536_0A03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281270.1"
                     /db_xref="GeneID:59323587"
     CDS             569994..570815
                     /locus_tag="HG536_0A03070"
                     /inference="similar to AA sequence:RefSeq:NP_010197.1"
                     /note="ancestral locus Anc_2.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137165.1"
                     /db_xref="GeneID:59323587"
                     /translation="MLITENYHDVRTSYGSTLRIYVFTPRLTGYPCAKFPGVIVYSEI
                     YQVTGPVRRFAQRIASEGYVVVAPAIYHNFVGPEPLTYDVEGTDRGNEFKIKKPLASY
                     DEDNRLCCDLLQSLPHFDGKRIGATGMCLGGHLAFRALLDKRVSCATLFFPTDIHSKT
                     LGLNKNDDSLERVSREATKDQELVLIFGTLDTHVPPAGRDLIRQSLREQCVNFTFLEL
                     NAAQHAFIRDESSKGRYDAAITQSCLGFMFEQFNRKLKVDLGEFAQDKENVEHVC"
     gene            <570976..>572016
                     /locus_tag="HG536_0A03080"
                     /db_xref="GeneID:59323588"
     mRNA            <570976..>572016
                     /locus_tag="HG536_0A03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281271.1"
                     /db_xref="GeneID:59323588"
     CDS             570976..572016
                     /locus_tag="HG536_0A03080"
                     /inference="similar to AA sequence:RefSeq:NP_013866.1"
                     /note="ancestral locus Anc_2.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137166.1"
                     /db_xref="GeneID:59323588"
                     /translation="MRPIMLVGHERPLTQVKYNREGDLVFTCSKDNVASVWYSINGER
                     LGTLEGHTGTIWSIDVDRYTQCCVTGSADYSIKVWNVCNGQNVHTWSSPVPVKRVEFS
                     PCGNYILAILDDVMKYVGSINVYQLKRDPQTNEILEFVQDPVHCITTQDGLAAASVAG
                     WSAEGRYIIAGHKDGKVSKYNTKTYEFEGAIELHSSNVSDIQFSPDRSYFITSSRDSN
                     AYIVDVATLQVLKRYEADCPLNSACVTPLKEFVILGGGQAARDVTTTSAREGKFEARF
                     YHKIFEEEIGRVKGHFGPLNYVAVSPQGTSYTSGSEDGFVRIHHFEKSYYDFKYEVEK
                     AAEAKEHMQLAA"
     gene            complement(<572043..>572240)
                     /locus_tag="HG536_0A03090"
                     /db_xref="GeneID:59323589"
     mRNA            complement(<572043..>572240)
                     /locus_tag="HG536_0A03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281272.1"
                     /db_xref="GeneID:59323589"
     CDS             complement(572043..572240)
                     /locus_tag="HG536_0A03090"
                     /inference="similar to AA sequence:RefSeq:NP_075208.1"
                     /note="ancestral locus Anc_2.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137167.1"
                     /db_xref="GeneID:59323589"
                     /translation="MARGNQRELARQKNLKKQQENGKNQKKTGDPKKRMESDAEILRK
                     KQAAADERKEAERAAQLKSKR"
     gene            <572753..>574369
                     /locus_tag="HG536_0A03100"
                     /db_xref="GeneID:59323590"
     mRNA            <572753..>574369
                     /locus_tag="HG536_0A03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281273.1"
                     /db_xref="GeneID:59323590"
     CDS             572753..574369
                     /locus_tag="HG536_0A03100"
                     /inference="similar to AA sequence:RefSeq:NP_010198.1"
                     /note="ancestral locus Anc_2.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137168.1"
                     /db_xref="GeneID:59323590"
                     /translation="MFGGSARLAAVRSRAVSRRAFSVGPRALQQQQPAAAVVAGKGSF
                     FKRAGKAALKLTLLSGLLGTAYVSYHLYREKNPAPQKPQTATFSNGSPRKTLVILGSG
                     WGAVSLLKNLDTTLYNVVVVSPRNYFLFTPLLPSTPVGTIELKSIVEPVRSIARRAPG
                     EVHYYEAEALDVDPQNKTVKIKSVNEDYEYEMDLKYDYLVNGVGAQPTTFGIPGVVEN
                     SSFLKEISDAQEIRMKIMTSIEKAATLSPNDPERSRLLSFVVVGGGPTGVEFAAELRD
                     YVDQDLSKWMPELSKEIKVTLVEALPNILNMFDKTLVDYAQDLFKRDRIDLRLNTMVK
                     NVDKTHITAKCGDDVAKMPYGVLVWATGNAPREVSKKLMTKLEEQNSRRGLLIDDKLQ
                     LLGAQGSIFAVGDCTFYPGLFPTAQVAHQEGEYLAKVFKKLYKIDQLKWEIAQGKGNA
                     SQLESKLARLQNQIEPFHYHHMGALAYIGSEKAIADLAVGESKYRSAGSFTFLFWKSA
                     YLAMCLSFRNRVLVAMDWAKVYFLGRDSSV"
     gene            <574683..>576713
                     /locus_tag="HG536_0A03110"
                     /db_xref="GeneID:59323591"
     mRNA            <574683..>576713
                     /locus_tag="HG536_0A03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281274.1"
                     /db_xref="GeneID:59323591"
     CDS             574683..576713
                     /locus_tag="HG536_0A03110"
                     /note="ancestral locus Anc_2.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137169.1"
                     /db_xref="GeneID:59323591"
                     /translation="MNGSMTMETAADRALKLPLEPPFDTSDHSHHHHDHEIENDEFVN
                     HRAGRSTEEGSQEQSRDNAEHANNYDQQKLVSLSPEMGPSFISGNEASPETYTDERSG
                     AAGRKRFSESVTDPSLTAAAAAAVASIQDVWSENFNEPLPTNKEERIQQALEFMRNEK
                     HAHAADKNIKKHSIRQIALFFQVPKSTLYDRLKNRALLPGNDKAGSAVVASAVSTYSM
                     SSRAHSQQMKISMEKEELLLVQTKKLCHSLGNTINLTHLKDFITSLADGVSLGKKWVH
                     NFTRRHDNDLIYGTLSSRFNVRVSNSKNCRCNFEYLWRCFIPLLQETIKQLPQDEPFY
                     YIAKTSVHQPSMTSIFACFEVKPRDLSITLFGEPHLVMFPDYFGKSYAQRDAGKDPTA
                     SIMDGHENIDHENLRDSDPATEHIMNRHEKLQKHHKIEKLNTVFASIYERCCSSSNLS
                     PGIVPLVVFEGFSDRYNWDPSTAKDMVHLGRFLAVPWNQQILQQLISKQMMNVVSNVT
                     RRSSMVPSQLTDMETDTVLHHVDLDLGALRAKLTQILRTQTETLPPSIESHDPAQDNE
                     LNVFASTLRSSPDRGQDVESNFLAPKLTETQQQHQDSHRPLSPPPPPPLPPQIATVAS
                     ANIFENSSLSQLQDVINLIDTNEAELYRGLADPSLKATLMDIFRKIRAILPQ"
     gene            <577147..>578478
                     /locus_tag="HG536_0A03120"
                     /db_xref="GeneID:59323592"
     mRNA            <577147..>578478
                     /locus_tag="HG536_0A03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281275.1"
                     /db_xref="GeneID:59323592"
     CDS             577147..578478
                     /locus_tag="HG536_0A03120"
                     /inference="similar to AA sequence:RefSeq:NP_010199.1"
                     /note="ancestral locus Anc_2.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137170.1"
                     /db_xref="GeneID:59323592"
                     /translation="MSHEGEEDLLEYSDNEQEIQVDAKEAADAEVANEGNTEAAETNN
                     ADNEKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQ
                     AKSGLGKTAVFVLSTLQQLDPVPGEVSVVVICNARELAYQIRNEYLRFSKYMPDVKTA
                     VFYGGTPIAKDAELLKNKDTAPHIVVATPGRLKALVRDKMIDLSHVKNFVIDECDKVL
                     EELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLH
                     GLQQYYIKLEEREKNRKLAQLLDDLEFNQVIIFVKSTSRANELTKLLNASNFPAITVH
                     GHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDLTTEADQYLHRVG
                     RAGRFGTKGLAISFVSSKEDEEVLTKIQERFDVKIAEFPEEGIDPSTYLNN"
     gene            complement(<578838..>579782)
                     /locus_tag="HG536_0A03130"
                     /db_xref="GeneID:59323593"
     mRNA            complement(<578838..>579782)
                     /locus_tag="HG536_0A03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281276.1"
                     /db_xref="GeneID:59323593"
     CDS             complement(578838..579782)
                     /locus_tag="HG536_0A03130"
                     /inference="similar to AA sequence:RefSeq:NP_013864.1"
                     /note="ancestral locus Anc_2.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137171.1"
                     /db_xref="GeneID:59323593"
                     /translation="MSDNITGNNELLAKELVATGQSSVMSDDKAFSDTKLSELDLAIV
                     RARSLLRTLNSGMVNSPIEETRFSPLMEDLDEPGKSLTKHGINCTPRDSMEGGHEEAN
                     IGTKSSEESVMTTISSLMRALDDSMRQIQQLKLKNMLLKSNSDNLQSSYVVEENLRKQ
                     QFERMKYQFLLEKEQLIEKLRAKESKVAKYKSRVMEKNRQINKLTRILNDSAILDTSA
                     SETSDSTTRRSVTSIPLSSSSKYKTSDMLKTLGLLASQVLKDEVDEDSGNQTILQVAD
                     NTTDSEGLHTPIFDDQLRLPSQVSGDRAAPPSYSIAKN"
     gene            complement(<580258..>580906)
                     /locus_tag="HG536_0A03140"
                     /db_xref="GeneID:59323594"
     mRNA            complement(join(<580258..580665,580883..>580906))
                     /locus_tag="HG536_0A03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281277.1"
                     /db_xref="GeneID:59323594"
     CDS             complement(join(580258..580665,580883..580906))
                     /locus_tag="HG536_0A03140"
                     /inference="similar to AA sequence:RefSeq:NP_010200.1"
                     /note="ancestral locus Anc_2.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137172.1"
                     /db_xref="GeneID:59323594"
                     /translation="MSAVPSVQTFGKKKSATAVAHVKAGKGLIKVNGSPITLVEPEIL
                     RFKVYEPLVLVGLDKFANIDIRVRVTGGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSK
                     NELKKAFTSYDRTLLIADARRPEPKKFGGKGARSRFQKSYR"
     gene            <581635..>582422
                     /locus_tag="HG536_0A03160"
                     /db_xref="GeneID:59323595"
     mRNA            join(<581635..581638,581830..>582422)
                     /locus_tag="HG536_0A03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281278.1"
                     /db_xref="GeneID:59323595"
     CDS             join(581635..581638,581830..582422)
                     /locus_tag="HG536_0A03160"
                     /inference="similar to AA sequence:RefSeq:NP_010201.1"
                     /note="ancestral locus Anc_2.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137173.1"
                     /db_xref="GeneID:59323595"
                     /translation="MAISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARASKAA
                     KIAPRPLDLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRRQ
                     NRNQEIFDANVQRLKEYQSKIIVFPRNGKAEAEQVLSTAAAFPITQPATDVETRAVED
                     NGESAFRTLRLARSDKKFKGIREKRAREKAEAEAEKKK"
     gene            complement(<582646..>582966)
                     /locus_tag="HG536_0A03170"
                     /db_xref="GeneID:59323596"
     mRNA            complement(<582646..>582966)
                     /locus_tag="HG536_0A03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281279.1"
                     /db_xref="GeneID:59323596"
     CDS             complement(582646..582966)
                     /locus_tag="HG536_0A03170"
                     /inference="similar to AA sequence:RefSeq:NP_010202.1"
                     /note="ancestral locus Anc_2.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137174.1"
                     /db_xref="GeneID:59323596"
                     /translation="MSTESALSYAALILADAEVEITSDKLLTLTEAANIPVEGIWADI
                     FTKALEGKNLKDMLVNFSAGAAPAGVAAAGAASGEAAGEAEEEKEEEAKEESDDDMGF
                     GLFD"
     gene            complement(<583293..>584726)
                     /locus_tag="HG536_0A03180"
                     /db_xref="GeneID:59323597"
     mRNA            complement(<583293..>584726)
                     /locus_tag="HG536_0A03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281280.1"
                     /db_xref="GeneID:59323597"
     CDS             complement(583293..584726)
                     /locus_tag="HG536_0A03180"
                     /inference="similar to AA sequence:RefSeq:NP_013860.1"
                     /note="ancestral locus Anc_2.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137175.1"
                     /db_xref="GeneID:59323597"
                     /translation="MGNAPAKLGDGSYGNDATANSRGGSGKAVSSSSTGAGGRITFSN
                     AEYNSARTRRGTSLVGSILGPGGGSRAGSEAGQSEKRRSTREREETKESHARQLVTKF
                     EQTVDGGFLAPYGCYGFEKLDYDADVVKTLIIDRQLAPFYLPLQDFNESWTREELIKI
                     VDGLPLHAAFDENLEKYEDIPVGNLRKQNFDGLIDKTLSKREQRRMRSKIFKARLYRK
                     RIIWQEVENEAFLEQKIEARKTNSKAKDKAMLPSDDLKYSLYKKGIECPICFLYYPEP
                     LNYSSCCQQPICTECFVQIKRAEPHFPHDEVDPAQPVTHDEEKDPNLLTSEAANCAYC
                     ATPNFGVIYRPREDRKVGIGGSEPSTYTLPEQLEDSNVEQRAAGNGPKHKPLVVASDM
                     IRPDWKMKLDKERARLAKRSANATAIHVSHRLIDPDHPSRRASAADNSNGRTQSSDWR
                     DIHDLEEEMLERAIRLSIADQNEKSKA"
     gene            complement(<584914..>586323)
                     /locus_tag="HG536_0A03190"
                     /db_xref="GeneID:59323598"
     mRNA            complement(<584914..>586323)
                     /locus_tag="HG536_0A03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281281.1"
                     /db_xref="GeneID:59323598"
     CDS             complement(584914..586323)
                     /locus_tag="HG536_0A03190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137176.1"
                     /db_xref="GeneID:59323598"
                     /translation="MTVESGSSHVFQGYVGKQKAYAKEGQGVYMTIEKNGKEYKHVFD
                     AISGAAVASLGWGDPDIAGIMSDALTKHTYSYPGLIANEEAEKLAKFYIDHSAPGVFA
                     SALWTCSGSESTENALKIIRQYQIERKKPRKIKIISRECSYHGFTLGAISIGNTPRGA
                     AFKDMMINQEDVCIKMPRCWPYRDMKEGETEEEYTQRLLDALENIILDNDPETVSAVC
                     VETLPGSSIGTPVPPKGYLKGLRDICNKYDLVFMLDEVMCGTGRANPNGKLNCWENFL
                     APEDAPDIQTVGKTLGSGYVTIAGVLISPKILGAYVEGTGLILGAQTYHSHAFNCATA
                     LGIQKKILQNGLTKNVFENGNLLGKKLQEALLDEPDNFVGDVRGLGGFWTIEFVKNKS
                     TKQPFPPEMKVGPCFADIALEHGVNVMGLSGADNYGGTWDICLLGPSFIITKDDVEVL
                     VQRLTKAVQALAQKLQSKA"
     gene            complement(<586717..>588537)
                     /locus_tag="HG536_0A03200"
                     /db_xref="GeneID:59323599"
     mRNA            complement(<586717..>588537)
                     /locus_tag="HG536_0A03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281282.1"
                     /db_xref="GeneID:59323599"
     CDS             complement(586717..588537)
                     /locus_tag="HG536_0A03200"
                     /inference="similar to AA sequence:RefSeq:NP_010203.1"
                     /note="ancestral locus Anc_2.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137177.1"
                     /db_xref="GeneID:59323599"
                     /translation="MNYTRSNELPHDITLGEFLFHRFKQLHSETIFGLPGAFNTQLLD
                     KLAKVPGLRWAGNTNELNAAYAADGYARLKGIACMITTFGVGELSAINGVAGSFAEHV
                     GLLHVVGMPPTSAQTKQLLLNHTLGNGDYKVFYRIASEVACYSTLMADQDLCAEEVDD
                     CITRAWILQKPVYLGIPINLIETMVSSAKLDKPLNLKLPPNDKHIEEEVVNQILQHMY
                     KAKNPVIISDACVIRHHVVAETTELSTRTRFPVYTTPMGKGAIDESLPNFGGVFMGSI
                     SPPEVREVVNFADFVLVVGCMLADFSTSSFHFGYKTKECALLFPTSVKFKHAIYPDLH
                     IKSLLEALLRKLDESKIKYKCQPAPPMIIPKSQLPSRHTLRHEWIWNQMSNWFQQGDI
                     IITETGTSAFGINQTHFPYDSRGISQALWGSVGYTVGACLGACFAVDEMAKDSLSPVS
                     RRVILFVGDGALQLTVQEVSTMVRWGLKPYIFIMNNQGYSVDRFLHHRSNASYYDIQT
                     WDYLRLLATFGARSYEARKIVTVGDFLEMVQDPHFARNDKIRMLEIMLPPMDVPQALM
                     DRWLTEQESKKRAGEETDAYTPSPESSLKRIRSDDLTPTD"
     gene            complement(<588877..>589989)
                     /locus_tag="HG536_0A03210"
                     /db_xref="GeneID:59323600"
     mRNA            complement(<588877..>589989)
                     /locus_tag="HG536_0A03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281283.1"
                     /db_xref="GeneID:59323600"
     CDS             complement(588877..589989)
                     /locus_tag="HG536_0A03210"
                     /inference="similar to AA sequence:RefSeq:NP_010204.1"
                     /note="ancestral locus Anc_2.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137178.1"
                     /db_xref="GeneID:59323600"
                     /translation="MNVQEITNEEIVHKQVYWGHASGGNGGQGQQEQPIEISYPTTEV
                     VGRGSFGVVFTTTIQQSGEMVAIKKVLQDRRFKNRELEIMKLLQHPNVIDLKYYFYEK
                     DPHGEVYLNLILDYMPQSLYQRLRHFVHLTSIMPRLEIKCYMYQLFKALNYLHHHANV
                     CHRDIKPQNLLVDPQTWELKLCDFGSAKQLKPTEPNVSYICSRYYRAPELIFGATNYS
                     NQIDIWSSGCVMAELLLGQPMFPGESGIDQLVEIIKILGTPSKQEICAMNPNYMEHKF
                     PQIKPIPLYKVFKKEDDATVEFLINMLKYDPLERFNSLQCLCAPYFDELRFATDDLKQ
                     VVDNLKLLAFDYETELGHLTEDQLAAVKLKLMPSII"
     gene            complement(<591159..>592184)
                     /locus_tag="HG536_0A03220"
                     /db_xref="GeneID:59323601"
     mRNA            complement(<591159..>592184)
                     /locus_tag="HG536_0A03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281284.1"
                     /db_xref="GeneID:59323601"
     CDS             complement(591159..592184)
                     /locus_tag="HG536_0A03220"
                     /inference="similar to AA sequence:RefSeq:NP_010205.1"
                     /note="ancestral locus Anc_2.392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137179.1"
                     /db_xref="GeneID:59323601"
                     /translation="MVKVAVVGASGGIGQPLSLLLKLNPLVSELALYDVRLAQGVAKD
                     LSHISTNAVCKGFDKDQIAEALRGAHVVLIPAGVPRKPGMTRDDLFKINAGIVKGIVT
                     AIGQHCPDARILIISNPVNSTVPIAVETLKAMGKFYPGNVMGVTTLDVVRAETFLADY
                     LIAQKKNSLSKQFDKTKMYKDVTVIGGHSGNTIVPVLKKKPLISTLASSYDEFVQRVQ
                     FGGDEVVKAKDGAGSATLSMALAGYRFAEQVLKSIHRENTPPIPTYVYLPGIANGVKA
                     QAKLSSSLEYFSLPANLLDGRVTSVDDTILDSLSPQERKLVERAVKELGSNIDKGKKF
                     VNGNAKL"
     gene            complement(<592288..>592836)
                     /locus_tag="HG536_0A03230"
                     /db_xref="GeneID:59323602"
     mRNA            complement(<592288..>592836)
                     /locus_tag="HG536_0A03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281285.1"
                     /db_xref="GeneID:59323602"
     CDS             complement(592288..592836)
                     /locus_tag="HG536_0A03230"
                     /inference="similar to AA sequence:RefSeq:NP_013858.1"
                     /note="ancestral locus Anc_2.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137180.1"
                     /db_xref="GeneID:59323602"
                     /translation="MGLLTIIKKQKLKDNEIRCLILGLDNSGKSTIVNRLLPKDQRST
                     EITPTVGFQIHTAHIQDRLVSLWDIGGQTTLRPFWDNYYDKTDVLVWCIDVSQPLRFD
                     ESARELFSFLQRDRGRPGHDLKLIVALNKIDLLSGSSLTTCVASVQDDLSDVAGAGAV
                     FVRCSGVTGQGMEELSYAMCAD"
     gene            <592961..>594583
                     /locus_tag="HG536_0A03240"
                     /db_xref="GeneID:59323603"
     mRNA            <592961..>594583
                     /locus_tag="HG536_0A03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281286.1"
                     /db_xref="GeneID:59323603"
     CDS             592961..594583
                     /locus_tag="HG536_0A03240"
                     /inference="similar to AA sequence:RefSeq:NP_013857.1"
                     /note="ancestral locus Anc_2.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137181.1"
                     /db_xref="GeneID:59323603"
                     /translation="MSRRSIVQVSSSDVRRRRSGVVKSTKKQRKLSEFDIPTASSLQV
                     RQRSFEEVIVRNNQDDPIIIEEEEEEEVVAIKEIKCPICQIDITNFEIYQKEAHAESC
                     LEKSTEAASKRSLTASAVSRPKLPEIKILSFVNGHKVVVDGFNFERDPVISQYFLSHF
                     HSDHYMGLRKSWDHGTIYASQITVDLMINKFNINRDLVRALPMNQETWIWANISVIPL
                     DANHCPGATVFLFQEWDDRRRNVVKQILHTGDFRSNPQLISRLNSICPTALDQVYLDT
                     TYLIPGFHFPSQDSVLSVTSRFASQLAEKGIRQFFNDSQQSIFRFIARSTASRTLYNC
                     LFLVGTYTIGKEKLAIAIAEALNTKIFVSKKSSRHKIISQYLSYFPEGLITHEVEQSC
                     VHLVPLSTLRSKESIDLYFKEHSKIYQDVVGFIPTGWTFTNKFAKPPDLPTQESRIQY
                     CEQLLQDHQNNTLDLRFILKQYKKHNRYQIFNVPYSEHSSFKDLALFGTQVHSKEILA
                     TVNLHSLERIKDMHQWFKTWQAMQNRRCYGRR"
     gene            <594864..>596729
                     /locus_tag="HG536_0A03250"
                     /db_xref="GeneID:59323604"
     mRNA            <594864..>596729
                     /locus_tag="HG536_0A03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281287.1"
                     /db_xref="GeneID:59323604"
     CDS             594864..596729
                     /locus_tag="HG536_0A03250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137182.1"
                     /db_xref="GeneID:59323604"
                     /translation="MKKDLEDQKVAIDGSPGVAEIREGDPLDSSTSQSSKETVVKQPA
                     RETAQQALGVGKTTGIALYLCVFSLALSLFLAALDIMIVSSIVETVANQFGDYSKTGW
                     IFAGYSLPNAVLSLIWGRIAAVVGFKTSVLTAIVIFEVGSLVAGVAHSMDMLIGGRVI
                     AGIGGSGIQGLAFIIGSTLVDESKRGLIIACMGGAFGVASVAGPFLGGAFTTHVTWRW
                     CFYINLPVGGLAFAFLVLFYHPNGKKLQSTRSTVVQFFNNLWAFAKRLRELFKLSTWK
                     TFVHELIFKFDIIESLLCSAGLVLILLAFSFGGSKYAWNSAPTIVMFVVGISLTIFAL
                     IYDFVIFPRLKVVRTNPRYQPLIPWKIFSKFSILVSNVTVFFTCMAFMCQVIYVVQFF
                     QLIYDETAWKASVHSIAMVVPTVITVMTSGIFNAKLGLVKPVALVGAFSGIIGAGLLT
                     LLDNTSTTSQHIGLLILPGIAFGATMQSSLIGSQIQLDKKSETYRMDFIAVTTLNNFL
                     KNLGQAIGGVVCNTVFTTSITNKMRQHHIDIGQNASADAVVVYRTHHFDGSRSLLGDL
                     LSDSIKNVFYMALGFSALAFIFGIFTSNKKLDMNKAPAKAEESGSEDSSSDNVNS"
     gene            complement(<596942..>598552)
                     /locus_tag="HG536_0A03260"
                     /db_xref="GeneID:59323605"
     mRNA            complement(<596942..>598552)
                     /locus_tag="HG536_0A03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281288.1"
                     /db_xref="GeneID:59323605"
     CDS             complement(596942..598552)
                     /locus_tag="HG536_0A03260"
                     /inference="similar to AA sequence:RefSeq:NP_013856.1"
                     /note="ancestral locus Anc_2.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137183.1"
                     /db_xref="GeneID:59323605"
                     /translation="MCATKMVTMRTPTEEHFHKSGELDDPRERSPRNSRAFHSYQTEH
                     HLLSRQTHTHVRNPSLPTLLNVDSSHSSAAETSPLTQEPMQDPSGHHLITPPSSSTRV
                     QFKTPIWKSGSSEHSEFELSSAFRHDSTSSTRRQSSIESLMRAAATVESDTDLNKTYQ
                     DKVATILELKNEISNTIRNWPIAKDTSSQELYSAQKSSDSGTGGSSDKILLDQISCEN
                     LASLNEVTQRLNNAVKELVYLKEHVRYLKESAAAISRARPVSDSGKRVTLPPIEALTM
                     NLPKKASSKNFQFKNEAAKTSVVPPALEQQKRSSSFHDPRKSHERLSASRISGSATWP
                     PSYIGANHRPTLSDPSAYRNMGKADGSAQEMQYSKPITVPVPPGTRPIILNAQSSLQT
                     SVKMKNKIVKKRKKSSSEKSSPDYHRSLTHGLLLSEPIRKDEQSTTSCVHCGENSTPE
                     WRRGPYGNRTLCNACGLFYRKLIKKFGVKDANLLMRFKKQVNPEDRRVPSVLNVPAAF
                     ISNLDNDSTLDAEYNTIGSISGPSSSGA"
     gene            <599635..>600849
                     /locus_tag="HG536_0A03270"
                     /db_xref="GeneID:59323606"
     mRNA            <599635..>600849
                     /locus_tag="HG536_0A03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281289.1"
                     /db_xref="GeneID:59323606"
     CDS             599635..600849
                     /locus_tag="HG536_0A03270"
                     /inference="similar to AA sequence:RefSeq:NP_013854.1"
                     /note="ancestral locus Anc_2.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137184.1"
                     /db_xref="GeneID:59323606"
                     /translation="MGADKVYERKSFSKEEWNDAVAACTAPLLGDGRGNVAGMGLNSG
                     GADGSTSAEPSIPKLLLNYFVCMGFEESSVRMAREMGYVKSNKDAQEFNDLYKIRERA
                     HISKLIKTGRVSEAMEEINSTFGIEVLECGAAGPSKDGNGGASFSGYVGSSDGKDDLH
                     FKLLLLDLIEKIRKHDRDTAGSQGTDDDFVLELIKYSQEKLALKAASNKTYMAELELV
                     MTLLLFPKGGDSKVKLPKSLKNLYSLSLRSHIAELVNRKLLRCLHSQVATHASQVGKF
                     PDLIGFSSGIAGKPFSHYNEILMVRPKEDVGQHLTTDSLAELRDSDDGRLRSTATSAN
                     DDWSWTTDMIKEQQEDGQVKSAAISMDKASSNDDFDLSEARLVQVMKLWAWCENQLHS
                     NDIGVPRVHRSM"
     gene            complement(<600857..>601555)
                     /locus_tag="HG536_0A03280"
                     /db_xref="GeneID:59323607"
     mRNA            complement(<600857..>601555)
                     /locus_tag="HG536_0A03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281290.1"
                     /db_xref="GeneID:59323607"
     CDS             complement(600857..601555)
                     /locus_tag="HG536_0A03280"
                     /inference="similar to AA sequence:RefSeq:NP_013853.1"
                     /note="ancestral locus Anc_2.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137185.1"
                     /db_xref="GeneID:59323607"
                     /translation="MSFAEGYFEVESRIIDRLARLPYVQQFVHDKISGRITLFLLVVG
                     TMAFINELYITIEMTFLQKETYEELNKGYIDESLKLHRMIVQDNYHSREYLDEKSGIV
                     IEEFEDRDKFFAKPVHVAHLYAMCNVLKDGKPVLAKPLQFHIEFSPEDYEDERRPEFG
                     CRLRVLRTKLYHFFKDTQLFSELVKKPENFTVSDSVKIYNSASEPLPCTIDDVQLCFL
                     KIETGDTIQCDLII"
     gene            <602235..>602825
                     /locus_tag="HG536_0A03290"
                     /db_xref="GeneID:59323608"
     mRNA            <602235..>602825
                     /locus_tag="HG536_0A03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281291.1"
                     /db_xref="GeneID:59323608"
     CDS             602235..602825
                     /locus_tag="HG536_0A03290"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137186.1"
                     /db_xref="GeneID:59323608"
                     /translation="MKFQLSLIIIQFVVLAKAVALSGQEGTAGSLYQTQSMPIAVPNE
                     TVSVGVLTSIVQATQTESFSSITPSTIYAFSGEPGAASDVLQLPIGSSGLLSLSSSDS
                     VDASSALSQFLNGAGVATSLSVSKTGSLSRSRTDSASFSSTRATTRLAANSSATMTSD
                     GRSSSSTNSISASGGAHRMASPAIAGGMIAGLVAFL"
     gene            <603050..>603604
                     /locus_tag="HG536_0A03300"
                     /db_xref="GeneID:59323609"
     mRNA            <603050..>603604
                     /locus_tag="HG536_0A03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281292.1"
                     /db_xref="GeneID:59323609"
     CDS             603050..603604
                     /locus_tag="HG536_0A03300"
                     /inference="similar to AA sequence:RefSeq:NP_013141.1"
                     /note="ancestral locus Anc_2.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137187.1"
                     /db_xref="GeneID:59323609"
                     /translation="MRLIQWIGFLYALTAYALSLQSTPTASDAARASAAQANLPFYTV
                     CLADINTNMPAYSSYMVDNNRQLPPAVANYYFHAVTLASTADLEADIANSFPFTEFQT
                     FITQFPWYDSLKQKASVSTVYLPQDFMTSSIPTSGRQTTVTAATTTGQTASSDNHSAT
                     ENKAVSINPSLFALILAVFGAFLA"
     gene            complement(<603601..>604980)
                     /locus_tag="HG536_0A03310"
                     /db_xref="GeneID:59323610"
     mRNA            complement(<603601..>604980)
                     /locus_tag="HG536_0A03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281293.1"
                     /db_xref="GeneID:59323610"
     CDS             complement(603601..604980)
                     /locus_tag="HG536_0A03310"
                     /inference="similar to AA sequence:RefSeq:NP_013852.1"
                     /note="ancestral locus Anc_2.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137188.1"
                     /db_xref="GeneID:59323610"
                     /translation="MQVCFAAPVKFYSTYSELIPAPRGFDTIFNPLQSDKWQHFPENF
                     PSNLTLSLGKDKTCHVVVAWNGRTMETIKVNLLDSARTIQFTARCPAISCKYIVLTES
                     GMFMRRFQVSLNSEDDFERLQVILAGLRVAVKPARPRMSTADQSKLNCKYLGQPNVSA
                     NPLSTIESNTLAANLSAQNAFSDNSLVESQYATGSVEQGFQYPLCSQISSEIPWQAQS
                     GSYFATALNHSDTQNEAQMVLPNQCFPFSNDTTSLTGPAPPIPSKPEVPSDCGMQSTV
                     QSISVALNKETKANLEFTTEGSCSISKSTEGKDVTCIAPAELFTEKKSCLSKDNIELP
                     QLRRDLISKPHETRSEGNRSQEIASEHLAITTPSEKNVLDNERNIRSEEGASKKGLKP
                     LGVNKSNDTKNEEKASRQSPIVQPAATFQKIRISKRAIKEKLKDEYFMKWVSKVEEAL
                     SAMTDVQSP"
     gene            <605196..>605843
                     /locus_tag="HG536_0A03320"
                     /db_xref="GeneID:59323611"
     mRNA            <605196..>605843
                     /locus_tag="HG536_0A03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281294.1"
                     /db_xref="GeneID:59323611"
     CDS             605196..605843
                     /locus_tag="HG536_0A03320"
                     /inference="similar to AA sequence:RefSeq:NP_013851.1"
                     /note="ancestral locus Anc_2.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137189.1"
                     /db_xref="GeneID:59323611"
                     /translation="MKQQEHCYTFWMVYFYESEPLEGSRKYQIATGKDKYENDLLIKY
                     GYRELNYVWFHTDKYSSGHVYLKLHPDEKSLDDVPAEVVNDCLQLCKSMSIQGNKMNQ
                     CTILQTPWHNLRKNQYMKPGEVSFKSLQRVRKKQCFARDQRLLNRLAKTRVEVTDEVE
                     QLLHQAKKSKDGDFFLRYVADNREKLIEEARVRKQDKKRRKKREQEDGSDSNLSS"
     gene            <606064..>607614
                     /locus_tag="HG536_0A03330"
                     /db_xref="GeneID:59323612"
     mRNA            <606064..>607614
                     /locus_tag="HG536_0A03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281295.1"
                     /db_xref="GeneID:59323612"
     CDS             606064..607614
                     /locus_tag="HG536_0A03330"
                     /inference="similar to AA sequence:RefSeq:NP_013850.1"
                     /note="ancestral locus Anc_2.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137190.1"
                     /db_xref="GeneID:59323612"
                     /translation="MSKRSIASEEEQRVVAAKIGGNDVPAVGSKNEEPDIEMGEFEDA
                     YSDEFESDGEIIEVDEEEDKEEDEEGIDEQKFIEKKQQDAQKQLEKEQKEDNAREELY
                     LPHLSRPLGPDEVLEADPTVYEMLHNVNMPWPCLTLDVIPDGLGTERRNYPQSLLMTT
                     ATQASKKKENELMVLKLSQLNKTLVKGDGDDEEEDEDDEGDDSDPIIENENIPLKDTT
                     NRIKVSPFASKQEVLTATMSENAEVYIYDLAPQTRAFETPGYQIPKAAKRPLHTVKNH
                     GNVEGYGLDWSPLIKTGALLTGDCSGQVFLTQRHTSKWVTDRQPFTVSNNKSIEDIQW
                     SRTESTVFATSGCDGYIRIWDTRSKKHKPAISTKASTTDVNVISWNEKIGYLLASGAD
                     DGKWGVWDLRQLSPNNSDNVQPVAQYGFHKGAITSISFNPLDESIIAVASEDNTVTLW
                     DLSVEADDEEIKQQTLEVSELKQIPPQLLFVHWQKEVKDVKWHRQIPGCLISTGTDGL
                     NIWKTISV"
     gene            <607755..>610745
                     /locus_tag="HG536_0A03340"
                     /db_xref="GeneID:59323613"
     mRNA            <607755..>610745
                     /locus_tag="HG536_0A03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281296.1"
                     /db_xref="GeneID:59323613"
     CDS             607755..610745
                     /locus_tag="HG536_0A03340"
                     /inference="similar to AA sequence:RefSeq:NP_013140.1"
                     /note="ancestral locus Anc_2.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137191.1"
                     /db_xref="GeneID:59323613"
                     /translation="MSRHLWPLSPPQTCKINDSIHALANNEVNNNDILQTISLPQANV
                     LVMVTPGRVLAYNMKPMALVASHERTPESIEEFGLNRSITQSVALDRHVGGLNNQTQS
                     NSLAWNQGKIVFYVATDKSFLLTYQILKSSANITTFKDYGIPIIDFGKLSEDLEQEYD
                     DSVDDDILTVFEKGKTSKIIQNGYAVTKEKGFLQFLSVNQENLDELPVRRLELRLKVV
                     LKFDYRIIDIISFKRLSEKDEKAEESLLVLFPHGLQLLSLENFKLKNSSLVQLTNGSR
                     ICIIQDQLLVVAQPSDHKAVLINNIKINEQKVDVAEFPVEAKLTTCFELKGKMALVCG
                     GTLVYYNPQTNELDYKFKVPFPVKICGKLNDETLILISRTNVMHFMTPFGNALFSSAG
                     DSEFEEPSSSFEYSGFAYVDKLLVSVSSSGEYQMWDLWEEAKQGFSDARSPVSYVLQN
                     NKNDIAIYSPAKGSSAAQDLMQVIKLPTRAINNCVPLIKISSNNKLMAVYVSNKNILL
                     IQNLETNVWYTFKEMTVLDMHWLSSTYLLCAIKRDDWTTSVQCFRLNLQGLDSSDIAK
                     YKIWEYQLQAPVERLRLQVSLFHKHKLLKIKSRENSELEKYGEKFYKTAEVIITTSDK
                     IVIFAILSILHPSGIHIIKKFHEHAKITIPSPILTESIDWAASFKDGLIYCSDNRIMK
                     ASEISGSGWTTTVLLEEVERIIDILSDEIYVVSGHCKLFYKIDDLWEKRPPLLSIRLE
                     DDYYPISVSPDATTIHGLSCVFHNDYSKLIIKHKIYLDQMISAKIAQNVSLQDISTEF
                     RPIKHYNFALEKILSLKILASEPLDQIIELVKLCDSPQNWEASGFNPHSDMLEIISNC
                     LRKIEAKHWNQLFSNLKMTPRELLARCLEGNEAKIIGVLLLVFLNYDVELVDDLRSDK
                     VDDDSDSTVPSEGKDSAVADLIRDQEMMLKVLRLLVTSAANAEDSATAAESWDMCFQL
                     IRLLKELDKQNKTQLVQQALQMFQ"
     gene            <611357..>611647
                     /locus_tag="HG536_0A03350"
                     /db_xref="GeneID:59323614"
     mRNA            <611357..>611647
                     /locus_tag="HG536_0A03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281297.1"
                     /db_xref="GeneID:59323614"
     CDS             611357..611647
                     /locus_tag="HG536_0A03350"
                     /inference="similar to AA sequence:RefSeq:NP_013139.1"
                     /note="ancestral locus Anc_2.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137192.1"
                     /db_xref="GeneID:59323614"
                     /translation="MTAEQKIQQISEKAHQPGQESPLHTVGFDARFPNQNQTKHCWQS
                     YVDYHKCINMKGEDFAPCKVFWRTYSSLCPLDWVDKWDEQRAKGIFPGDINP"
     gene            612089..612161
                     /locus_tag="HG536_0Atrna1A"
                     /db_xref="GeneID:59324249"
     tRNA            612089..612161
                     /locus_tag="HG536_0Atrna1A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:59324249"
     gene            complement(<612182..>613090)
                     /locus_tag="HG536_0A03360"
                     /db_xref="GeneID:59323615"
     mRNA            complement(<612182..>613090)
                     /locus_tag="HG536_0A03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281298.1"
                     /db_xref="GeneID:59323615"
     CDS             complement(612182..613090)
                     /locus_tag="HG536_0A03360"
                     /inference="similar to AA sequence:RefSeq:NP_013849.1"
                     /note="ancestral locus Anc_2.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137193.1"
                     /db_xref="GeneID:59323615"
                     /translation="MAFPRRIPIGGWKHALKPESPTVITFDAYNTLYATTLPVMQQYC
                     LVAKKYNVIADPMQLTMKFPKVFKELRDRHPNYGKFTGITAVEWWSKLITNVFQPLEI
                     SKEMVEEILVRFEGYQAYQVYPDVLDFIKEAKSKHPDVILGIISNTDPVVYTLLQNLG
                     LYEYFKPHIFLSYDLDLKKPSKEIFEYALEDMAKRYPRLLENNDLGTLRSRCWHIGDE
                     AINDMRGAENAGWNGVLIDRNNKYGHLSRSFEHKDRSSDLLSVDKIDTTSSISYEESL
                     RQMDTVLLGERAFVVSNFKTLQDFLL"
     gene            <613439..>615439
                     /locus_tag="HG536_0A03370"
                     /db_xref="GeneID:59323616"
     mRNA            <613439..>615439
                     /locus_tag="HG536_0A03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281299.1"
                     /db_xref="GeneID:59323616"
     CDS             613439..615439
                     /locus_tag="HG536_0A03370"
                     /inference="similar to AA sequence:RefSeq:NP_013135.1"
                     /note="ancestral locus Anc_2.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137194.1"
                     /db_xref="GeneID:59323616"
                     /translation="MTIKEIEDTSKWRLVSSSIIPDPKHAVKELIDNAIDAGATSIYV
                     DIDSNTSGCHYICVRDDGSGVDKADRNAMCLNHATSKIRSQDDLSHLKTLGFRGQALF
                     SLATLANKKGSMEITTKSKSESVGEKWLVPKDGLTKGIDRKKVSCPSGTTVLIKNLLL
                     GLRARYLHTVARAARSNEEIHRLTQHYSLIFRSIRFHFCLVTVDKDGQVTRKQLQQSL
                     EPNLSRVRALSIASKLRSPVSDNFLVNDNLPVNKFIHLNVILPRMQPQTDVCGLNKNK
                     RFLSVNNRIISLQLNFGTSVAKIVNKIYREANLMDPTTWYINFECDARILDVNVEPGK
                     NDVMIKDVSIVMRQLEESLSAYIVAELGKKGCEEIEMTGRIPRRPGICQEATVTSQKP
                     GNNGGVSTVNGDQHAGKQGEIKRNESLLPSANENVRSVGSTSALRCAKRQAASDYVYP
                     DEIRWKCNLNSDDAVGTQEVTNRHCSSSLESSPIPGCENEDMEVARNISLSNPFMIAK
                     LKHFSVKQRKIEVPQKNLDNSSSHDSADVAHLESRRYLESAPTYPRADFKQPSLSSTC
                     GDTTLIDEEIVDEERIGHKACLASRRLRLYSEHTEGVTQSVDYNYGKYSQSAYKNELQ
                     WLSRDSDPKNRVTESLIALSKDLKDKRISLSRAKEGWFILTN"
     gene            complement(<615893..>619828)
                     /locus_tag="HG536_0A03380"
                     /db_xref="GeneID:59323617"
     mRNA            complement(<615893..>619828)
                     /locus_tag="HG536_0A03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281300.1"
                     /db_xref="GeneID:59323617"
     CDS             complement(615893..619828)
                     /locus_tag="HG536_0A03380"
                     /inference="similar to AA sequence:RefSeq:NP_013848.1"
                     /note="ancestral locus Anc_2.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137195.1"
                     /db_xref="GeneID:59323617"
                     /translation="MLNSNTPRGNHWIGASSTSSTYQAIDGRTSGSQEWRFRSSKSYD
                     RVSSTLSDGRARGDTKYTLGPDGKRFGELQSQPLISPEVLEASRQRALALLIFAIIQG
                     YKVYDLIVLKNKVAVVGRLFDSSRLSFIFKYLIIDSLFLYFLPSFKIPKLTFQPWAVT
                     VQIVAMTVITVLISNEHGFALLSVFGAAWRKLSTKEVSLTGSSVNMRKVMDSSSHFRG
                     ALTIKILPENTAMFNPLHDSFCLPMDASLVPEGHVKVPIRINSTADISLVQLEYRDIY
                     TDRSELRNLTSKEFRLVEDLSGLLSRDRLMSQRVQDTSTIRYIELPLNDVGFYQIKKI
                     VDTKDFSLKVYQSHLVIPYCPVASITGHGSSDRCIGDSDRVSLEVQGVPPMKLTYTKS
                     INGKARTYVDTNLVPEFFETPLQSTRKHIFSATDLSDLKWGRNYPVTINLDTTASQDG
                     HYVYKIDKLVDGLGNVMDFTKIPEALQEDYQVSYDFKVHEIPRGSLDEKFDPKSSTKR
                     AIVVKFEKPPTWEDSAPYSANISFVDEKQKLHLRSISTTSHHASFQAESPGTYKLEGI
                     SSKHCPGVVIGKSSILITKPVPPQLDVKSTPILDQCVGQVGLNFDLTFTGAPPFQYMA
                     MIYKMEENKKWRLYDTKRYTSEGTRSQFSYNPTIEGNYEIVFDHLTNKLFTDQISLVP
                     REKYTFKTSMRVKPSAKFKTLKEVELCLGEQTKVPVTFHGEPPFSLTYDIVETSSNKR
                     SSRKVDNLLTYDYEIEIPRFEVGGDYIVSLVSVKDSSDCLVGLSEPDARIKIRRDIPS
                     AAFNLLDNSNQVKIKQGSQAHIPLKLAGEAPFTVKYEHFDSHGQLLGVYETQFHSSYK
                     PVLKVSNEGRYKLVDVRDSSCSGIIEDPESHFEVGFLDKPSFTVVANSKIEKVSDTNF
                     VKHEVCQGTESVLDLALSGSPPFSLRFDLVTPNGHSISKAIQVATKYATIRLRNEEPG
                     EHIVIISALYDSNYGEEDFSKASYSSPEVIVKQKVNPLPEVKFSDSGKIFRACSTAVN
                     EETSSLAPISLRFNYGEAPFSVTFSIYHESTSRTEHCTIDKIVPGSFNYRRLYENLKL
                     GNHLIAIEKVVDANGCANDKIATENEHVWISVTDVPKIHLLDPTADYCVGDYVAYQLS
                     GNAPFNIRYEFNGAQLKLKEHTSQFVRLATEPGTISILSIGDSTSQCMVDFTKPNMKK
                     EFDRLSLVVHPIPSVTVSQGQNAVEDIHEGDQAEVIFSFEGTPPFSLTYVRTEEAEGR
                     KRPQIVETHKVTDIHSFEYRVLTSLQGTYEAIEISDAFCFAKNDAFFHY"
     gene            <620919..>622316
                     /locus_tag="HG536_0A03390"
                     /db_xref="GeneID:59323618"
     mRNA            <620919..>622316
                     /locus_tag="HG536_0A03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281301.1"
                     /db_xref="GeneID:59323618"
     CDS             620919..622316
                     /locus_tag="HG536_0A03390"
                     /inference="similar to AA sequence:RefSeq:NP_013134.1"
                     /note="ancestral locus Anc_2.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137196.1"
                     /db_xref="GeneID:59323618"
                     /translation="MSIYQVLRKFATFIGPGIMVSVAYMDPGNYSTSVSGGAQFKYTL
                     LFSVFISNIFAVLLQCLCVKLGTVTGYDLAENCRRHLPRKLNLVVYFFAELAIIATDL
                     AEVVGTAVALQILFGIPLTYGVILTVLDVLVILMFYQQDGASMKKVRAFELFVSGLVA
                     ATVICFLLELFKITIPDKLELIRGYLPSAIIFKDQGALYISLGILGATVMPHSLYLGS
                     SLVKPRLQEFDIKRYGKVGKRPSVKAIKYNLNYSYAELIISLFLIATFVNSAILIVAG
                     ATLYGQPEAKDADLLSIYNLLVHYISPAAGLIFALAMIFSGQSAGIICTVAGQIVSEG
                     FLKWSLPPWATRLGTRLIAIVPCLFITLTMGERGISDVLNFSQVVLSLILPIVSAPLI
                     YFTANRKIMTVIDEHGEGENEDENTPLTMPGGKTVDYTNSRWLTISAFIVWAIIGALN
                     CYLVFSFLLGADVHF"
     gene            complement(<622402..>623637)
                     /locus_tag="HG536_0A03400"
                     /db_xref="GeneID:59323619"
     mRNA            complement(<622402..>623637)
                     /locus_tag="HG536_0A03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281302.1"
                     /db_xref="GeneID:59323619"
     CDS             complement(622402..623637)
                     /locus_tag="HG536_0A03400"
                     /inference="similar to AA sequence:RefSeq:NP_013133.1"
                     /note="ancestral locus Anc_2.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137197.1"
                     /db_xref="GeneID:59323619"
                     /translation="MYAPEQGGFYRLYHDIKLVCTMLIHYYSQGTRNYQMVDKFYKFA
                     IELILRECYKLGISLNNGKTDTSLVTDTETELDSVIAHDFIKISTNYKVPVAETYYIK
                     TRELELFSSMIAKSNLDNRPQELPNSNFEINKVIPQTNICEEAPKLGFVAANTSNIPD
                     PTLPPTEMMTRFLHPNWYALPTTMWLKYGDYKPWAPSFNENGTVIDSTTRGIIWLQRV
                     GYLQIYQDAENNAAEDKKEGSREPMDKTKLEDNLHEGKEEGALLNGESSTVDNKEEMK
                     DEDQKAAFDDAEKPLAQQHSIKLENLFDWKPSNYIDDDEIDGFKDGTQAQLVTSILLQ
                     IRNLRKDRVMNKIIKPSAEEVKLYNKARRLLKEVVLAKQVKELPMKHCRSFPVLQANY
                     NGSIPVVRLQPTRKRKSKK"
     gene            complement(<624124..>627777)
                     /locus_tag="HG536_0A03410"
                     /db_xref="GeneID:59323620"
     mRNA            complement(<624124..>627777)
                     /locus_tag="HG536_0A03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281303.1"
                     /db_xref="GeneID:59323620"
     CDS             complement(624124..627777)
                     /locus_tag="HG536_0A03410"
                     /inference="similar to AA sequence:RefSeq:NP_013847.1"
                     /note="ancestral locus Anc_2.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137198.1"
                     /db_xref="GeneID:59323620"
                     /translation="MGTYRKRFNEKARAGHMAKLKELKKVRNKQYFRHLEDGKQDQSD
                     EKGSVIEENEDSNAVLLKPMSKEEKQLKKRKLEELFAPKESKVSKQKKKRLEKFIEHQ
                     LKREEKKLIIEKLQDYKIDTSLMKPLKTLGQGKQTKKEAFQEALSLERQGRGNADTAE
                     ILYEEHETRDWDQDHGGSDAHEGDGDIEVDKAKQQSSFVDRRPASVGGSAFGFGFSNA
                     QVVHKKTSKPKYSWRRRIELAERKKNDLEDEMDFRSSSQEDEEGSSQGASDSDEHSSD
                     SSTEALEEGVQYSAADDFKKWANQQVKQIEGRDVEIVMPKPAVKYQPVIREEDLEDGL
                     IETVIPVDEHSQRKAFYVNVARPAEIQEIRMKLPVFGEEHRIMEAIHHNDVVIICGET
                     GSGKTTQVPQFLYESGFGNVDSPDYPGMIGVTQPRRVAAVSMANRVSSELGDHGSKVG
                     YKIRFDSNLKEDTRIAFMTDGVLLREMMKDFRLTKYSSIIIDEAHERNINTDILIGML
                     SRCIRLRAKEHAKDPKKNKKLKLIIMSATLRVADFSENTALFSSPPPILKVDARQFPV
                     AVHFNRRTPYDYMEEAFKKTCKIHRRLPPGAILVFLTGQQEINQMVKRLRREFPFRKE
                     HKVPKDLESNTISVKINPKTADLETEDVEFSVEIADEENFDDELGSEDDGENNSEGEE
                     GFDECLEEGQTENDPLYVLPLYSLLPTSEQMKIFNEPPTGSRLCIVATNVAETSLTIP
                     GIKYVVDCGRSKERKYNEDTGVQSFEIGWVSKAGADQRSGRAGRTGPGHCYRLYSSAV
                     FEHDFEQFSRPEILRMPVESVVLQMKSMAIQNVLNFPFPTPPERNSIHKAMNLLLRLG
                     ALDSAERITEDGRMMSLFPISPRFSKLLLISEEKDCLPYAVTIVSALSVGDPFLKEQE
                     VGLKSEDAEEDNSDDKEKEKALRSKYFKCKARFSRLDKYSDVFRLLSAICAFDFIAKN
                     ERPRFLRDNFLRAKFMDEILKLRKQLMYIIKSSTREENVAATVTDGDLKCDVPQDIQL
                     RLLKQMICAGFVDQVAIRADFLYPEEVPITNKTSIINIPYVPVLATKTPDISECFVYI
                     HPSSILTNAGELPPKFLVYHSLHLGNNGKTRMNSLCDIKSTPLANIAGKGSLVSYSKP
                     LSGHGMKSIDVSPSERYCYVIPRFGATVDSDLKIGWDLNPVAVHQKRINGQWKVQKII
                     PNKSYSAIQQQTK"
     gene            <628097..>629023
                     /locus_tag="HG536_0A03420"
                     /db_xref="GeneID:59323621"
     mRNA            <628097..>629023
                     /locus_tag="HG536_0A03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281304.1"
                     /db_xref="GeneID:59323621"
     CDS             628097..629023
                     /locus_tag="HG536_0A03420"
                     /inference="similar to AA sequence:RefSeq:NP_013846.1"
                     /note="ancestral locus Anc_2.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137199.1"
                     /db_xref="GeneID:59323621"
                     /translation="MVAENQEENLYGILSERNIKQVQFGIDKKFPTWYGSNAYFSPDS
                     RQLGFIEEDRTPVKREKSQYWLDTLYVCEYCFRYTDRDDSFVAHVAHCQFKSKAPGRA
                     KYKSPLYTIRRVRGSRHLLFCQCLCLFTKLFLDNKSMYFKVDHYEFYIVYETGNTKPM
                     AFFSKDLVSYHQNNLACILTFPPYQRLRLGTLLLEFSYALSKSEHIVSGPESPLSPFG
                     LISYLKYWSKVICWELVEGELANLGRLSIETIATVTGIRVGDIILTLKYLDCLGDNNQ
                     IHLPVLRRHLKAVERNHKELFMLHDEYLLIDD"
     gene            complement(<629104..>632523)
                     /locus_tag="HG536_0A03430"
                     /db_xref="GeneID:59323622"
     mRNA            complement(<629104..>632523)
                     /locus_tag="HG536_0A03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281305.1"
                     /db_xref="GeneID:59323622"
     CDS             complement(629104..632523)
                     /locus_tag="HG536_0A03430"
                     /inference="similar to AA sequence:RefSeq:NP_013132.1"
                     /note="ancestral locus Anc_2.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137200.1"
                     /db_xref="GeneID:59323622"
                     /translation="MSTDEKEERKRFFRDELESSQESLPKFNQVLEDNKSFLFSNGEA
                     EEATANGVSEHVESRDGNDDNVVSQNVSKLRNIVPDISLEMAIGLCKQYAHSGDVISS
                     AIGHYFEEASKAGNLSSPSRKSLPESLTTPIFEISQQSVSPEPAEKNTRYPSPKRLKP
                     SVSWKRFIGSLQMNVMATRPTLKPLKYGSELSIAKPAGEVKLSKLYDASGHKKSAFAA
                     YVKVFDAQHNRELGRIPENIAQILYPLMNIDDFFFEATMVFCDNKRLSIGDSFIVQLD
                     CFITSALFNPTTSSFHNTSFAKNSRARTWEGSQTIVETQEELEHRSRRTSLLALFDRL
                     RIAPYTEEKERGVGETEIIDLESEGSWSEARKDGTIKQGQETNHQDETLNLNQLKLFY
                     NATQSVEALEKLPEYEPSNDVFKLNLRRYQKQGLAWMLKREHAYDKLSASSEVEGVNE
                     NTMNPLWKQFEWPRDMSWAAQRSKKSQEREFSSNERFFYANLHTGEFSMDRPVLKTMT
                     KGGILSDEMGLGKTISALSLILSAPFDAKYLANKSGMFEEASRDSSRKPYAAKTTLIV
                     VPMSLLTQWGSEFERANNAADFYCEVYYGGNVSSLKTLLTKTKNPPTVVLTTYGIVQS
                     EWSKIGKGKSLHQNEGTSGLFSIDFYRIIIDEGHTIRNRMTATSKAVLQLSSKCRWVL
                     TGTPIINRLDDLYSLVKFLRLEPWSQIGYWKLFVSEPFERKQFKQAFDLVNAILGPVS
                     LRRTKEMRDADGKKLVELPPKEVIVEKIQFNTSQEKIYKYFLDKAENSVKTGLAHGDL
                     LKKYSTILVHILRLRQICCDAALLGSQDENDEDLRDGAQQFNESVNVESILGNSEDSS
                     QPKDDGDISDVITQVAEKYRSKDSFESLECSICTTESINLKSAVFLECGHAFCQPCIE
                     DYLDFQKQKKLEMRCPNCRELFRTKFLLTLCQDSEGNFTFVPYNESSKPAKILALLKH
                     LKLLQDTAAGEQVVVFSQFSSYLDILERELSNAFPPNVAKIYKFDGRLNLKERSSVLQ
                     EFSVKDLSRQKILLLSLKAGGVGLNLTCASHAFMMDPWWSPSMEDQAIDRIHRIGQTN
                     NVKVIRLIMENSIEEKMLHIQERKRTIGEAVDADEDERRKRRIEEIKMLFE"
     gene            <633347..>634297
                     /locus_tag="HG536_0A03440"
                     /db_xref="GeneID:59323623"
     mRNA            <633347..>634297
                     /locus_tag="HG536_0A03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281306.1"
                     /db_xref="GeneID:59323623"
     CDS             633347..634297
                     /locus_tag="HG536_0A03440"
                     /inference="similar to AA sequence:RefSeq:NP_013845.1"
                     /note="ancestral locus Anc_2.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137201.1"
                     /db_xref="GeneID:59323623"
                     /translation="MKSYVVKWRLWIYRGSIAIAMVFLVGFSIVLPIDCIAQAAESFN
                     NAWNTFIVVGALVAFAVACVIIIVARIIFYRSCKQHIPRWYLPFAPGDLPHRGSRKLV
                     LTNMERSRELSTLFKRPKDPVIHAGMEPPIRCDDKAYEKLFPEYLNYASCIKVVADRL
                     KYQGIFLNNADLKMGLDETFSDVVRNQFMDTEDKFQMENAQKLIDIYEMMRYSNEEVT
                     RSQFVDFVSLAIYFVDISLTMDKKLPHLKQINTTSRLQFNVDDEDWERKISRTPTGYF
                     NNESDKFDYVPYADSSSVLRRTFTGRSFIKPTSTSSHSGH"
     gene            complement(<634469..>637039)
                     /locus_tag="HG536_0A03450"
                     /db_xref="GeneID:59323624"
     mRNA            complement(<634469..>637039)
                     /locus_tag="HG536_0A03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281307.1"
                     /db_xref="GeneID:59323624"
     CDS             complement(634469..637039)
                     /locus_tag="HG536_0A03450"
                     /inference="similar to AA sequence:RefSeq:NP_013844.2"
                     /note="ancestral locus Anc_2.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137202.1"
                     /db_xref="GeneID:59323624"
                     /translation="MILPLDFDEDEGYRDFRPRVPKRQRLPPVVQLCKEMMPDIRTIG
                     ESVKAFEEDIKFLSDAIVNEYGHEDYFNNALLKTFRAVVLEQPHKQPAIALLTMVVNG
                     RNEVAAKSVINYFFEELQNCCKESIDENFEVRSNETGPWNKAKLLLRFLSLLSPILLK
                     DDPLGLYQKFFQLSVELNKMEGSKRNALSEELYTNTLLNIPYLFFFNREDENLQNRVE
                     EMISFVESEYEVKKTDISLLKEYNKNSPYESYELVEGVLSNVKRALANNMEQLSRLFP
                     DLRHLLPEQKNEHGFNEAFELPSAEILKPFSGLDMGFGSVDSMWKNPRYAFHVYLPNS
                     AGDFETVVPVTTYAGQLLNDIIIDITESMEFNRKEVARQVITLDLFFKPGIFAEPGES
                     IAQLAATYEENPLATTFKIEDLAIETILGLIFKLPDVSQPFAYFYTLLVEICQNSPKA
                     IAPVFGRAFRFFYNNLDNLDLELKSRYLDWFSIQMSNFNFSWKWKEWEDDSIRFGKSF
                     YCAKLNFAKNLIRKELRLTSNTLDVEDSLPEEFKKYLDSSYVPREQVHEFYQSLFSEA
                     HVVDIEEIKKNSLYFMQESVPFHEEVRQILDYIHKANDVREVIELETILDDMKQKYGA
                     VIRDFDRFVIVLLVQTVVYSGSRSLSHANKYISDLKDDMATIFGKLQMDNDAKEFLTV
                     EAVLRFWNSNSQNGFLISDAFKHAGLIKPEAIFAFSFTEYDNKNNGLVDGTSIESTFR
                     NLSQHSNNVECLEYVFERLCIITNETIAQLQVPAEEEIVCPTISDDMEIDLEEELPRL
                     DLIWKYETSVSFIKSILRKYAAQYRPLADKLREGLSTAVPHQQTRNQFLTWIDEIYQI
                     "
     gene            complement(<637507..>639732)
                     /locus_tag="HG536_0A03460"
                     /db_xref="GeneID:59323625"
     mRNA            complement(<637507..>639732)
                     /locus_tag="HG536_0A03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281308.1"
                     /db_xref="GeneID:59323625"
     CDS             complement(637507..639732)
                     /locus_tag="HG536_0A03460"
                     /inference="similar to AA sequence:RefSeq:NP_013131.1"
                     /note="ancestral locus Anc_2.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137203.1"
                     /db_xref="GeneID:59323625"
                     /translation="MDAGMSAMTSSRGQMRRDLLQSDVGNIDVSQEIPRGPPQPRQPY
                     PRMQNRMPQQQPYSGGPWPEETERRAYSLNQKSLSSFFRHKGPKMHHGRSKGGFGGKE
                     EDEEVIVDDSMSMMTYNDIRTSGNKGGERYGYGGDTAPIIPTLVTREHSNMNNVEYRK
                     HLTAQKKSAMNAMARAQKTPNDARSMSLQGYSSVNPMRQPNQMYPGFLAPPPYAGDPS
                     RPMMHPPAQPERGTFYGPTNHRPMPGAVGGPRAMSLMSPNVRPPNMRPGVNNFQPRPQ
                     QQAYGQPHGLSSDNLPPQPVKAAPTARDDTRGQLNVIQLSAPQQKDLREKERLLAERE
                     RELWEKERVFREQEALIRQELTQKEKKTELPKEEQASGQQRLAVDKKDIDLDPSPTLE
                     NGLRSLSVDDHSTTTKVDLHNRVSMGTFVSVFSDSPEKRRLANPSGMYQLEEKNRSMF
                     VTAQEFPTAGQHDPTEALAEDKDASLRDDTLTEMASTERRAKRSSMIKAKEFLRKLST
                     SSLNKENDSQIALNKSSSRLSMNSIPNSESSHYTLVRNREGGPALGRYKNNGSEDRLA
                     KSSEAQDDPDAFIFDNTLGKPYVPSFAEEDELLEINKFKTITISGEQLHILSENKELM
                     SELTLVSMELAESIKRETVLEEQLKNSNEATQGENPFSLADFETELRKKSSKIVELIQ
                     QLNNERLKRFIAEEQVLLTENGAKPSSIELLQKISALNDQLALKDAEVSQLKDQLSVS
                     K"
     gene            complement(<639907..>640248)
                     /locus_tag="HG536_0A03470"
                     /db_xref="GeneID:59323626"
     mRNA            complement(<639907..>640248)
                     /locus_tag="HG536_0A03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281309.1"
                     /db_xref="GeneID:59323626"
     CDS             complement(639907..640248)
                     /locus_tag="HG536_0A03470"
                     /inference="similar to AA sequence:RefSeq:NP_013842.1"
                     /note="ancestral locus Anc_2.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137204.1"
                     /db_xref="GeneID:59323626"
                     /translation="MANFFVALWESIFQPGTTPQLIVATHVSFIALLSTLIWLIYATK
                     GNVHFYALFIIALCLWVCVIWFIRELKSVDLKNNEQLEGSIKQEPAEKKIASAAEKEQ
                     PKSSTMRSRKL"
     gene            <641295..>641909
                     /locus_tag="HG536_0A03480"
                     /db_xref="GeneID:59323627"
     mRNA            <641295..>641909
                     /locus_tag="HG536_0A03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281310.1"
                     /db_xref="GeneID:59323627"
     CDS             641295..641909
                     /locus_tag="HG536_0A03480"
                     /inference="similar to AA sequence:RefSeq:NP_013129.1"
                     /note="ancestral locus Anc_2.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137205.1"
                     /db_xref="GeneID:59323627"
                     /translation="MGAYKYLEELQRKKQSDVLRFLQRIRVWEYRQKNVIHRASRPSR
                     PDKARRLGYKAKQGFVIYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRALRATA
                     EERVGRRAANLRVLNSYWVNQDSTYKYFEVILVDPSHKAVRRDARYNWICNPVHKHRE
                     ARGLTATGKKSRGINKGHRFNNTKSGRRKIWKKHNTLSLWRYRK"
     gene            <642271..>644049
                     /locus_tag="HG536_0A03490"
                     /db_xref="GeneID:59323628"
     mRNA            <642271..>644049
                     /locus_tag="HG536_0A03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281311.1"
                     /db_xref="GeneID:59323628"
     CDS             642271..644049
                     /locus_tag="HG536_0A03490"
                     /inference="similar to AA sequence:RefSeq:NP_013128.1"
                     /note="ancestral locus Anc_2.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137206.1"
                     /db_xref="GeneID:59323628"
                     /translation="MTDYKKTAILSVYDKTGLLDLAKGLAENNVRILASGGTARMVRE
                     AGFPVDDVSSITHAPEMLGGRVKTLHPAVHGGILARNLESDEEDLKKQNIDKVDFVVC
                     NLYPFKETVAKVGVTVAEAVEEIDIGGVTLLRAAAKNHARVTILSDPLDYSTFLSELS
                     QDGEISQELRNRLALKAFEHTADYDAAISDFFRKQYSEGVAQLPLRYGANPHQKPAQA
                     YVSQQDSLPFKVLSGSPGYINLLDALNSWPLVKELSASLNLPAAASFKHVSPAGAAVG
                     VPLSDVEKQVYFVSDIENLSPLAAAYARARGADRMSSFGDWIALSNIVDIPTAKIISR
                     EVSDGIIAPGFEPEALEILKKKKGGKYCVLQIDPNYIPESIETRQVYGVNLQQKRNDA
                     IINKSSFREIVSANKNLTEQAVIDLTVATIALKYTQSNSVCYAKNGMVIGLGAGQQSR
                     IHCTRLAGDKADNWWFRQHPRVLGIKWAKGVKRPEKSNAIDLFVTGQIPTEEPEKSEY
                     ESKFEEIPAPFTPEERKEWSSKLTNVSLSSDAFFPFPDNVYRAVRSGVKYIAAPSGSV
                     MDKAVFSAADSFNLVYVENPIRLFHH"
     gene            complement(<644774..>646705)
                     /locus_tag="HG536_0A03500"
                     /db_xref="GeneID:59323629"
     mRNA            complement(<644774..>646705)
                     /locus_tag="HG536_0A03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281312.1"
                     /db_xref="GeneID:59323629"
     CDS             complement(644774..646705)
                     /locus_tag="HG536_0A03500"
                     /inference="similar to AA sequence:RefSeq:NP_013837.1"
                     /note="ancestral locus Anc_2.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137207.1"
                     /db_xref="GeneID:59323629"
                     /translation="MNGTANQGSLVGAFSYLNQTAHSLVPETVIFSSLINYPYRIALS
                     VLNATRLQYEQAVASDELIPSLESVVDTIGYFFSSYAVASFVTALILNRFVIMASLRS
                     NTARTSLPLWSKFVLHLSALVPLFYNVIQTLNQVGIIEVFPAMGFPFYLARTFTIFAW
                     SHCVETFITTTTNSKPLEESDYTIFELSVQFYYLSQRNLYLTMAPEYLSDCLMALLGR
                     IWIHIVEMFNLRKHRLAGSTVLNITNIIFLIYQVKTHGFDSIPVSTRYRHFPKIFSLF
                     LIVMSVATYALACLVRKNPFGNQEYDTKELQFHSFMHNWWNHLNCTGEEEFSHVVNKL
                     ALLLCNGNESMNRGIHREYSSLNNPADIHRSYMISGYLNKVSTIPDDMDQKDPGTDKQ
                     LQRLGAPSIISKLKISYSLVKAAFTFFFKRKWLEKRQVQEKSANTNRSERSRDLNKFI
                     TERNYARFLTKPESDRNHGEETPLLPEEDYSEDYLPDFETSEDESETDTIGPDNSEEQ
                     AEEMLLSTTAPKEMEWFMAIWPILKVQLAEDRRLTRSQYAASSPADIIAEVVSQKRQC
                     ASATAGSTDEDMLGDNDEEDSRSNCVVCRINPRNIVLWPCTCFALCEECRISLGLRGF
                     NSCVCCRTEIHGYSRLNNV"
     gene            complement(646879..647006)
                     /locus_tag="HG536_0Atrna1L"
                     /db_xref="GeneID:59324255"
     tRNA            complement(join(646879..646923,646968..647006))
                     /locus_tag="HG536_0Atrna1L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:59324255"
     gene            <647971..>649236
                     /locus_tag="HG536_0A03510"
                     /db_xref="GeneID:59323630"
     mRNA            <647971..>649236
                     /locus_tag="HG536_0A03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281313.1"
                     /db_xref="GeneID:59323630"
     CDS             647971..649236
                     /locus_tag="HG536_0A03510"
                     /inference="similar to AA sequence:RefSeq:NP_013127.2"
                     /note="ancestral locus Anc_2.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137208.1"
                     /db_xref="GeneID:59323630"
                     /translation="MSQTLFNNIEQLPPDALFGIRQRLAQDSRAVKVDLGIGAYRDDN
                     GKPWVLPSVRSAEQLIQQDPNYNHEYLGINGLPELAAGAARIIFGENSNALNEGRVVS
                     VQSLSGTGALHLAAKFLSTFLAGRPLYISEPTWANHKSIFQSQGIKTVPYPYWQASTK
                     SLDLDGFLESIKDAPSGSVVLLHACAHNPTGLDPAEKQWPAILEAIASKNHIALFDSA
                     YQGFASGSLDRDAFAIRLGVEKLAKVSPVFVCQSFAKNVGMYGERVGCFHVVIPQQDD
                     STVDISKVNKAIASQLSKITRSEVSNPPAYGAKIVSKILNTPELTEQWHKDMITMSSR
                     ITKMRHELREKLVQLNTPGNWDHIVDQCGMFSYTGLTPEMVKRLEAQHAVYMDASGRA
                     SIPGLNQGNVEHVAKAIDEVVRHFTSSKF"
     gene            <649428..>650384
                     /locus_tag="HG536_0A03520"
                     /db_xref="GeneID:59323631"
     mRNA            <649428..>650384
                     /locus_tag="HG536_0A03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281314.1"
                     /db_xref="GeneID:59323631"
     CDS             649428..650384
                     /locus_tag="HG536_0A03520"
                     /inference="similar to AA sequence:RefSeq:NP_013126.1"
                     /note="ancestral locus Anc_2.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137209.1"
                     /db_xref="GeneID:59323631"
                     /translation="MDIRDRSAEFHKSVLVYKKRHNANSRHAEPQSNGIPGKSSEFQL
                     KASGIAHDISSTAQLLSKLAMLAKRKPMFNDNPVEIAELSFLIKRKIYAIEQSLVELS
                     KLQRSRQQQPRDSSSDSQHSKNVMTLLNTKVRNISGAFKDVLEERQQMEINNRDRWGK
                     ISRSKDGDRDDEARSDANLSMYNSSNPFMSSVIAETDEKGTQNGGGELAIPKDSQLLL
                     MEEGQMSSNQYLQERNRAVETIESTIQEVGNLFQQLASMVQEQGEVIQRIDANVDDID
                     MNISGAQRELLKYFDRVKSNRWLAVKIFFIIFVFFVIWVLVN"
     gene            complement(<650446..>651156)
                     /locus_tag="HG536_0A03530"
                     /db_xref="GeneID:59323632"
     mRNA            complement(<650446..>651156)
                     /locus_tag="HG536_0A03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281315.1"
                     /db_xref="GeneID:59323632"
     CDS             complement(650446..651156)
                     /locus_tag="HG536_0A03530"
                     /inference="similar to AA sequence:RefSeq:NP_013125.1"
                     /note="ancestral locus Anc_2.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137210.1"
                     /db_xref="GeneID:59323632"
                     /translation="MLSYFFGGSSGGGKNKDLPKLAIVELREQINLLTKKQSHLQTQI
                     LKQENDARAFLAKNNKNLAKNSLKKKKIYEGQLVKLEGQMETLEQQLFSIESANLNLE
                     TMRAMKQGAKAMKSMHNGLDLDKVDETMEEIREQVELGEEISDAISRPMYTGANEVDE
                     EELDEELDMLAQEAALSEARQTSGAQSVSLPSAPREKIQSSEKQEPRRTEPVQEQEEE
                     EEDEDERALRELQAEMGL"
     gene            <651363..>651839
                     /locus_tag="HG536_0A03540"
                     /db_xref="GeneID:59323633"
     mRNA            <651363..>651839
                     /locus_tag="HG536_0A03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281316.1"
                     /db_xref="GeneID:59323633"
     CDS             651363..651839
                     /locus_tag="HG536_0A03540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137211.1"
                     /db_xref="GeneID:59323633"
                     /translation="MGSPSDTTHVVPTHQRITSSKQWVLDHRREPTGRHAGGGSRAAG
                     TPAAPAADRETKRRLKELETARLQLEYDSVKQENDKLKKVIVRLKQEIQVYSGLLASE
                     QPQRQQPLDELLISKSKRRKKSLEPGPGQDPEAAVTSDDILLMNTLTDVLAQMQQP"
     gene            <651944..>652543
                     /locus_tag="HG536_0A03550"
                     /db_xref="GeneID:59323634"
     mRNA            <651944..>652543
                     /locus_tag="HG536_0A03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281317.1"
                     /db_xref="GeneID:59323634"
     CDS             651944..652543
                     /locus_tag="HG536_0A03550"
                     /inference="similar to AA sequence:RefSeq:NP_012781.1"
                     /note="ancestral locus Anc_2.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137212.1"
                     /db_xref="GeneID:59323634"
                     /translation="MERNSYDQHGVWSQECQRRMFLCQLGLSGSTRGAVRSGLVFSRA
                     SRAVLSRRFNSQTVKTSFQKEQEILVAQRRNRPVSPHLTIYQPQLTWYLSSLHRITGV
                     LLGSAFFAVTMAFGVSTLFGLGLNTEKLQEYYREKVPRWADWTIKGSAAYMFAFHFGN
                     GIRHLLWDTGKELTIKGVNRTGIAVLVFAAFAGTSFLFW"
     gene            <652592..>654169
                     /locus_tag="HG536_0A03560"
                     /db_xref="GeneID:59323635"
     mRNA            <652592..>654169
                     /locus_tag="HG536_0A03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281318.1"
                     /db_xref="GeneID:59323635"
     CDS             652592..654169
                     /locus_tag="HG536_0A03560"
                     /inference="similar to AA sequence:RefSeq:NP_012782.1"
                     /note="ancestral locus Anc_2.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137213.1"
                     /db_xref="GeneID:59323635"
                     /translation="MLGNAYIRATKMGPLEGDIAGEGGEVAMGFRGRFSITDSVIIVL
                     VYVETVLALSLRLVPQPVKSFFTWLINFAEGSDEHSIEQKLRRAATIHEMCRLFDISV
                     EDHLVRTEDNYILTLHRIKPKTGRFNGKVVYLHHGLLMCSDVWVCNIEKHKNLPMVLH
                     ELGFDVWMGNNRGNKYSTAHLHRLPNQRKFWDFSIDEFAFFDIPNSIQFVLDRTQVEQ
                     LVCIGFSQGSAQMFAAFSLSEELNMKVSQFIAISPAMTPRGLHNRIADTLVKSSPRFM
                     YLFFGDRIVLPTAVLWQRTLHPKLFNLLVDFGNRFLFNWRALNITARQKLASYSKLYS
                     TTSVKSIVHWFQILQSQKFQMFEESDDIINSLYRPYQIATFPTKTNIKIPILLIYGGV
                     DSLVDIEAMKDLLPAKTVFDIEVDNHEHLDLLWGHDVDSLVISRVIKFIRFFDEPFEL
                     PLIDNNQGVGHFSLVPKGLTSSLTMNGDETTQFKEHASDGESVYMDSSDHLEELRQHK
                     RERRILSDLFYDDLHSS"
     gene            <654432..>655934
                     /locus_tag="HG536_0A03570"
                     /db_xref="GeneID:59323636"
     mRNA            <654432..>655934
                     /locus_tag="HG536_0A03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281319.1"
                     /db_xref="GeneID:59323636"
     CDS             654432..655934
                     /locus_tag="HG536_0A03570"
                     /inference="similar to AA sequence:RefSeq:NP_012783.1"
                     /note="ancestral locus Anc_2.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137214.1"
                     /db_xref="GeneID:59323636"
                     /translation="MPYNNSMWLNSMQRNERSSFTNRKLLIDRPSFKRRVGNPPPSRP
                     APKRLRADNRPITPLPPHPASNASTHNGFNSRYNAARQTSRYEGSRYNNPNPKTAYKN
                     EPRSQVWTTNHNDSAHTTENGRKDKFLSQLPKGPKVSMSRYNDGKSAISMRQKVEQSR
                     IPPPSLITETRESSVYDRIIQVGEGTYGKVFKARNTVTGRMVALKRLRLEGEREGFPI
                     TSIREIKLLQSFDHPNVSTLTEIMVESQKTVYMIFDYADNDLSGLLMNKQIVINAAQC
                     KHIFEQLLRGMDYLHNSGILHRDIKGSNILIDNKGHLRITDFGLARKIKADNDYTNRV
                     ITLWYRPPELLLGTTNYGPEVDMWGCGCVLVELFNKSAIFQGQNELEQLDAIFKIMGT
                     PNTDRWPNLFDMPWFFMVMPQQTNKFPNVFQEKFSSIIPSQACIRLSEGLLSYDQGKR
                     LTAAQALQSDYFKELPKPEPLILEGHEGCHEYEVKLARKQKRAKLQKEQT"
     gene            complement(<656045..>656314)
                     /locus_tag="HG536_0A03580"
                     /db_xref="GeneID:59323637"
     mRNA            complement(<656045..>656314)
                     /locus_tag="HG536_0A03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281320.1"
                     /db_xref="GeneID:59323637"
     CDS             complement(656045..656314)
                     /locus_tag="HG536_0A03580"
                     /inference="similar to AA sequence:RefSeq:NP_690844.1"
                     /note="ancestral locus Anc_2.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137215.1"
                     /db_xref="GeneID:59323637"
                     /translation="MNLINMGSHHEQSNHLPSMSNPNKERQYAHMAHQLQLLQSNLVK
                     TTEQLDIMSQQCNKNLVGQLGKVHATWFIGSNRYFEEEMLGKQKK"
     gene            <656298..>657029
                     /locus_tag="HG536_0A03590"
                     /db_xref="GeneID:59323638"
     mRNA            <656298..>657029
                     /locus_tag="HG536_0A03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281321.1"
                     /db_xref="GeneID:59323638"
     CDS             656298..657029
                     /locus_tag="HG536_0A03590"
                     /inference="similar to AA sequence:RefSeq:NP_013835.1"
                     /note="ancestral locus Anc_2.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137216.1"
                     /db_xref="GeneID:59323638"
                     /translation="MLIKFIAYNTKDGYHRSNKTSQQPRRPKLESMSNNNLLENPADL
                     LRQVRENFIIEQDVESLAAIDEKASQIKAKSQEELRRSKMEISNLELQLKSKETRIGV
                     LVNELAQVKDESQDLMGKNDLLSFVKQLDELEQSVVQLRSELDERIVTLVKGQRSSTT
                     ASEQPSGELIDDEERKDILRDTVARANILKLKLYRSLGLVIDDANGQVFIEKDNSEID
                     TLPLDNDLSDFFRTKYIWDRIKANR"
     gene            complement(<657110..>657505)
                     /locus_tag="HG536_0A03600"
                     /db_xref="GeneID:59323639"
     mRNA            complement(<657110..>657505)
                     /locus_tag="HG536_0A03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281322.1"
                     /db_xref="GeneID:59323639"
     CDS             complement(657110..657505)
                     /locus_tag="HG536_0A03600"
                     /inference="similar to AA sequence:RefSeq:NP_012784.1"
                     /note="ancestral locus Anc_2.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137217.1"
                     /db_xref="GeneID:59323639"
                     /translation="MFGPFKASNSLLGGLLWKVPWRMSSHQKQRVRHRLRDVDEVLKQ
                     VNLGLHVQRSQEKGVAYQDALAMTKKFKPRIKSLRLLNKSSFFPKENQMSSKDKYTVF
                     DRKSKDYRKGVHKVPKWTKLSLRRNPKFF"
     gene            <657680..>658003
                     /locus_tag="HG536_0A03610"
                     /db_xref="GeneID:59323640"
     mRNA            <657680..>658003
                     /locus_tag="HG536_0A03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281323.1"
                     /db_xref="GeneID:59323640"
     CDS             657680..658003
                     /locus_tag="HG536_0A03610"
                     /inference="similar to AA sequence:RefSeq:NP_012785.2"
                     /note="ancestral locus Anc_2.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137218.1"
                     /db_xref="GeneID:59323640"
                     /translation="MSEGQQPAKRGARLPIWVLSPREEKEARQNLKKFAYNECDEYVQ
                     AMANCAKANGIKVFPACDAQRDKMVECMLFYQVDAKYLDEQRDLIIQRKIAALEEQVR
                     KNRDK"
     gene            complement(<658180..>660282)
                     /locus_tag="HG536_0A03620"
                     /db_xref="GeneID:59323641"
     mRNA            complement(<658180..>660282)
                     /locus_tag="HG536_0A03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281324.1"
                     /db_xref="GeneID:59323641"
     CDS             complement(658180..660282)
                     /locus_tag="HG536_0A03620"
                     /inference="similar to AA sequence:RefSeq:NP_012787.1"
                     /note="ancestral locus Anc_2.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137219.1"
                     /db_xref="GeneID:59323641"
                     /translation="MPPLDKKIKKFLKNSIRVAPKISNKGELAELRAGLVSQYPQTRK
                     DAIKKTIQQMTLGKDVSSLFPDVLKNMATNDVEQKKLVYLYVMNYAETHPELCILAVN
                     TFVTDAQDPNPLIRCMSIRTMSMIRVDKILDYVESPLRRTLQDDNPYVRKTAVICVAK
                     LFQLDRELCIELGVLEDLKASLDDSNPMVVANATAALTEINTMDPSAIDLTELINSHV
                     SQFLLALNECTEWARITILDALAGYDSKDSLEAQDIIDRVSAHLQHVNPAVVLATIQV
                     VIKNYPRTQQQQTNKAIMNRLSSALVSIMSTPPEMQYIALRNIRIILEKYPELLTKEL
                     RIFYVKFNDPLYVKLEKIDILVRLVDPTNLKQCNLLLAELKEYSMEFEPEFVSRAIQG
                     LAQLGIKYSDQKFVLKTLDILLELLERHENLKDDCCVAICDLLRHSCGDKEMVENVCS
                     VLSSWESPESAMTSDSAKCNYVWLMGQYPDQFTNLQSKFEGFVQEFAQEEQLTQVSIL
                     MTAVRLHTRLPGAILQSVLELATTSIHELDVRDMAMIYWRCLSLPDSEKLIQELCSSV
                     APQIQSTLDSFSPELLEKLLTELSTIGSILFKPQSERTSNYVQRQRVVKGKKLHELED
                     MAKNEIANNFNDDVLLDFGGEESTGRVSGSKETLDDLDDLFNFSSDTVSEGLKSLSVR
                     SQPAPKQTPNTQDLLDIF"
     gene            <661078..>661713
                     /locus_tag="HG536_0A03630"
                     /db_xref="GeneID:59323642"
     mRNA            <661078..>661713
                     /locus_tag="HG536_0A03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281325.1"
                     /db_xref="GeneID:59323642"
     CDS             661078..661713
                     /locus_tag="HG536_0A03630"
                     /inference="similar to AA sequence:RefSeq:NP_013834.1"
                     /note="ancestral locus Anc_2.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137220.1"
                     /db_xref="GeneID:59323642"
                     /translation="MSNAEVLVLRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLIS
                     WKLTGDDQQYGVPVRSFKGHSHIVQDCALTADGAYALSASWDKTLRLWDVATGETYQR
                     FVGHKSDVMSVAIDRKASMIISGSRDKTVKVWTIKGQCLATMLGHNDWVSQVRIVPTE
                     DVNDDTVTVISAGMDKMVKVCLSFIFLLCKMVRCLPFQMMYSRYLLLRTGL"
     gene            complement(<662454..>664811)
                     /locus_tag="HG536_0A03640"
                     /db_xref="GeneID:59323643"
     mRNA            complement(<662454..>664811)
                     /locus_tag="HG536_0A03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281326.1"
                     /db_xref="GeneID:59323643"
     CDS             complement(662454..664811)
                     /locus_tag="HG536_0A03640"
                     /inference="similar to AA sequence:RefSeq:NP_012788.2"
                     /note="ancestral locus Anc_2.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137221.1"
                     /db_xref="GeneID:59323643"
                     /translation="MLKTTFLNRNLTARVLSFTNIRGVKRYATEATQFSTAKASEDLN
                     VGNLRRAFNDVDYWHEINKRNFSVSEDDSPFSNFGIEAKLQTGLFRNPFLTSADGLRK
                     FSHHSLSQAQELLNDMKSDKSLEELITYIMKLDRLSDTLCRVIDLCEFIRSSHPDNAF
                     VEAAQACHEEMFEFMNTLNTDVELCDTLRQVLNDSRITDRLSEEEIKVGRILLEDFEK
                     SGIYMNPEVRDQFIAFSQEISLVGQDFINNTNYVRSNFIKIKCEDLENSGISKLILNQ
                     LSKDVRGKHFKIPTHGYLAYSILRNCPDEEVRMKVWSAMHSCSDEQIRRLDQLVRLRA
                     ALAKLMGCDSFAEYQLKGKMAKTPHQVRGFMTALLSYMLPKTIQELKYIFDLKCKYQQ
                     IPSSENPSDAEIAQVVRPWDRDFYSSIHSVQQRRATSDSEQISSYFTLGNVIQGLSDL
                     FDSIYGIRLEIEVTKTGETFSPEVRRLNVVSEQEGIIGVIYCDLLERSGKTSNPSHFT
                     VCCSREIYPGETDFSTIQTGVNSQGIQFQLPVICLVCNFSTSTNPSGKPICLLHLNEV
                     ETLFHEMGHAMHSMLGRTRLQNISGTRCATDFVELPSILMEHFARDARVLKRIGKHHI
                     TGQPIPESLLENYLQEIKFMQHCETFSQAKMAMLDQELHSQRVIEEFERLDVVAIYQQ
                     LERKLQVLVDDKSNWCGKFGHLFGYGATYYSYLFDRAIASKIWDSLFAHDPFSRSSGK
                     KFRDQVLKWGGSKDPWKCIADVLDKPELAEGGTEAMKFIGQSEDL"
     gene            complement(<665192..>666625)
                     /locus_tag="HG536_0A03650"
                     /db_xref="GeneID:59323644"
     mRNA            complement(<665192..>666625)
                     /locus_tag="HG536_0A03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281327.1"
                     /db_xref="GeneID:59323644"
     CDS             complement(665192..666625)
                     /locus_tag="HG536_0A03650"
                     /inference="similar to AA sequence:RefSeq:NP_012789.2"
                     /note="ancestral locus Anc_2.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137222.1"
                     /db_xref="GeneID:59323644"
                     /translation="MIRVSRKLLLSNCSLTRLRGIQARGLRCSAAMRNARNGGNIYTY
                     QQISQRNDRIQKIVLSLLGFSAFSYGVWHFYWPHHTFPKPVAQILRKGLWAESDKEQF
                     DYQKALKFYIEALDKCQELKVDPISDEYTGIELKVAEMYEKLGMLDEASGVYLELLYR
                     YFDALNTEGKIPEDKRPELIRRDLRILIKSLETNKDVSTGKRNLLAHLLMAQEEVLSR
                     SQELKQFFERRKEKAKIIFQGKALDASDFKTFVNEENLKLDDEGYMILDLQKDSSAWE
                     PFKEEFFTARDLYTAFCLSSKDIAAALSCKMTTVEWMVMADMPPGQILLSQANLGSLL
                     YLQGEKFEAEIFELEGKRDKDPSLRSDEPMIKALRHLHRNRDTCLQMATQCYDSVIQF
                     AKKNNKLRFNMKDQLDPSVSQAIALSTYGMGVLNLHQGVLAKAEKLLKDSISMAKEID
                     FQELLNEARNELDKAETLRLETGKQER"
     gene            <666863..>668914
                     /locus_tag="HG536_0A03660"
                     /db_xref="GeneID:59323645"
     mRNA            <666863..>668914
                     /locus_tag="HG536_0A03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281328.1"
                     /db_xref="GeneID:59323645"
     CDS             666863..668914
                     /locus_tag="HG536_0A03660"
                     /inference="similar to AA sequence:RefSeq:NP_013832.1"
                     /note="ancestral locus Anc_2.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137223.1"
                     /db_xref="GeneID:59323645"
                     /translation="MCGRYAIAYSSEELPSHFQSQHLPVTPQLAKGEHHDRSYNVAPT
                     SDGAVYRAKDHELRYMKWGLIPHWTKSVKDFKTYKTFNARVENLLESRMWAQCCKNKR
                     CVIPLNGYYEWVTKGKKKIPYYVVRSDGKLAFVAGLYDYLESEDLWTYAVITAKAPKE
                     LTWLHTRMPVLLEPGSEAWETWMNPDKTDWTQEELDELLAANYDDKMLSVYQVSEEVN
                     KVGSSSESMVKPIFKEDSGKFNLERFPEEEEHGGAAEGEPETKRFKAEAKEPESGKGL
                     SGKIGGGYDVKKERRGRMVGPDQEEDLEIPETAVAGENAEEIEEAFVRDEEDVDLEEE
                     YLKQSEDEEVEEGDLENVAGEDDEEYVEGGDDNEAGSDYEVVQEGEKEEDRAAGESIG
                     ERVKNEDTARAEEGNLSKADVRKEQRSRKNKTSATAKGDTGESSSKWGSMTASEAGRK
                     GGTRSSRRGNTRGAQEEEEGEEEDTSGRRGRGNFGKGDTGEQSSRWGSMTASEAGRKG
                     GRKSSRSGNTGGAEGEEGEEEASGRKGSGNYGKGDTGEHSARWGSMTASEAGRKGGRK
                     SSRSGNTGGAEGEEGEEEASGRKGSGNYGKGDTGEHSARWGSMTASEAGKKGGRKSSR
                     SGNTGGAGEEEEGEGEETSGHKGRGNFGKGDTGEHSARWGSMTASEAGKKGGRTRKQH
                     T"
     gene            complement(<668973..>670262)
                     /locus_tag="HG536_0A03670"
                     /db_xref="GeneID:59323646"
     mRNA            complement(<668973..>670262)
                     /locus_tag="HG536_0A03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281329.1"
                     /db_xref="GeneID:59323646"
     CDS             complement(668973..670262)
                     /locus_tag="HG536_0A03670"
                     /inference="similar to AA sequence:RefSeq:NP_012790.1"
                     /note="ancestral locus Anc_2.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137224.1"
                     /db_xref="GeneID:59323646"
                     /translation="MLQKNNSMNINLGLSRVSKLLNYLGNPHERLTVLHVAGTNGKGS
                     VCSYLSSILQDSSNQVGKFTTPHLIEVTDSITINSKPISWSVYRNIRNNLETINNRHQ
                     LNCTEFELLTCTAFQYFRNVNCQWCVIEVGLGGRLDATNIIPGHRKVACGITKISLDH
                     EAFLGNSLVKIAQEKAGIITKGVKYAIVDGSNEQTVIQTVEDKCREMDCQLTITDPDC
                     GTTHIDTKSWGRLVFEKMPLNGHYQICNLRVALAIIDGIQQRKMANISIDAIIKRLQN
                     VEWPGRLQNLNFCYDPIQKSTIPVLLDGAHNGSAAIELAKFLRNQFGDQPLTFIVSVT
                     SGKDLQPLFGSLLRPHDRVIVTEYGRVDGMPWISPMAASELSLHIKENYTPKVEVQND
                     VVSCIMRGQQIRAPIVICGSLYLCGDVLRLHQENLGQ"
     gene            <670365..>670715
                     /locus_tag="HG536_0A03680"
                     /db_xref="GeneID:59323647"
     mRNA            <670365..>670715
                     /locus_tag="HG536_0A03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281330.1"
                     /db_xref="GeneID:59323647"
     CDS             670365..670715
                     /locus_tag="HG536_0A03680"
                     /inference="similar to AA sequence:RefSeq:NP_013830.1"
                     /note="ancestral locus Anc_2.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137225.1"
                     /db_xref="GeneID:59323647"
                     /translation="MQPEYVQSRLNSLAEVDNKVCGLLKIASQIVFTFSELKKGNSDL
                     KPQFEQHVKDFYTDLESATAQLRQEIRLLDENVGSRLLPINVNKKATGQDDDKMAEQI
                     AILRELLHEKQSYN"
     gene            complement(<671021..>671770)
                     /locus_tag="HG536_0A03690"
                     /db_xref="GeneID:59323648"
     mRNA            complement(<671021..>671770)
                     /locus_tag="HG536_0A03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281331.1"
                     /db_xref="GeneID:59323648"
     CDS             complement(671021..671770)
                     /locus_tag="HG536_0A03690"
                     /inference="similar to AA sequence:RefSeq:NP_012792.1"
                     /note="ancestral locus Anc_2.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137226.1"
                     /db_xref="GeneID:59323648"
                     /translation="MEFIPVIPLSDPVAAIVLCRQDISRMFTRYMSNYVHFLNKFIGH
                     MRRVGSLRFERMTLIKFVKKLRFLHESLTNFEVGSGIIHPEDADLKTANVPLASFCLK
                     CLELLDVLNFYLTQPLQKEIISKTLNSNLTLSEDCIAGIEDTYNHFVKYTQWTIEALG
                     IDDPLLHIEVVQFARKCALEDNVNVEESSDIFLQEVETVEDAEEYGNLSMEWTNVLGS
                     KLDTLQVYYDDVMMHWQDGFDRKKDTKTSRT"
     gene            <672120..>673712
                     /locus_tag="HG536_0A03700"
                     /db_xref="GeneID:59323649"
     mRNA            <672120..>673712
                     /locus_tag="HG536_0A03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281332.1"
                     /db_xref="GeneID:59323649"
     CDS             672120..673712
                     /locus_tag="HG536_0A03700"
                     /inference="similar to AA sequence:RefSeq:NP_013828.1"
                     /note="ancestral locus Anc_2.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137227.1"
                     /db_xref="GeneID:59323649"
                     /translation="MTDEVTMEMEYSKNTPMEEIDSEIRLCNSYFYDKQLQISKERSP
                     RKADLKQRSIHLKKLFHGIRDNTDALIEAMYSDFHRSKQESLTLEIIQVLNCILSIIE
                     KLPKWIEPKKVSDYSAPYLFGKIVVESIARGSVLVIGPFNFPLLCSLIPTVYAIAGGN
                     SVILKPSEMTPATAMCIEKCVRDAGLPDGLLQIVKGAKAETERLVQSGKFDMIFFTGS
                     NRVGSIIAQEAAKTVTPCVLELGGKSPVFMTNNLRRKNIKTALKRIFFSTFGNSGQIC
                     VAPDYVLVHESIYDQVVEQAKEVLKEFFPEITPEAEYTHMINKKAFDSVSSRIASSKG
                     DKFVVGNQSSDAESLMIPPTLVFDVEWDDSLMEKENFGPVLPFIRYSDLDRTLDDVIQ
                     KQDTPLVQYIFSQKEQEVQRILTRLRSGGCIVGDTLIHVGINDAPFGGIGRSGYGNSG
                     GIWGFNTFTHQRTVLKQPYWMDAALAIRYPPFTSWKSKAFRLAVEKSPWFDRNGNDRF
                     GCFKWFALGLAILVFAIALSKC"
     gene            complement(<673875..>677582)
                     /locus_tag="HG536_0A03710"
                     /db_xref="GeneID:59323650"
     mRNA            complement(<673875..>677582)
                     /locus_tag="HG536_0A03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281333.1"
                     /db_xref="GeneID:59323650"
     CDS             complement(673875..677582)
                     /locus_tag="HG536_0A03710"
                     /inference="similar to AA sequence:RefSeq:NP_012793.2"
                     /note="ancestral locus Anc_2.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137228.1"
                     /db_xref="GeneID:59323650"
                     /translation="MAIIKRGGRTKAAAAPAKRSAKIKKATYDSSKKKEVGVSDLTLL
                     STISDQAINENLKKRFFNGSIYTYIGHVLISVNPFRDLGIYTDAILESYKGKNRLEVP
                     PHVFAIAESMYYNMKAYNENQCVIISGESGAGKTEAAKRIMQYIAAASSAHSESIGKI
                     KDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIRFNAQFEPCAGNITNYLLEKQRVV
                     GQIRNERNFHIFYQFTKGASENYRQMFGVQKPEQYIYTSASGCTSVDTIDDLKDYQET
                     LKAMQIIGLSQEEQDQIFRLLAAILWIGNITFIENEEGNAQVRDTSVTDFVAYLLQVD
                     SELLIKSLVERILETNHGMRRGSVYHVPLNQVQATAVKDALAKAIYNNLFEWIVERVN
                     ISLQAFPGADRSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQDTYE
                     REQIKWTPIKYFDNKIVCDLIEAKRPPGIFAAMNDSVATAHADSNAADQAFSQRLNLF
                     SSNPHFELRSNKFIIKHYAGDVTYDVNGITDKNKDQLQKDLVELIGTSTNTFLSTIFP
                     DTVDPNSKRRPPTAGDKIIKSANELVETLSKAQPSYIRTIKPNQTKSPNDYDDAQVLH
                     QVKYLGLQENVRIRRAGFAYRQVFDKFVERFYLLSPRCSYAGDYTWQGDTLDAVKMIL
                     VDSSIPDKEYQLGVTQVFIKTPETLFALEHMRDRYWYNMAARIQRAWRRFIQRRIDAA
                     TRIQRAIKEKKGGNKFEQLRDYGTTLLAGRKERRSMSLLGYRAFMGDYLSCNEAKSKG
                     SFIRKQAGITEKVVFSIHGEALHTKFGRSAQRLKKTFILTSSHFYIIGQVMTQNTLSY
                     NAEYNIDVRNISSVSLTNLQDDWMGINLMNSAQPDPLINTYSKTELMTHLKRLNNKIQ
                     IKIGPNIEYQKKPRKLHSVKGQVSDTAPKRGDLYKSSTILVQRGHPASSESHAKPRKG
                     TNNTPVKSFSKKPSNMGNRPAPSTAQRKAPAPVPRTTKKPAPPPPATKQQPTGNSLAA
                     TAAQAAYHPNGVMKQSKPVAPKPTVNQKPAAPKAEEQNHKAEIASVNATAVKHVPPPP
                     PPPPPAAKQEVPMFQAAYDFPGSGAPSELPLKKGDVVYITRHEPSGWSLGKTLDGAKE
                     GWVPTAYMTEFHGTSNAIQAPKAINSTATTASATPANAMQNTQIDTTASQPANFSDGL
                     ASALAARANKMRVESDEDETAKTDDEDDDDW"
     gene            complement(<678402..>680453)
                     /locus_tag="HG536_0A03720"
                     /db_xref="GeneID:59323651"
     mRNA            complement(<678402..>680453)
                     /locus_tag="HG536_0A03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281334.1"
                     /db_xref="GeneID:59323651"
     CDS             complement(678402..680453)
                     /locus_tag="HG536_0A03720"
                     /inference="similar to AA sequence:RefSeq:NP_013826.1"
                     /note="ancestral locus Anc_2.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137229.1"
                     /db_xref="GeneID:59323651"
                     /translation="MIRQATTKQFAARRCLQQIAARPAVYGTFRCYSSASRNYSASVA
                     SAPSSDRRPEPAPCFNVDPAAEQPSKLSQKLRADPHMDSSFIGLTGGQIFHEMMIRHN
                     VDTIFGYPGGAILPVYDAIHDSKAFNFVLPRHEQGAGHMAEGYARASGKPGVVLVTSG
                     PGATNVVTPMADALADGVPMVVFTGQVSTSAIGTDAFQEADVVGISRSCTKWNVMVRS
                     IEELPRRINEAFEISVSGRPGPVLVDLPKDVTAAILKNPIPTKTTLPSTSLAQITKRA
                     LDEATNEKLARAADLLNKAKKPVLYVGAGILNNPDGPRLLKELSERAQIPVTTTLQGL
                     GAFDQEDPKSLDMLGMHGSATANLAMQHADLILAVGARFDDRVTGSISKFAPEARRAA
                     LENRGGIVHFEITPKNISKVVETQVAVQGDAAVNIEKLLPLVFPVKERTEWFASITEW
                     KEKYPYAYQKETPGSKIKPQTVIARLSDLANKSDKEVIVTTGVGQHQMWAAQHWTWKN
                     PRSFITSGGLGTMGYGLPAAIGAQVAKPDALVIDIDGDASFNMTLMELTSAVQANAPV
                     KILLLNNEEQGMVTQWQSLFYEHRYSHTHQLNPDFVKLAEAMGLKGLRLSKQEDMDAT
                     LKEFIETEGPVLLEVIVEPKVPVLPMVPAGKGLDEFINFDPKVEEEQTALRHERTGGQ
                     Y"
     gene            complement(<680901..>681791)
                     /locus_tag="HG536_0A03730"
                     /db_xref="GeneID:59323652"
     mRNA            complement(<680901..>681791)
                     /locus_tag="HG536_0A03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281335.1"
                     /db_xref="GeneID:59323652"
     CDS             complement(680901..681791)
                     /locus_tag="HG536_0A03730"
                     /inference="similar to AA sequence:RefSeq:NP_012794.1"
                     /note="ancestral locus Anc_2.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137230.1"
                     /db_xref="GeneID:59323652"
                     /translation="MPFTALPGYFRAFESADSEGVDSRAVDHLELVAHDSWRDLHSQI
                     PADTDTHHYKLVVLARHGQGYHNAALLRYGLEAWEDHWSFLVGDEYGDWLDSKLTALG
                     KEQVEKTGLQVLAPMVGHIEALPDVFFTSPMRRCLETFIGSWGDIFRRNNEYLKDSTI
                     PVQVVENLRERLGEHTCDKRVPHSEVVGEYQHYATDGGNVINWHYEPGYPEEDELWFE
                     DYRETDAELDERLHTGLSQIFGQLNSDQRFISITCHSGVIQSILRNLSHPPVRNLDTG
                     KVVCVVVKINVNRLKGASHL"
     gene            complement(<681929..>682297)
                     /locus_tag="HG536_0A03740"
                     /db_xref="GeneID:59323653"
     mRNA            complement(<681929..>682297)
                     /locus_tag="HG536_0A03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281336.1"
                     /db_xref="GeneID:59323653"
     CDS             complement(681929..682297)
                     /locus_tag="HG536_0A03740"
                     /inference="similar to AA sequence:RefSeq:NP_013825.1"
                     /note="ancestral locus Anc_2.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137231.1"
                     /db_xref="GeneID:59323653"
                     /translation="MGFWDSFEVYNRKKHAKDVSMLGTNHSNLGQGQGKTGYMYSHEY
                     YGPAKKKAMEESGIISEAGTADMRKSSVSSESSGESSTKLMMGEDQPHMVDISKLTQN
                     EFKRLYEGMRKGEPDNRVNF"
     gene            683103..683175
                     /locus_tag="HG536_0Atrna1K"
                     /db_xref="GeneID:59324254"
     tRNA            683103..683175
                     /locus_tag="HG536_0Atrna1K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59324254"
     gene            <683306..>685195
                     /locus_tag="HG536_0A03750"
                     /db_xref="GeneID:59323654"
     mRNA            <683306..>685195
                     /locus_tag="HG536_0A03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281337.1"
                     /db_xref="GeneID:59323654"
     CDS             683306..685195
                     /locus_tag="HG536_0A03750"
                     /inference="similar to AA sequence:RefSeq:NP_013824.1"
                     /note="ancestral locus Anc_2.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137232.1"
                     /db_xref="GeneID:59323654"
                     /translation="MSAEATTFVVDVSPAMERDGHLSKVIAYLEYTLLDKCKRGRKTD
                     WISCYLANCRYSKNSQSISNVYEAQEFVAPVTSTETLKLLRYLQFYGEETSGPRPSDD
                     GGESADIESVESMVQCLLVSSLDMKEKFKTRKMLRQTVVFTADVDGLDLNEDEIDVLK
                     EEFNSRLILIDCRKKTTTDSKDSDIEDSRWGTLVKAIPGSMVFDINDLLLEIALPKPA
                     VVKPVRIFAGELRLGAEVTAIVPSSDCKGISPADDERCLCIKVEGYPATKRVSTLNRK
                     LVFKDEQNGSKQCEPVKSVIEYEVHDDKADKRFTVAQQSIAKAYRYGSDYVVLPSTLD
                     EQRYYRTSPGIDIRGFLDRTRLPRYMLNSESRFILPDTRSGSTADMATFSALVDTMLE
                     HDKVCIVRYVAKCDSEVEMCMLCPLIMRDEHDEKVRTLILNRLPFAEDERVASFPRLT
                     NRTTTSGKKIEDNQEAENSRIDALISNYIDSLDMDSPVKQDTDLASHYYLPLGQATKD
                     STLPLPGGEEENILLRGSNPFRVPAIHLHRQKQVLLEWIHQKLVIGSDELQMPEMPDV
                     LREKIQPHYNDRRDEAGMAELVKLLNLKQTEKKFIAADEQYDLQDEAAENIPSLESIL
                     ALGER"
     gene            <685815..>687533
                     /locus_tag="HG536_0A03760"
                     /db_xref="GeneID:59323655"
     mRNA            <685815..>687533
                     /locus_tag="HG536_0A03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281338.1"
                     /db_xref="GeneID:59323655"
     CDS             685815..687533
                     /locus_tag="HG536_0A03760"
                     /inference="similar to AA sequence:RefSeq:NP_012795.1"
                     /note="ancestral locus Anc_2.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137233.1"
                     /db_xref="GeneID:59323655"
                     /translation="MSLAVETVVTEPYNDQKPGTSGLRKKTKIFMEKPHYTENFIQSI
                     LDAIPEGCKDATLVVGGDGRYYNDVILQKIAAISAANGVRKLVVGHNGLLSTPAASHI
                     IRTYQDKSLKKVTGGIILTASHNPGGPENDIGIKYNLANGGPAPESVTNAIWEVSKKL
                     TSYKIVKDFPTIDLSTLGEKSYGPLVIDVVDTTKAYVEFLREIFDFDLIKKFVDSQRK
                     TKNWKLLFDGLNGVTGPYGKAIFVDELGLPENEVLQNYHPKPDFGGIHPDPNLTYART
                     LVDRVDKEKIEFGAASDGDGDRNMIYGYGPAFVSPGDSVAIIAEYAKEIPYFAKQGIY
                     GLARSFPTSGAIDRVAAKQGLKCYEVPTGWKFFCALFDAKKLSICGEESFGTGSNHVR
                     EKDGMWAIIAWLNILAIYNKHNPEKEASIKTVQEEFWLKYGRTFFTRYDYEHVSSEKA
                     KDIVKHLEKFVNTPNVVTSKFPTDETLTVEAAGDFQYTDLDGSVSANQGLYVKLSNGA
                     RFVVRLSGTGSSGATIRLYIERYTDDKSKYGQTAEEFLRPVIDSVVEFLKFEEVLGYS
                     EPTVKT"
     gene            <687825..>689960
                     /locus_tag="HG536_0A03770"
                     /db_xref="GeneID:59323656"
     mRNA            <687825..>689960
                     /locus_tag="HG536_0A03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281339.1"
                     /db_xref="GeneID:59323656"
     CDS             687825..689960
                     /locus_tag="HG536_0A03770"
                     /inference="similar to AA sequence:RefSeq:NP_012796.1"
                     /note="ancestral locus Anc_2.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137234.1"
                     /db_xref="GeneID:59323656"
                     /translation="MSYWKFSKFKFGKSKEERQAKEAEKEKKDKDKKEESEKGIDSKL
                     FHFEHGSSDWGDQNLTVNSSDLSRSSIDRKETIVPSPASMAPVRLSHDASSTASTVRD
                     ELTEENEDVSSPRASHSRERVADISTTSETTAAPVATHANNATSTAGMMTIKVYNGEG
                     FRLPFPITSNEQILSKLLSSGITAERTSLALEVDSVASQLSRIQLQKQGSSGENLLPE
                     DQCTNFVPATILLPGSDDLNPLLYFTIEFDNTVATIEPEYGTMAQPVFNKISTFDVTR
                     RLPFLKIDVFVRIPSILLPSKVWQQEVAAHNEGLKTILDQINSNQDIHLDSFHLPVNL
                     KIDSAANIRLFNHHWITLDNGWGKINLSVDYKPTRNKALSIDDFDLLKVIGKGSFGKV
                     MQVRKKDTQKIYALKAIRKAYIVSKSEVTHTLAERTVLARVDCPFIVPLKFSFQSPEK
                     LYLVLAFINGGELFYHLQKEGRFDLSRSRFYTAELLCALETLHNLDVIYRDLKPENIL
                     LDYQGHIALCDFGLCKLNMKDKDKTDTFCGTPEYLAPELLLGQGYSKAVDWWTLGVLL
                     YEMLTGLPPYYDEDVPKMYKKILQEPLRFPDGFDRDAKDLLIGLLSRDPKRRLGYNGA
                     EEIKRHPFFCQLSWKRLLMKGYIPPYKPPVTSAIDTSNFDQEFTREKPIDSLVDEFLS
                     ESVQKQFGGWTYVGSEQLGSSMIQGRSIR"
     gene            <690221..>692130
                     /locus_tag="HG536_0A03780"
                     /db_xref="GeneID:59323657"
     mRNA            join(<690221..690415,690487..>692130)
                     /locus_tag="HG536_0A03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281340.1"
                     /db_xref="GeneID:59323657"
     CDS             join(690221..690415,690487..692130)
                     /locus_tag="HG536_0A03780"
                     /inference="similar to AA sequence:RefSeq:NP_012797.1"
                     /note="ancestral locus Anc_2.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137235.1"
                     /db_xref="GeneID:59323657"
                     /translation="MMAFENSGKRPAQDVVVSAMESKKRKVEFSDKITMHTGDDDHDD
                     ANISTEMYKRFVKSALDELEKNSNTQVGLIASQVALPRKSEDHVSLANLDVLLDVLSD
                     NISRIETSRASPLIQSIVHLEKWWELPSQTLGKYIFFIRVLCSSIPKWWQDVSMVLIS
                     GFHLPLEMTVSHHDMLRYFLKMIPSSMGFIDIYMPKFFPSNNDSCKNLVNYVANLLKF
                     TSYCKELQFQAWSLIIERVISLDVELQNELDELDDDIEDEDLDLADDEEAGDDEEDDE
                     EAVDVETRDDDKEDDVGEDGEIEGEEEYNVQATQNIKDFSKKLDAILTMVTECLREKV
                     TPESLKSGEGVSVFNTITTLFKTHVLPTYFTRSVQYIMFHISQHQIELMDSFLVTLID
                     ISFSPTETAETRIKSLQYLGSFIARAKKLSRTQIIFVASYLASWLNRYVLEREEEVDQ
                     PGGMDRFKHFYGAFQALCYIFCFRHTLFRDADGNWECELDKFFQRMVISKFNPLKYCN
                     ENVMLMFARISQHEDLAYCFSIIENNNNQRLRGIIGRGDKEQKGSVYSSAASTWSLAT
                     RQQFIDLQSYFPYDPLILERSKEIMKEFYIEWSEVSGEYESDGLED"
     gene            <692247..>694046
                     /locus_tag="HG536_0A03790"
                     /db_xref="GeneID:59323658"
     mRNA            <692247..>694046
                     /locus_tag="HG536_0A03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281341.1"
                     /db_xref="GeneID:59323658"
     CDS             692247..694046
                     /locus_tag="HG536_0A03790"
                     /inference="similar to AA sequence:RefSeq:NP_012798.1"
                     /note="ancestral locus Anc_2.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137236.1"
                     /db_xref="GeneID:59323658"
                     /translation="MGSRSPSLQRIRNAGSLRACKYLWLFLMAIEFHSDDVQMIFAGD
                     IAKKLEDSYPVPPNVDDSGTISLAFLISLSVTFALLMVVLVIIAIYVTFCGADEAEYD
                     EETGGTSGAAGPFHSLFSKKRNAILLDSSFTSAGQFDDDALLQEQEATELPKMSPFEL
                     DLYNRAKEFQKVNPPNVKEFGTFTNESDLQFIRDRGIQSYSFLPSINDNTDVEGNFLP
                     SFLIQDKLDITFTKYNKSSSAIMNYPLPFNRKDAVYFEVKVFRHPSDSNAIFSIGLMT
                     FPYPYFRIPGMSLFSIAYESTGKLRINNPFMASTLLPKLQEGDVVGFGYRFRTGTIFI
                     THNGKRLIDVTQNVGIDLFVGIGSLNAAFTRTYTRDGLLEDPDNIEMREGLSEGREVE
                     LPPDLQRVHDVAAPDAPESDEVELHVNLGQVGFVFIEANVKKYGFGSVYGEIGIPPSY
                     NGNETKTDTILQKGADIPPEYSDTTGPDEFFGNIHINSGGSATASSSNLLAPRTGRLL
                     SAIPEIAESDLERYERNSSAYDQEYNHSLMTNENVGLSRLSSVESAESDNKAGQTSAR
                     HNERTPLINRQPLNRDDDKHKRKRRKRKKRSKK"
     gene            complement(<694122..>694676)
                     /locus_tag="HG536_0A03800"
                     /db_xref="GeneID:59323659"
     mRNA            complement(<694122..>694676)
                     /locus_tag="HG536_0A03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281342.1"
                     /db_xref="GeneID:59323659"
     CDS             complement(694122..694676)
                     /locus_tag="HG536_0A03800"
                     /inference="similar to AA sequence:RefSeq:NP_012800.1"
                     /note="ancestral locus Anc_2.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137237.1"
                     /db_xref="GeneID:59323659"
                     /translation="MAVHFVSYTARTHNRSAHNRRLSWLCWILESMSVKPIDTFITNS
                     VQLFEVNPSQTILSISYKWKPQSSKKKPVVSFKTHNAHLSSCYKFKTNKSKDVSRLLS
                     ALGPRGVTITRGKIEKRVCKPASRENGKKSKKEAKSRDVVGLSTLIVNTEVKEHVPVV
                     EQKEQSLESSKKKNKNKNKGKKRR"
     gene            <694961..>697492
                     /locus_tag="HG536_0A03810"
                     /db_xref="GeneID:59323660"
     mRNA            <694961..>697492
                     /locus_tag="HG536_0A03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281343.1"
                     /db_xref="GeneID:59323660"
     CDS             694961..697492
                     /locus_tag="HG536_0A03810"
                     /inference="similar to AA sequence:RefSeq:NP_012801.1"
                     /note="ancestral locus Anc_2.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137238.1"
                     /db_xref="GeneID:59323660"
                     /translation="MNRTKSGTKDEGNGVKLKRSGSKRRSGEKNRSSGGESVRSGTLN
                     GSTVASVASHDDEHSISSTNKEFSADIQPVTFDVKLTPEESESREIGRQHADTLSKVR
                     EKLSKGSGRNYSSTLPNFLRSIDRRQYEKYLKEPHHIKLVKRSRQLKQFRRLFLAQEL
                     HAYELSEGKETAKRKVSLLKQDSSQNAIWVTKFSLGGRFMATGGKDGTLCLWKVIGSP
                     AERWELDASQESRNAFKAKSRLIKQQILGGTPGGSIKDEAKASPGVTKANPTNLYAPV
                     FHPNPHKKFKEHTADILDMDWSKNNFLATSSMDKSVRLWHPDRSTSLKAFHHPDFVTC
                     VLFHPSDDRFLITGCLDHKCRLWSILEGEVVFEFDCQDLVTSMTISGSEGEYTIVGTF
                     NGYVIVLATRGLDFVSSFHVVDKTTQVEEAGTRLLSSGSKTHHGPRLTCLQCYKDPAD
                     DSLRLVVTSNDSRIRVFNLKTKKCLEVLRGFESGTSQHKAQLTFLEGNEPVLVCGSDD
                     HWAYSWKLQSANSSSIAKEGAKQTKIGGLRDFLSHPLHHNGDHSKNRQHQHGSLHLKT
                     LLPHSHGSSSDQPIKNSDFICFHAHHNPVTTAILAPPETSKTLSLSNDLICDISLEFF
                     RQSDTLAFLGSKKDESSDSDQSSIEHNDVDGSSSVTTGSGDNDGRTSPSTVAAIGSIM
                     VTTDTEGLIRVFRADMPKNIRERVLERLNDLGRENNNSGDVLTTYGSADRLAVAKKHP
                     SSLLGLSKLAAAAVQCPDEILGASRLKPNSVLRNPLFNYSSGSLNSTRTRGSGSSNGK
                     NGSMPGLRCDVCNGTNFNVLSNSPSITGEAGYSCADCGNILNNFR"
     gene            <697803..>698774
                     /locus_tag="HG536_0A03820"
                     /db_xref="GeneID:59323661"
     mRNA            <697803..>698774
                     /locus_tag="HG536_0A03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281344.1"
                     /db_xref="GeneID:59323661"
     CDS             697803..698774
                     /locus_tag="HG536_0A03820"
                     /inference="similar to AA sequence:RefSeq:NP_012802.1"
                     /note="ancestral locus Anc_2.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137239.1"
                     /db_xref="GeneID:59323661"
                     /translation="MAESKGNGGKVIEKSAAQKVTKFGSFVAGGLAACIAVTVTNPIE
                     LVKIRMQLQGELSSSVQRIYKNPLQGMAVIFKNEGIRGLQKGLVAAYIYQICLNGSRL
                     GFYEPMRGFLNKTFYPEEEPHKVQNATINVVSGAASGIIGAVLGSPLFLVKTRLQSYS
                     EFIKIGEQTHYTGVWNGLRTIYAKEGFKGLYRGVDAAILRTGAGSSVQLPIYNTAKHF
                     LLNNDLMKDGTALHLTASTISGIGVAVVMNPWDVILTRIYNQKGNLYKGPLDCFIKTV
                     RIEGVSALYKGFEAQVFRIAPHTIICLTFMEQTMKLVYNIEKRVLGH"
     gene            <699083..>700123
                     /locus_tag="HG536_0A03830"
                     /db_xref="GeneID:59323662"
     mRNA            <699083..>700123
                     /locus_tag="HG536_0A03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281345.1"
                     /db_xref="GeneID:59323662"
     CDS             699083..700123
                     /locus_tag="HG536_0A03830"
                     /inference="similar to AA sequence:RefSeq:NP_013819.1"
                     /note="ancestral locus Anc_2.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137240.1"
                     /db_xref="GeneID:59323662"
                     /translation="MRLPNYVRFRLTGPSKELARSSRVNAYFKRIKDKVMPILIWLAS
                     FRVVAWLHESLQNILIGVIRVGPVPRHVSFIMDGNRRYAKKCDMPIKKGHEAGGVALL
                     NLCYACKRIGIKCVSAYAFSIENFNRPKEEVETLTNMFSAKLDEFCDRANTLSDPLYG
                     SRLRIVGDHSLVSADMREKIKRVERLTDNGDDFTLYICFPYTSRNDIYHTVCGSIEKS
                     LADRAYASSLTVAGFTRSMYLEEFSNNCDLLIRTSGHMRLSDYMLWQSHENSEILFTS
                     TLWPDFGFIRLYLALLRWSFFTNIQRYNEMGFSLRRKLYHSLPFVSGHAPVSVDSLPS
                     PPIAISVTGESE"
     gene            complement(<700136..>700783)
                     /locus_tag="HG536_0A03840"
                     /db_xref="GeneID:59323663"
     mRNA            complement(<700136..>700783)
                     /locus_tag="HG536_0A03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281346.1"
                     /db_xref="GeneID:59323663"
     CDS             complement(700136..700783)
                     /locus_tag="HG536_0A03840"
                     /inference="similar to AA sequence:RefSeq:NP_012803.1"
                     /note="ancestral locus Anc_2.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137241.1"
                     /db_xref="GeneID:59323663"
                     /translation="MFYIQLNESIRSALQNAKEEDIAQSQRDEIDTILSVGHLSMDNL
                     IDHYEWYLKGKIPLKTLISPIEFKFKAKHVPGSQYSPEFKKDLERLGLQQRENEYQEL
                     IKKSRLRDSPFGSSGKNDDPTPAQMAKEIREQMTTVFNVLVSVVSVVFAIWYWSGSST
                     RLPLHYRVILCLFFGILVLVAEVVVYNSYLRKISDAKSKERSKKEKKKVVKQIII"
     gene            complement(<700932..>702926)
                     /locus_tag="HG536_0A03850"
                     /db_xref="GeneID:59323664"
     mRNA            complement(<700932..>702926)
                     /locus_tag="HG536_0A03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281347.1"
                     /db_xref="GeneID:59323664"
     CDS             complement(700932..702926)
                     /locus_tag="HG536_0A03850"
                     /inference="similar to AA sequence:RefSeq:NP_013818.1"
                     /note="ancestral locus Anc_2.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137242.1"
                     /db_xref="GeneID:59323664"
                     /translation="MRDLNQKCIQANRPVVTITSTVYDRRALDINSDIPLINSLNHLT
                     YLTSNSGKVRETLANDGALERLVAILQGCYIPLFELLGLDLKHVSKHKRAQSIWRQKK
                     LAMCAWKWTLAFQCLVLTGTRGTEQIRKKVVLSGVVPVLATVVDNYLIYHKKYDHLKG
                     GPIDINLSSLESEKTYRLLRKDENESYAQYMEYITGRDPLRLSNDDNFAGEDLMGPSM
                     TLPSDFIEIWLNCRTSTDVDGIDGKRREKDSPSESTESETSDKFNAGDGSFVGDDDQS
                     LCISVPRDFLLGRVIPKQDDVIWSLQLLAFISKYTYMKQQLQNVELVESLSFRSVVER
                     VRKRLAQKERPDGEGSASGDIVMQDAPPNHMAATDDPFLIELQEVARSCKQSEKETIK
                     ENEPFFQKRYRHFISSISTEHNQPRRVQERRLIDDFKRKWDYNTLSTELDDETWSYIN
                     SKESLNLFPLVERCTVNHENPHDMVYWSSVIMRNSCRKNEVTGVRQCANFACGKWEDF
                     PRQFAKCRRCKRTKYCSRDCQLTAWTYHRYWCHEVGTSVSTTASTTGANTPNAAHSSN
                     SLSQNPPDDGTTINFTINNNATEDAANGGGIAVGGGIEGAEAVPAGFNVRAADSPTTL
                     SMNDNGRPNVDNVVRHIIGDITEEEDEMVLTDQNSGSNIA"
     gene            703872..703944
                     /locus_tag="HG536_0Atrna2A"
                     /db_xref="GeneID:59324260"
     tRNA            703872..703944
                     /locus_tag="HG536_0Atrna2A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59324260"
     gene            <704258..>704839
                     /locus_tag="HG536_0A03860"
                     /db_xref="GeneID:59323665"
     mRNA            <704258..>704839
                     /locus_tag="HG536_0A03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281348.1"
                     /db_xref="GeneID:59323665"
     CDS             704258..704839
                     /locus_tag="HG536_0A03860"
                     /inference="similar to AA sequence:RefSeq:NP_012805.1"
                     /note="ancestral locus Anc_2.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137243.1"
                     /db_xref="GeneID:59323665"
                     /translation="MSVKTLNPEVLWAQRSSETEPEENYLLVTISIPDCENPTVKLEP
                     TFFEFQAKSKGHVGDETSHQYHLHIDFFKEIVPDKTVHKIANGQHYFLKIYKKDLGIE
                     FWPRLTKEKVKYPYIKTDFNKWVDEDEQHNAPPPAGFDMNDMLMNGNPDMEALKAQLA
                     QGAGGLDMGAGDLPEELDDEEDDEEVEEIEAGK"
     gene            complement(<704946..>705836)
                     /locus_tag="HG536_0A03870"
                     /db_xref="GeneID:59323666"
     mRNA            complement(<704946..>705836)
                     /locus_tag="HG536_0A03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281349.1"
                     /db_xref="GeneID:59323666"
     CDS             complement(704946..705836)
                     /locus_tag="HG536_0A03870"
                     /inference="similar to AA sequence:RefSeq:NP_013817.1"
                     /note="ancestral locus Anc_2.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137244.1"
                     /db_xref="GeneID:59323666"
                     /translation="MSVTTDGDRVVLTHPEDKTSTVTILNYGATVISWKLKGKEQLWV
                     SEAAKLDGSKPVRGGIPLVFPVFGKSKTDDALSKLPQHGLARNSAWEFLGQTKSNPPT
                     VQFALSPEIANPELTKVWPFDFSLILTVELGIDFLKTDIEVTNPSKSQELKFNWLFHT
                     YLKTEDIEDTFVSNLVGMELYDQLLQETYVDKHPVVTIHEEKDVIYRNIDDDRLIQVV
                     RKGEPIHTLKRHNLPDAVVWNPWIAKSKSMADFEPKTGYQTMICVEPGHVHDLITLAP
                     GETWNAYQLLYRDTLKYQAI"
     gene            complement(<706077..>707522)
                     /locus_tag="HG536_0A03880"
                     /db_xref="GeneID:59323667"
     mRNA            complement(<706077..>707522)
                     /locus_tag="HG536_0A03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281350.1"
                     /db_xref="GeneID:59323667"
     CDS             complement(706077..707522)
                     /locus_tag="HG536_0A03880"
                     /inference="similar to AA sequence:RefSeq:NP_012806.1"
                     /note="ancestral locus Anc_2.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137245.1"
                     /db_xref="GeneID:59323667"
                     /translation="MPEEDPQAPKVPQKGIFDSENEPLRSENASQNGQVTPLSLMIPT
                     FESVQTLPTPMTYTPPAHSAKSPRQALVISKRRGDAVQPAKENAGAQHRVVSELFPLP
                     EAAQQRVSSLPTVSESSSTTDFSLSARSDPIEVDTVDDQEILIGYMLDRLDVPMRWKK
                     VRQIGSGNFSNVFLYESIDQTTDPRLRLVSVKRIKYPEELVNRQALNPQLAKDLLSRL
                     ESSLSRELAILKSLDYPSIVKLYGVNNPVFITSKKPLRDLMLREDRLPHCDMIMSYCS
                     GGDLLVAATSCNGKLEVSVVQRLFSELVMAVKYLHDNNVIHRDLKLENVLLKFPLDAI
                     IDMKDSPVYLKHHLIELADFGLCKKIEPGELCTARCGSEDYVSPEILMGIPYDGRLSD
                     TWALGVILFGLLEDRLPFDPPPNASVRQRNRATSHRIARYEWKWLRLLNEDLDAKQIV
                     QHTLTRKSERWRIDQIRESSFVKSTADALPF"
     gene            complement(<707816..>708889)
                     /locus_tag="HG536_0A03890"
                     /db_xref="GeneID:59323668"
     mRNA            complement(<707816..>708889)
                     /locus_tag="HG536_0A03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281351.1"
                     /db_xref="GeneID:59323668"
     CDS             complement(707816..708889)
                     /locus_tag="HG536_0A03890"
                     /inference="similar to AA sequence:RefSeq:NP_012808.1"
                     /note="ancestral locus Anc_2.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137246.1"
                     /db_xref="GeneID:59323668"
                     /translation="MSQFVRSTTSKYRFGGHVSTAGGISNSVTNAFNIGCNSFAMFLK
                     SPRKWVSPQYTEDEIQKFKDNCKQYGYNPLTDVLPHGQYFINLANPDLEKAEKAYDSL
                     IDDLRRCEQLGVGLYNLHPGSSLKADHQVQLKQLAKYLNKALKETQFVKIVLENMAGT
                     GDLVGSNLEDLRAVIEMIDDKDRIGVCIDTCHAFAAGYDIRTEECFDKFWKLFDETVG
                     LQYLKAIHLNDSKVPLGANRDLHELLGQGFLGLEVFRLIAHSEHLVNIPIILETPQPE
                     PEGYGREIKVLEWLEGKEKDDKEVISKNEALQKQGSKSRQEHEQKFATKQKKSAAKKR
                     KTVVESEDELDKVRKPKRSRKKD"
     gene            complement(<709048..>710196)
                     /locus_tag="HG536_0A03900"
                     /db_xref="GeneID:59323669"
     mRNA            complement(<709048..>710196)
                     /locus_tag="HG536_0A03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281352.1"
                     /db_xref="GeneID:59323669"
     CDS             complement(709048..710196)
                     /locus_tag="HG536_0A03900"
                     /inference="similar to AA sequence:RefSeq:NP_012809.1"
                     /note="ancestral locus Anc_2.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137247.1"
                     /db_xref="GeneID:59323669"
                     /translation="MGIKGLNAIISEHVPSAVRKSDIKSFFGRKVAIDASMSLYQFLI
                     AVRQQDGAQLSTESGETTSHLMGIFYRTLRMIDNGIKPCYVFDGKPPVLKAHELGKRL
                     SRREETEKKLAEAIEQVEKMKQERRLVKVSPEHNAEAKQLLELMGIPYITAPAEAEAQ
                     CAELAKKGKVYAAASEDMDTLCYRTPYLLRHLTFSEAKKEPIHEIDTETVLKGLDLTI
                     EQFIDLGIMLGCDYCESIRGIGPVTALKLIKEHGSLEKIVEYIESGEANNKWKVPEDW
                     PYREARQLFLSPDVIDGNEINLKWAPPKEDELIEFLCHQKKFSEERVRSGIARLRKGL
                     KAGVQVRLDGFFQVVPRTKEQLAAAAAKAKQAKATGKGKAKGKVAKRR"
     gene            <710704..>712158
                     /locus_tag="HG536_0A03910"
                     /db_xref="GeneID:59323670"
     mRNA            <710704..>712158
                     /locus_tag="HG536_0A03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281353.1"
                     /db_xref="GeneID:59323670"
     CDS             710704..712158
                     /locus_tag="HG536_0A03910"
                     /inference="similar to AA sequence:RefSeq:NP_012810.1"
                     /note="ancestral locus Anc_2.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137248.1"
                     /db_xref="GeneID:59323670"
                     /translation="MTSLYEYKHPIINKQLASGSDDHSGRKFPTLNAWYSVVNDYEFQ
                     ARCPIILKNSHRNKHFTFACHLKDCPFKVLLSYCGNQRGLENEQQTEHQHQHHELNHS
                     LVSLERKPKLEEQEGVKDGGQQGAAEGDARKYTEADAEDDDVSAAIAAAVAAVQDVRQ
                     KDGGFGEEYGNGGRASEGAVRGPFVVTKIEPYHNHPLESNLTLSKFVLTKVPRILQHD
                     LNFDQILESLCNEDDNTVSKFRVSQYVEESGLLDILKERYGLTDAEIDKKLLSHISRR
                     VTTYKARFVLKKKKNGEYGNAGAARGQNGAGAHGYPRHARAAAMEHLGHPGGGVADHG
                     DSGRVNGRHLQSLHDGNLNPELNDAEVQAAQAAAQAAIGEAVALKRSVQQMVGDDDVD
                     DDASRKRHMMKLSTSMGGSLVNDDGSLVALDDTQDDKLPRDVAEQLRLLSSHFKEVEA
                     HNLNNSGCEPDEETKLVVKDDIPDENIQPELRGQ"
     gene            <712307..>714094
                     /locus_tag="HG536_0A03920"
                     /db_xref="GeneID:59323671"
     mRNA            <712307..>714094
                     /locus_tag="HG536_0A03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281354.1"
                     /db_xref="GeneID:59323671"
     CDS             712307..714094
                     /locus_tag="HG536_0A03920"
                     /inference="similar to AA sequence:RefSeq:NP_013816.1"
                     /note="ancestral locus Anc_2.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137249.1"
                     /db_xref="GeneID:59323671"
                     /translation="MLRLSRGRLCGLNQLLPCYLSGSRQLRYYSTKDEKASDSTEDDG
                     ISSPQPSKAAQPWYVTMIDRNETVRDSVFQAQKVEFPNGSPESLRKITNRLKDHLGVT
                     DILVFDLRDADRGNYTTAVAKVSDFMVIGTAKSAKHCQRCFMELNGFIKREYGSVAYV
                     EGDVNGRDEKRRHKRLARKTNLSKNWGSNSSALSGGFQSNSEAWFMIDCHVDNIFLNI
                     LTEQRREELSLEELYAPENERYKYKRSEEKVPQEETLELQDDNNILAGLKRLAYQRRQ
                     YSTVPVATAISGKLSGFLEAQDFNNASSFIDEHKHEHSLTLLQTIAKSFATHKVPVVD
                     TTKLREWHTLFDQCWPLVLDAETASLHWSTRLRFLKMLNVANRNFYPVRMFINDYLLL
                     KRSTGFPLVRDDLLQFLQMVTINLSLNPKADYWDLVKANGDVVQALKLFDELNGDSLL
                     HDELVMTLLLRTMVLNDDKRTRLHSLYELVDYVMHKRAVSPAIMASVLEILGGIRDWN
                     KFFQFWELGADDFLPGEDDRPWYEFLRIVVNSNDLNLMNKLVNEGHLLWLKRNEVELT
                     QDIESQLNKLFIKVDPQGVTLQSLKNYLY"
     gene            complement(<714095..>715039)
                     /locus_tag="HG536_0A03930"
                     /db_xref="GeneID:59323672"
     mRNA            complement(<714095..>715039)
                     /locus_tag="HG536_0A03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281355.1"
                     /db_xref="GeneID:59323672"
     CDS             complement(714095..715039)
                     /locus_tag="HG536_0A03930"
                     /inference="similar to AA sequence:RefSeq:NP_012812.1"
                     /note="ancestral locus Anc_2.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137250.1"
                     /db_xref="GeneID:59323672"
                     /translation="MPLVLFSGYPSSGKTTVAKELIALLEQRLQDDESLARRNYSIVY
                     HSDRSLGIQHSDYVSSRDERKLRSEIISAVKRDLSARRIVIVDSLNYIKGFRYQLHCE
                     VKNVATTFCLIHTMCPLDALHAWNRNEDHEAWDEQLLEQLIQRYEEPNAKTRWDSPLF
                     PLLTTQDSIKDHFEEICSAIFRTSAKNGDHRDPLSKALQKPNSATILKPASQSNFIQV
                     LDSDTSAVVRKIMDHVKVQQSIGGSSSSTRIIVSEETSDINDDRCCFVDLPSSGVTLP
                     LLQRLKRQFVNLNKLRDMERSRIVPLFAEYLNRNLNND"
     gene            <715164..>716195
                     /locus_tag="HG536_0A03940"
                     /db_xref="GeneID:59323673"
     mRNA            <715164..>716195
                     /locus_tag="HG536_0A03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281356.1"
                     /db_xref="GeneID:59323673"
     CDS             715164..716195
                     /locus_tag="HG536_0A03940"
                     /inference="similar to AA sequence:RefSeq:NP_013815.1"
                     /note="ancestral locus Anc_2.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137251.1"
                     /db_xref="GeneID:59323673"
                     /translation="MKKFIPRFDFPDYNIPRTDFKGHQLKALKKFDSLRPQLNLILEL
                     RDVRAPLSTRNVLIDQLIDPRIHQRLVIYTKRDLVADNTHYLLKLSHWQQEIDEDFIL
                     IDAKRRQSARHVLDIIKSYKRQLEVRSQGLALPTGYKVLVAGMPNVGKSTLINTLRGA
                     GSKVARTGAEAGVTRSTSETIRIGEPHDNIYLIDTPGIGLPGRLVNERQRMLSLSLCG
                     CVKTNLVDPVVQADYLLYLANLQEPHKHYPGAPTNDVYKLLRRVQPRGAPRDNATAAA
                     VHWLRQSHRGLIYDRELLLDTDSFSLRGYLSRQPQPEPQAKQQSRVTAHDRRLQNVHQ
                     LFPKLSGTQ"
     gene            <716743..>718068
                     /locus_tag="HG536_0A03950"
                     /db_xref="GeneID:59323674"
     mRNA            <716743..>718068
                     /locus_tag="HG536_0A03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281357.1"
                     /db_xref="GeneID:59323674"
     CDS             716743..718068
                     /locus_tag="HG536_0A03950"
                     /inference="similar to AA sequence:RefSeq:NP_012813.1"
                     /note="ancestral locus Anc_2.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137252.1"
                     /db_xref="GeneID:59323674"
                     /translation="MSSTKPLPIQPYPAAIAPQLSAAHNGTGATVGARKNGGASSSGL
                     TIRTSRHWVLPPRPKPGRKPNHYDSKRSKQAAAAPPQPAPVVKKSVSQPVCVKKELAS
                     VPIKKSATAPACLTKKQVQPSPAKKQTKTALKKEIQHIKVENSKLKQELSQLVSDLQA
                     LKQRYNSPEAASTKKRQFLDDSTSAFLKFEEDERNEDLTQLPPLLVSTAKMKFTSSVS
                     SCKTIPTDDEDMLTVSSSTPNSLISADLQHSSSSVSSASSLNLNPGQAHGLSPTIHAK
                     PQLKFLDDHEQMQFYDKYMRMDFSLAPHQHIDENHLAALDSIKEEETEFKFGGANDDD
                     ILSFLENKHELAVQQDSKDDQCFFAVKQETREDDADFLLQQPVANDTISTTISNSTTS
                     NFYMPPSLEELMEEQDGGSKNFPLNLTTNDFNYYEDNLDMLKMEAFDMI"
     gene            complement(<718217..>719101)
                     /locus_tag="HG536_0A03960"
                     /db_xref="GeneID:59323675"
     mRNA            complement(<718217..>719101)
                     /locus_tag="HG536_0A03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281358.1"
                     /db_xref="GeneID:59323675"
     CDS             complement(718217..719101)
                     /locus_tag="HG536_0A03960"
                     /inference="similar to AA sequence:RefSeq:NP_013814.1"
                     /note="ancestral locus Anc_2.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137253.1"
                     /db_xref="GeneID:59323675"
                     /translation="MSEFKIKSGLAQMLKGGVIMDVVTPEQAIIAEKAGACAVMALER
                     IPADMRKSGQVCRMSDPKMIKDIMAAVSIPVMAKVRIGHFVEAQVLEALEVDYIDESE
                     VLTPADWQNHIKKNEFKVPFVCGAKDLGEALRRINEGAAMIRTKGEAGTGDVSEAVKH
                     ITKIRGEIAEYKGTLKTEEQLAEKAKELRVPVELLKETLEQGKLPVVNFAAGGVATPA
                     DAALLMQLGCEGVFVGSGIFKSSHPEKLARAIVEATTHYSDAKKLLEVSSDLGEMMGG
                     VCVESIKQTDKRLAEIGW"
     gene            <719590..>720231
                     /locus_tag="HG536_0A03970"
                     /db_xref="GeneID:59323676"
     mRNA            <719590..>720231
                     /locus_tag="HG536_0A03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281359.1"
                     /db_xref="GeneID:59323676"
     CDS             719590..720231
                     /locus_tag="HG536_0A03970"
                     /inference="similar to AA sequence:RefSeq:NP_013813.1"
                     /note="ancestral locus Anc_2.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137254.1"
                     /db_xref="GeneID:59323676"
                     /translation="MQTEESMKRVGVLALQGAFSEHIQHLEKCVADNGYEVKIVTVRT
                     PEELSQCDALVLPGGESTSMSLIAQRTGMFPHLRKFVHDPSKAVWGTCAGLIYISQEL
                     ANERELVQPLELLKVRVRRNAFGRQAQSFVQNCNFSEFIPGCHDFPAVFIRAPVIEHI
                     FDADAVKPLFTLESGLIVAASQGDNILATSFHPELAENDSRFHDWFLRQFVLK"
     gene            complement(<720224..>721513)
                     /locus_tag="HG536_0A03980"
                     /db_xref="GeneID:59323677"
     mRNA            complement(<720224..>721513)
                     /locus_tag="HG536_0A03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281360.1"
                     /db_xref="GeneID:59323677"
     CDS             complement(720224..721513)
                     /locus_tag="HG536_0A03980"
                     /inference="similar to AA sequence:RefSeq:NP_013812.1"
                     /note="ancestral locus Anc_2.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137255.1"
                     /db_xref="GeneID:59323677"
                     /translation="MDVGLFLALPVDIRTWVYYQLDGNFSCVTPEPIEQLYSDQIIKL
                     ASQVEKDSSASQKLLKKRLYDVFAQYLNIFDYSPSLISRWLEYSLWLRYDSIVLDCMR
                     LNHAYGGTLIGQVDWIYLDGRLRLAYFKNCMPVVWYTLREYARWIIREETEDDELDGV
                     SFFRLNLEYSSLDFLKRIFKSMRNNDLFLLLSEVFLEEDGETDLPALVDDDADQVAYP
                     VEDLRVIELLSKLESMKNLNRISVRGDRLFEALINFHGVRDNPGRTISYMVKKRIMRL
                     ELWQLNEPARSGLADFTRWENLRELRLVNINTIDFNKLVLPSLCKMISLESVSEVVWW
                     DLESKIGSVIEGSTITRKLNATTKLRFLDRKSLKPDNLGLCQSIVWQAFKHLNFLKLQ
                     NVTTVRGGKIVIPCALYNNRRVLLFPTTSSVKEIIII"
     gene            <721679..>722770
                     /locus_tag="HG536_0A03990"
                     /db_xref="GeneID:59323678"
     mRNA            <721679..>722770
                     /locus_tag="HG536_0A03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281361.1"
                     /db_xref="GeneID:59323678"
     CDS             721679..722770
                     /locus_tag="HG536_0A03990"
                     /inference="similar to AA sequence:RefSeq:NP_012814.1"
                     /note="ancestral locus Anc_2.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137256.1"
                     /db_xref="GeneID:59323678"
                     /translation="MLKDQLKIELKKWEYAFIKEHGRDPNKDDIKRLPEIRNMYKKYA
                     RLRKDHSPVASHSAQEQRSSAKASVMELGPTPQIYGKAMSIFDMNISPIKTSPIDGTR
                     DSEEPVIIKHTTDDLPACEDLPVKRQLTFTSPAPSSSPRKGSDCRHKAYGPNSPLKWE
                     KENLHISIKCVSPLKRTPVKGFNQGTVSFSPSPLVRRPLTRPLLELMKEHEAIVEEFK
                     QMEDKDDETLLSSKRPDNIFAEEEEIVLDDERKTVKTRRRKILRRKVIEEQNEGIEKN
                     IAEEITKLKQQRVKDFLGVNENSTEDNDDSAAGPDQQQEQGKETITKSMQKGGRKRNK
                     KYNLVSNNFRRLKLPTKKAGNRRWNNRRR"
     gene            complement(<722840..>724372)
                     /locus_tag="HG536_0A04000"
                     /db_xref="GeneID:59323679"
     mRNA            complement(<722840..>724372)
                     /locus_tag="HG536_0A04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281362.1"
                     /db_xref="GeneID:59323679"
     CDS             complement(722840..724372)
                     /locus_tag="HG536_0A04000"
                     /inference="similar to AA sequence:RefSeq:NP_013811.1"
                     /note="ancestral locus Anc_2.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137257.1"
                     /db_xref="GeneID:59323679"
                     /translation="MSSSRQRIVTSRAPLLPQQTTPEQRYWRQYSSAQLVKEHNSVTH
                     ISFNPQHPHDFAVTSSTRVQIFSSSTRQVIKTFSRFKDIVYSASFRNDGKLLCAGDAT
                     GLVSVYESYNPRTLLLSINASSHPTHVTKFHDQDSKTLVTASDDRVTRVWDVAHAYEP
                     QLELLGASDYVRTICFVPAAPHLVMTGSYDGFLRLYDTRSSGAVPVYSLNHGQPVENV
                     TSISPTQVVSCGGSNFKVWDLTSNKKLHERGNFNKTVTCLDYVEDFDCPSRSALIASS
                     LDGHVKVFDPLDNYKVKFGWKFSGAVLSCAVSPGEAQGNKHLVAGLSSGLLAIRTKSK
                     EKRSNKPAGSVSAVTKSNNYQRMMRGSEYQGDQEHIIHNDKMKQQRRVRAFERNINQF
                     KWSEALDSAFVPGMAKELTLTALQELRKRGKIRVALYGKDESSLEPLLNWCLKGIEDV
                     RAAPVIADWLAVVIELYDELLETSPVLQEMIIDLRNKVRQEVYKAKEAQRIEGMLQLL
                     TS"
     gene            <724604..>726436
                     /locus_tag="HG536_0A04010"
                     /db_xref="GeneID:59323680"
     mRNA            <724604..>726436
                     /locus_tag="HG536_0A04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281363.1"
                     /db_xref="GeneID:59323680"
     CDS             724604..726436
                     /locus_tag="HG536_0A04010"
                     /inference="similar to AA sequence:RefSeq:NP_013810.1"
                     /note="ancestral locus Anc_2.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137258.1"
                     /db_xref="GeneID:59323680"
                     /translation="MSSFQLEFIQPPQPATLRNFTTHLSYDRGSNAVAYPCGKSAFIR
                     FLDDSKAVIQFSGHGSSNVSVVKFSPIQGSQYLCSGDDAGRVIVWGWSRDRDTGSFET
                     AVKAEFQVLAGPITDVSWDFEGKRLCVVGEGRDKFGVFISWDSGNSLGEVSGHSQRIN
                     ACHFKQSRPMRCVTVGDDGSVVFYQGPPFKFAASDRTHHDQGKFVRDVQFSPGSGDFA
                     VTVGSDRRIVCLDGKTGEFIKYIEDENEEIKGGFFAISWIDESRFVTASADATVRLWS
                     VKDSKFLGKWFIPGDALANQQVGVVATKNEQIISLSLDGTLNFLKIGEESPVKFLRGH
                     NKGITALTVNPLISGSYDGRIVNWATSPETMREDHSNLVVAIDNSEPPKYASVSWDDT
                     LKVLSETKYKFEGQPKVSSSANNGGIIAVATDSDYLLIMNSYTGEVLQKKQLSEPASA
                     IDIRGGLVAVGLERTNTIEVFKTSDLAVNYKLPAALRATPSCVSISATGSYLAAGDVM
                     GKIILYDLKTKDIKTTRWAYHTSRINSIAWMPAKSEGDDEDLVATASLDTNIFIYSVK
                     RPMKTIKCLNAHKDGVNVALWENSQTLVSCGADACIKRWNISVE"
     gene            <726902..>728236
                     /locus_tag="HG536_0A04020"
                     /db_xref="GeneID:59323681"
     mRNA            <726902..>728236
                     /locus_tag="HG536_0A04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281364.1"
                     /db_xref="GeneID:59323681"
     CDS             726902..728236
                     /locus_tag="HG536_0A04020"
                     /inference="similar to AA sequence:RefSeq:NP_013809.1"
                     /note="ancestral locus Anc_2.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137259.1"
                     /db_xref="GeneID:59323681"
                     /translation="MSEELGQSPAVGDRLPARSRSGSERPNYHIDTEDLDIRDDDDDA
                     DDYHEEDDIEDEEENETNVVVHTEGQIPPVARRGRPSKRKSREASQDDNRSETEASRS
                     GSTAPGFLNIKRPRLSYPVDESGMPLPVINEEYDLPDDPEGETKINRDGNLLGGRQFL
                     VRSFTLSDKGKRRYMLSTEPARAVGFRDSYLFFQYHPNLYKFILSQEQKNDLIDRGVL
                     PYSYRSRQIALVTARSVFKEFGAKIIVGGKNITDDYYATRLRQEGRVVEGTYAREPMR
                     KGNLRGFDGFDYAESSVNPAKNAVEFFDKRHQNHHNGGASTAGANKINATNWLYQHAA
                     ACSRFNSDMYYDRVRILLIERQGLRDPYTNTLHLPQSTQASKILKTCRKPLTTEERRE
                     ECSVVYETKISDADLTRNKTGLSEIPLEIFDGTVSEEVLAAILEQQKFERGL"
     gene            <728720..>731212
                     /locus_tag="HG536_0A04030"
                     /db_xref="GeneID:59323682"
     mRNA            <728720..>731212
                     /locus_tag="HG536_0A04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281365.1"
                     /db_xref="GeneID:59323682"
     CDS             728720..731212
                     /locus_tag="HG536_0A04030"
                     /inference="similar to AA sequence:RefSeq:NP_013807.1"
                     /note="ancestral locus Anc_2.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137260.1"
                     /db_xref="GeneID:59323682"
                     /translation="MLSLLWPHTKVVARRTFSTPCSRILVTNLSSNFKSFHSIRPLHL
                     KNDNPSGDHQGKDNNRQDGNEDATDKDLESLKQEMNRFIEEAKKGGLGGNWQERQNKI
                     NKEIKRLEETIARQQARQKQVDEENESNKNQDPFNFQSRQSKEAEDLHRRMNENRKAE
                     EEKFKQSLNNPNVSTSNNIGLFQLGLTFLLLSFVLNIFNAAEEPKEITWQDFRCKLLA
                     RGHVSKLVVVNKSFVKVLLNEAGKNQPENAGHDYYFFTIGSVESFEKKLQKAQDQIGI
                     ANDFRVPVVYVQEGNWARAMFQILPTALMIAGIIWLTRRSASASGASGGGIFGMGRSK
                     AKRFNTETDVKVKFKDVAGCDEAKEEIMEFVSFLKEPKRYEKMGAKIPRGAILSGPPG
                     TGKTLLAKATAGEAGVPFFFVSGSEFVEMFVGVGASRVRDLFKTARENAPSMVFIDEI
                     DAIGKARQKGNISGANDERENTLNQLLVEMDGFTPADHVVVLAGTNRPDILDKALLRP
                     GRFDRHVNIDKPELSGRQAIFEVHMKKIKLAGDIYDLKNRLAALTPGFSGADIANVCN
                     EAALIAARGNSHSVKLEHFEQAVERVIGGVERKSKLLSPEEKRVVAYHEAGHAICGWF
                     LEFADPLLKVSIIPRGQGALGYAQYLPGDIYLLTEQQLRDRITMSLGGRVSEELHFSS
                     VTSGASDDLKKVTRMATAMVTELGMSPKIGWINYKKRDDTDLTKPFSEETGTIIDEEV
                     YRVIQECHDRCTRLLKEKAQELEKVAQLLLKKEVLTREDMINMLGKRPFPERNDAFDK
                     YLNETETERIKKSEQDDRKHYENRNETEADLR"
     gene            <731511..>733196
                     /locus_tag="HG536_0A04040"
                     /db_xref="GeneID:59323683"
     mRNA            <731511..>733196
                     /locus_tag="HG536_0A04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281366.1"
                     /db_xref="GeneID:59323683"
     CDS             731511..733196
                     /locus_tag="HG536_0A04040"
                     /inference="similar to AA sequence:RefSeq:NP_013806.1"
                     /note="ancestral locus Anc_2.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137261.1"
                     /db_xref="GeneID:59323683"
                     /translation="MEPLDETTSLLPIPEQEEIGDLEVEYHKHNLALPKLPILTSLWL
                     GSFISSLDGTVVANIMNRVAEEFAESDRKQWIATSFLLTNTAFQPLYGKLSDVTGRKF
                     ALLTAYTFFGLGCLLTCFARNVTEFAVARAICGIGGGGINACSSITVSDICTAKERGI
                     YQGYANIVFGLGQMLGAPIGGLFIDTVGWRAIFGIQVPVILLSAILAFKNVNIKLSHV
                     PPVRYRFTRKNLSRIDFLGSLTLALSICGLLLICSTDLNKKALAVLTGAAFALFLWVE
                     LCFATEAILPFKLLSGSFGLASVATVCSSFIIFGDIFRSPIYLQLIHDISVTQTGLFL
                     IFPSIAVAAGSLAAGYVLRHSKMQLDRCAYLIVLFGIAFQLLGLTANYYLVSIVEPAL
                     STHGEHSVAAAAVRFASQSFSWKILFVLDSVLVGFGYACLLVATLVSIVFSIEKSQQA
                     TMTGIFYLWRSIGNVLGASLTLVIFDKSLARSLWHYMFHSDGVSYDFTADEYYELLSD
                     TSYLRSHFPPKILRGLLAVYRTAFQVSFWPNIGLAIAGLAASCFLIRTVPKTT"
     gene            complement(<733200..>733973)
                     /locus_tag="HG536_0A04050"
                     /db_xref="GeneID:59323684"
     mRNA            complement(<733200..>733973)
                     /locus_tag="HG536_0A04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281367.1"
                     /db_xref="GeneID:59323684"
     CDS             complement(733200..733973)
                     /locus_tag="HG536_0A04050"
                     /inference="similar to AA sequence:RefSeq:NP_013805.1"
                     /note="ancestral locus Anc_2.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137262.1"
                     /db_xref="GeneID:59323684"
                     /translation="MDGRLARIVLCDTSEAVCDGWRRMLTSRCGDLSVSVYHGTLGAL
                     LERECGGSVAVVSPGNSFGFLGGGFDQALCQQLGGEPFETWFRAKLHERYYPVGSATA
                     VELGGGFSCGAVRYVVHVPTMVAPCRSVYDRRRCVATGYSRVFDAMWNALVSCPADVQ
                     TLVVPGLATGYAGVPSEVACKSMVFALRVFALPAKLFSRELQNVLIMHFLGCGYGGFF
                     GERSLRECERWGISVEALQRFDASRDSIEDILPAVELYV"
     gene            <734327..>735610
                     /locus_tag="HG536_0A04060"
                     /db_xref="GeneID:59323685"
     mRNA            <734327..>735610
                     /locus_tag="HG536_0A04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281368.1"
                     /db_xref="GeneID:59323685"
     CDS             734327..735610
                     /locus_tag="HG536_0A04060"
                     /inference="similar to AA sequence:RefSeq:NP_012816.1"
                     /note="ancestral locus Anc_2.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137263.1"
                     /db_xref="GeneID:59323685"
                     /translation="MQLLFRRWLVSGIEAIPRAAPDRILGLTEQFASDSCRNKVNLTV
                     GVYKDSWGQVTTLPSVAMAQRQIDEDVELNTDLSYLPITGCPEYSEKVLGFLFGESSP
                     GSGPQLVRQQRVSFAQTLSGTGALAVASKLLALFLAQTVWVPQPSWPNHWNVFRSNGF
                     ADIRAYPYYRDGRLVVDEWLDLLRSQVRSDRAKRHAIVLHACCHNPTGADPTREEWRR
                     ILDTIHELQMIPVIDMAYQGLESGNPPKDAYVLRMCLDESRYDCWPNGLFLCQSFAKN
                     MGLYGERVGSLSVVVPPNDSGTREKVDSQLKQIVRSAYSSPPGYGSRVATLVLSKPFL
                     RMQWYKDVAFMVSRLNQVRSDMHELLGWPALTDFEHQHGMFYYTGLSSKQVDLLRTKY
                     SVYMTADGRLSLSGVNDQNIEYVCKALKAVSKTAR"
     gene            complement(<735694..>738318)
                     /locus_tag="HG536_0A04070"
                     /db_xref="GeneID:59323686"
     mRNA            complement(<735694..>738318)
                     /locus_tag="HG536_0A04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281369.1"
                     /db_xref="GeneID:59323686"
     CDS             complement(735694..738318)
                     /locus_tag="HG536_0A04070"
                     /inference="similar to AA sequence:RefSeq:NP_012817.1"
                     /note="ancestral locus Anc_2.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137264.1"
                     /db_xref="GeneID:59323686"
                     /translation="MFSRRRLSRDTEQPTNASALAAASAVGKALNSNGTTVDRSKIPE
                     YNRSPSLGSSRRSSLQLDGPLGNRNNGSSRTGSPDENIIDGIRRRTSVKSTNPRSNSS
                     TRSRSLQGPGGSAGRKRSLRNGAEDCNVDPQTVFKEFGDQKTAAFVQQSGNEKPVTIK
                     KYIPTSHGLVAVEVPIEEHLEQQKRRFSHLRRSSSSNSLSIARQNSLTRRATLESQAK
                     SQERRHSSLTNSSFRSPSYRSRQSDNQPLIRTHMPEETEQELTEDIIRPLRIPRDEYV
                     KKTTEVDSLNHNGQGSSRQLETEIQHVDDNVIMQEEQSESEITVNEKLAPAAAELSLN
                     PPQEAGPSKARDHSEKPNIAVEKEIQIMAQSDAPAPENLGQADRTDSEPRNDSEDDLF
                     DASDNVETEHAEDSTKPAQSGAEPPRASSLAQHLRALNPYLNQPEAASSAKTEEGDAQ
                     VSSKPDTKNLFKVPSPMKSALKKTNTQSSAASSIYSESSPANQAYLSLTTAENTRLNA
                     KLASSENLVQRQNSKHQTRPYSVANPPNYGSTSPSPRESAKAKRHSTVQKSAGENRQF
                     AYRPNSEQTTNHATAAARTSTSINKARKDFVKRKPFEHINNKNDMTKKENRKSKEVPD
                     SVLYPKEPPQKRSSFEKIRNQEVHLGFKKLSLRDEKMLEADFDQNNYTNGSRSGIPTT
                     PKKQNAALSSQEANLAFLEKSGWKSRFHDSDSDDDSMPFTGSSQTKQATSIGTHSEGP
                     AGASKGFSLFKNKGKAQNGTTAMQQPAQPPFMEGEASLSNATPNKVNKKWSKLSLRSS
                     STTDAYDSKSESLNKSAAQEKRYHSNSKVEGFDHGGMKARTTGENLLAPSDGNNQAVK
                     KKKTFGTKLKKLFGREKY"
     gene            complement(<738716..>740899)
                     /locus_tag="HG536_0A04080"
                     /db_xref="GeneID:59323687"
     mRNA            complement(<738716..>740899)
                     /locus_tag="HG536_0A04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281370.1"
                     /db_xref="GeneID:59323687"
     CDS             complement(738716..740899)
                     /locus_tag="HG536_0A04080"
                     /inference="similar to AA sequence:RefSeq:NP_012818.1"
                     /note="ancestral locus Anc_2.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137265.1"
                     /db_xref="GeneID:59323687"
                     /translation="MCGIFGYCNYLVEKSRGDIIDTLVEGLQRLEYRGYDSTGIAIDG
                     DELDSTLIYKQIGKVSALREEIAEHKPKRDVTFLSHCGIAHTRWATHGEPKQINCHPQ
                     KSDPNCEFVIVHNGIITNYRELKTLLLNKGYTFESDTDTECIAKLFKHLYDTNLENGH
                     ELDFHELTKLVLLELEGSYGLLCRSAHYPNEVIATRKGSPLLIGVKSEKKLKVDFVDV
                     EFPDDNAQPETPLVSERANGATANGNSVRTLNGSGKKRLYDHEDRGNSNLLPIAANEF
                     NLRHSQSRAFLSEDGTPNPVEFFLSSDASSVIKHTKKVLFLEDNDIAHIYDGEIHIHR
                     SRREVGASMTRSIQTLEMELAQIMKGEYNHFMQKEIFEQPESAFNTMRGRIDFEKGTV
                     MLGGLKAWLPAIRRARRLVMIACGTSYHSCLATRAIFEELSEIPVSVELASDFLDRKS
                     PIFRDDICVFVSQSGETADTMLALNYSLERGALTVGIVNSVGSSISRITHCGVHINAG
                     PEIGVASTKAYTSQYIALVMFALSLSDDRVSKLERRQDIIRGLKMIPEQIKEVLSLEP
                     QIKALCEKELKDQKSLLLLGRGYQFASALEGALKIKEISYMHSEGVLAGELKHGVLAL
                     VDEDLPIIAFGTRDSLFPKVVSSIEQVTARKGQPIIICNKNDEAWEKKSATTKMVTLE
                     VPLTVDCLQGLLNIIPLQLISYWLAVNKGIDVDFPRNLAKSVTVE"
     gene            complement(<741395..>742927)
                     /locus_tag="HG536_0A04090"
                     /db_xref="GeneID:59323688"
     mRNA            complement(<741395..>742927)
                     /locus_tag="HG536_0A04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281371.1"
                     /db_xref="GeneID:59323688"
     CDS             complement(741395..742927)
                     /locus_tag="HG536_0A04090"
                     /inference="similar to AA sequence:RefSeq:NP_012819.1"
                     /note="ancestral locus Anc_2.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137266.1"
                     /db_xref="GeneID:59323688"
                     /translation="MSDQREIVEQLRKTLQLLDAGSNVRSNNEPGEKAWKEIHPSFEK
                     LEEYSKDYIEFTYENPTTYHLIEYFAHELEKAGFEYLSEKESWGERVKNSSNRKFYTS
                     RNGTNLSAFIVGKKWEPSKGVGAIGAHADALTVKLKPSSLKDHVEGFDLLGVAPYGGT
                     LNNLWFDRDLGIGGRVLYREAPNGSIKSKLINSAPQPIAKIPSLAPHFGSPAEGPFDK
                     EDQAVPVVGYVSDDTPGPDANDIEKSSPLYGKHCLNFLRYVAKLAGLKVCQLVQLDLD
                     LFDVQKGVIGGIKDDFLFAPRLDDRLCSYASMRALLESSADLDVDSMDTFVNVTLFDN
                     EEIGSLSRQGARGGLFESVVGRVTASLQGNSVDMRALFANSITLSADVNHMFNPNFRE
                     VYMKNHSPKPNVGITLSLDPNVHMATDVVGTAFVEDLARSNGDKVQYFQIKNNSRSGG
                     TIGPFIAAQTGARTVDLGIAQMAMHSIRATTGSRDIGLGVKFFRNFLQNWRPVYDKFG
                     DL"
     gene            <743687..>747805
                     /locus_tag="HG536_0A04100"
                     /db_xref="GeneID:59323689"
     mRNA            <743687..>747805
                     /locus_tag="HG536_0A04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281372.1"
                     /db_xref="GeneID:59323689"
     CDS             743687..747805
                     /locus_tag="HG536_0A04100"
                     /inference="similar to AA sequence:RefSeq:NP_012821.2"
                     /note="ancestral locus Anc_2.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137267.1"
                     /db_xref="GeneID:59323689"
                     /translation="MAGGTPKRTAAKSSHSSSVAKKAARNAMLKVAGTTKVSPTQLER
                     VVQSVNDATKRLSQPDSILSTSTTTKSSKRKSRDTVGPWKLGKTLGKGSSGRVRLAKN
                     MQTGQLAAIKIVPKRNNLQSKDEVSSTLSVSYASNCSNASTTLNTTANNYNNAGHSTV
                     ASNSYGIEREIVIMKLISHSNVLGLYEVWENKAELYLVLEYVDGGELFDYLVSKGRLG
                     EREAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKTIKIADFGMAALEVSNKL
                     LQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQ
                     SGKYQMPQNLSAEARDLIAKILVVNPARRLTTEEILAHPLIVKYDGVAKPKKPRAMGN
                     HMAQGKSNSDLHLLNSYGSKTISFTSKKDIDESILNNLQILWHGAARELIVAKLLQPK
                     MSEEKIFYALLLKYKENHMKKQPADAEQPKEQIFNVPTGKTHGSEESQENTGIPKLIQ
                     KSEFSVPVIEQEGNDETVLPLPFASIPPAIPVFTASNSRTFKKSGSLLSLQSQKSLSG
                     KDPLRSSSRKSLSRSNSKKTLQKSASKRSLYSSASISKRSLNLKDYVLTDNDFESNQL
                     PPLPSLDSTNGFEYLCEQLLFGNGLDKILEEEEEEDKSVASRRARTGSSSSNTAFRGD
                     LNDDGLLSINESFRPAFLFSSEKSVESNDRMDDNRAKEFMAKMPLQDITNTHTQSRTP
                     RSKLKRDISQKSNLSNILDHKTIKKEYDLSSNSGLRASSVGQHSDPVHSLDPRRNVSQ
                     PVSSNVVESLLRGFRSASGSKSRGSDADWAYSRGSIFREENKSTNFLASPLGHEQPSA
                     KESYMDADIKSSELDFLAHSSAVQKDHSDLSHISFNTSATFKDLGAYLHEVNESYASQ
                     TRSSLKPKSRKATIKTDYSRKNLAVRRGNNSLNSKGHHSHNCSVASYDVDIMSDMSFA
                     MEIPTNTFSAQAVTISNRGSAEQVIADRENNQAEYQKESANLLTYTPTTTYEEKKMNI
                     FEDPPVESDSIEVTSSESDSSPNIHRKAVSIDTLNTTNVLPPTTNVRVSLYVNNNQSS
                     AAALPRETTEQIISKFKLSPEKTLEPVIQKRFSSAASKKDSYILHRSESKLAMFKDID
                     EEEEAQHSGPSDIPNTSIKDSSSNPRATQPYRVTMLFDGEEAEQDGPASSEPLAQESK
                     STAPHDFDAKPGKGHTLEAAVPKREIKQKPASQSLSSRDGRPKQNWISRIFGGLKQKS
                     DEQKFVKRHITSISFDDAHTLTLNEFDKNEIDYLLKTCERRGGREKVEYDCKFTTGNF
                     KFKIKIESDASTIITVKRKGRSRGQHAASAFEIFNGDVAKVISQAEKKTAAA"
     gene            complement(<747948..>749069)
                     /locus_tag="HG536_0A04110"
                     /db_xref="GeneID:59323690"
     mRNA            complement(<747948..>749069)
                     /locus_tag="HG536_0A04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281373.1"
                     /db_xref="GeneID:59323690"
     CDS             complement(747948..749069)
                     /locus_tag="HG536_0A04110"
                     /inference="similar to AA sequence:RefSeq:NP_013800.1"
                     /note="ancestral locus Anc_2.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137268.1"
                     /db_xref="GeneID:59323690"
                     /translation="MLRNTTVRLSRPMVFHGRLTRLQSTFTIPKTQKGVVFYEHGGEL
                     LYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVAKG
                     KDVKNFEIGDYAGIKWLNSSCMSCEVCEQGHESNCSHADLSGYTHDGTFQQYATADAV
                     QAAHIPKNADLAQVAPILCAGVTVYKALKTSGAKPGQWVAISGAAGGLGSLAVQYAKT
                     MGLRVLGIDGGERKEQLFKSLGGEVFIDFTKSKDIVSDIQEATQGGPHAVINVSVSDA
                     AISQSTKYVRPTGTVVLVGLPVKAVVKSEVFSHVVKSINIKGSYVGNRADTREAIDFF
                     SRGLVRSPIKIIGLSELGKVYEMMEAGTILGRYVVDTSR"
     gene            complement(<749416..>751263)
                     /locus_tag="HG536_0A04120"
                     /db_xref="GeneID:59323691"
     mRNA            complement(<749416..>751263)
                     /locus_tag="HG536_0A04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281374.1"
                     /db_xref="GeneID:59323691"
     CDS             complement(749416..751263)
                     /locus_tag="HG536_0A04120"
                     /inference="similar to AA sequence:RefSeq:NP_012822.1"
                     /note="ancestral locus Anc_2.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137269.1"
                     /db_xref="GeneID:59323691"
                     /translation="MNSEFVRAIAEDLFRIPSKILKQSTSAPNGSSNKELENVFEQIA
                     SVVKNNQSTVVSKLDQFSSSAAHALVAIFQRHPLFIDYLTLTGLATALVVVGSFASIR
                     SIPYTALPPTQVHPSFDPSDYDLDHECQIIYADEKQKWTDKLDERQAIVLPLTSAVLL
                     LALYVIITKLKVEWKIYLLKLLNFNIVLVTFPAGLLVYTYFANCFTRHLSRLGSWNPL
                     MVSPRFRVTISDDNEAVNRAGWFVHNFQYREALTDDLGYEGVVDKIKNDPWERQLYSR
                     ELTNPSDVKSNRQFVNMYLNGSMLFSCILSAATTALYVCFPNDWLIRNMISMNLAVWA
                     ISQMDLKNLKSGVLVLVALFFYDVYFVFGTRVMVTVATSVDLPIKLSLPSRFNTVLNN
                     FEFSILGLGDIILPGIFIALCYKYDIWRWHYVNTDTEFHLLNWHYIGRYFITALLSYI
                     VALVSCMSALTLFGAAQPALLYIVPFLLISTLTMAWASGDLGQFWSFQYDTIELGENK
                     LSNSDSEPLTTYSDYLRSDDLDNDDSEDYTNQDAIMDYESDNDDDDDSDNDCSQETIP
                     EYKPTDLLRLLDDAAGSSDAEDADFVLQDDDDVSDSDTIVLDEEENELA"
     gene            complement(<751413..>752171)
                     /locus_tag="HG536_0A04130"
                     /db_xref="GeneID:59323692"
     mRNA            complement(<751413..>752171)
                     /locus_tag="HG536_0A04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281375.1"
                     /db_xref="GeneID:59323692"
     CDS             complement(751413..752171)
                     /locus_tag="HG536_0A04130"
                     /inference="similar to AA sequence:RefSeq:NP_012823.2"
                     /note="ancestral locus Anc_2.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137270.1"
                     /db_xref="GeneID:59323692"
                     /translation="MAKLVHNVQKKQHRERSQLTRRSRLGFLEKHKDYVKRAQDYHKK
                     ENTIKILRAKAKERNPDEYYHAMTSRKVDASGLLHTSRRGRDEDSTLSMDQVKLLKTQ
                     DSNYVRTLRQMEKNKLEKKSKELMFESKGKHTIFVNDRQEMEDFTPEKYFNTTTSMVN
                     RRENRLTKDQLMSSQVASIVPDPSAIMPRESLNKKKLKKFKAIEGHLERESKLSAVQQ
                     RMDLQREVMKKGSKKKISDSNGNICFKWKKQRKR"
     gene            <752375..>753304
                     /locus_tag="HG536_0A04140"
                     /db_xref="GeneID:59323693"
     mRNA            <752375..>753304
                     /locus_tag="HG536_0A04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281376.1"
                     /db_xref="GeneID:59323693"
     CDS             752375..753304
                     /locus_tag="HG536_0A04140"
                     /inference="similar to AA sequence:RefSeq:NP_012824.1"
                     /note="ancestral locus Anc_2.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137271.1"
                     /db_xref="GeneID:59323693"
                     /translation="MTEGKLPDLSTCLEFCLSAKKNLLFFYGKGPDKYGEIDVERQAN
                     AVKSLVEHRFSLNKITCRVTNQVAQRNEQQLSGTEICIFTGMETLDEHEQARLVQITA
                     HNQNLVLIAMVPWESRIEDGARNLDADKTLRSSINLRDWLKHRFWLACYDLHRSHSIP
                     SPIEIEDFKAIDAQVCCKHLIRRYILDIIVHIRMHRLLDITKGGGAHTGSLHDIEALA
                     KLISYYKFAKKFVTPDHVKMACIWYFPLHLELVRNASMDISVLYGSRPDMVDGFLEKI
                     AQLKVAQSNMAQNPLFLETLVVKDVLKKVVPPV"
     gene            <754323..>755945
                     /locus_tag="HG536_0A04150"
                     /db_xref="GeneID:59323694"
     mRNA            <754323..>755945
                     /locus_tag="HG536_0A04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281377.1"
                     /db_xref="GeneID:59323694"
     CDS             754323..755945
                     /locus_tag="HG536_0A04150"
                     /inference="similar to AA sequence:RefSeq:NP_012826.1"
                     /note="ancestral locus Anc_2.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137272.1"
                     /db_xref="GeneID:59323694"
                     /translation="MMKFTPAYLASLLALAQVIVAKSEEFGLVAFKPNADVHYSTVHS
                     KDGALYFGHNNKKPLTAWITECGLLKFSDESYASVTKHGTLEETTKCYASSGFFIKEG
                     KLAFKGKKEFWAHPKDFEYKVAVGDAKDAISLLIRAQGSSGYPIKDFYPNKEKCFEEE
                     KKDRENNKDDGCHKDRDHLKEKDDRDDRDHKDGKDGKKDKKDDDERREDKDDDERRKD
                     KDDDERRKDKDDDEHGKHKDDDEHREDSDDEDLDLDDVHKNHKKGKDYKKEKHYKKEK
                     SHRKEKNHRKEKNHRKEKNHKKEKDHKRVKHHDEEEDSDDDYSDYEDFKQDHKYKKFR
                     GHKNQKKHEDYDDEEYDDEDDYDDHRVNKDFKDRKNRNSHRDHKGYRKNMQHKENKEE
                     KERKEFKDHKDHKDQKSHKERKDHHNKKDNDESDDDFEEGMDFDHDKHFDHDKHFDHD
                     KHFDHDKHFDHDKHFDHDKDFDDDKDFDDVKDFDDDKDHKDDCTHKKGEEFDYKYPEL
                     EEETSWKNGANAISIGNGVGVGAFAALAALIM"
     gene            complement(756196..756269)
                     /locus_tag="HG536_0Atrna4V"
                     /db_xref="GeneID:59324270"
     tRNA            complement(756196..756269)
                     /locus_tag="HG536_0Atrna4V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59324270"
     gene            complement(<757351..>757986)
                     /locus_tag="HG536_0A04160"
                     /db_xref="GeneID:59323695"
     mRNA            complement(<757351..>757986)
                     /locus_tag="HG536_0A04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281378.1"
                     /db_xref="GeneID:59323695"
     CDS             complement(757351..757986)
                     /locus_tag="HG536_0A04160"
                     /inference="similar to AA sequence:RefSeq:NP_013794.1"
                     /note="similar to Saccharomyces cerevisiae VPS20
                     (YMR077C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137273.1"
                     /db_xref="GeneID:59323695"
                     /translation="MGQKGSKVQITENDRAILQLKRSRDEIHKFTRRTDLLISSERLK
                     LKEMIKENPTKCKSDPRVRFLLKRIHYQDHLLQQALEQLINLENLVSTLEFKLVETQF
                     IKGLERGNQILKKLNKEFENVDELMDDVQMQIAYQEEVDEVLAHSIVGVNDFETEIDK
                     ELDQMEREINPQQQIEMPSVDKLPDLKQRPIASSERKEQGKKEGTEAPVLA"
     gene            complement(<758192..>760429)
                     /locus_tag="HG536_0A04170"
                     /db_xref="GeneID:59323696"
     mRNA            complement(<758192..>760429)
                     /locus_tag="HG536_0A04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281379.1"
                     /db_xref="GeneID:59323696"
     CDS             complement(758192..760429)
                     /locus_tag="HG536_0A04170"
                     /inference="similar to AA sequence:RefSeq:NP_013795.1"
                     /note="ancestral locus Anc_2.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137274.1"
                     /db_xref="GeneID:59323696"
                     /translation="MEIVPEFGSLLGKSTFFHGGQTNSGSNTDQEASPAGQELTAALD
                     GDDGARIGTFVTSKGKVVKLRKKERGKVPRVAQYQLLGLGSDDKMTTWKGEESYGINI
                     NVLMDRVTNQPSKSDVDSQHRDEKPLPKDGDKLWVDKWSPKKFVDLVGNEKTNRRVLG
                     WIRQWSPCVFNEQLPERSMGRPEQDVADPLSRPAKKILLIHGPPGIGKTSVAHVAAKQ
                     AGYSVAEINASDERAGTLVRDKLHNTLFNNTFNDKPVCLIADEIDGSIESGFIRALLD
                     IINKDAQATQKQLLGSNFTVKRKKKKARLLLRPIIAVCNNLYAPALEKLKPHCEIVAV
                     KRPSDSSLQERLEEICRAEGVKVSVEALKDLMHIAQGDVRNCVNSLQFLATNKNFCAG
                     EFSDNPLNSISKDFSHSWFRICNQIFRRDPHKELQHQLREKMQLVELNGNFEKILQGC
                     HSLYPHVKYSDNGVEKPAIIADWLFYHDLMFKSLFEHNGELLRYSSVVPLAFFNLFGD
                     VANREDLRIENSEYELRETRKSNQDILKLMMHKISLRTPSLVPFLSFESLVLEVLPSL
                     DRLISSDVSKCRDAKVKQAVYDNLIDILRFFELELTERFHENYGSKKILFIEPPITEI
                     VLMDAQRRKEVISKRPALLDVLLAKVEENNARKKHITKINEDKARNEEIKNNAIKARK
                     SGLSMADFFKSQYKVEEGDRCDVSNKTGLAGSNSDKNFRIWVRYKEGFSDAVRKNVSW
                     HDLWS"
     gene            <761021..>761716
                     /locus_tag="HG536_0A04180"
                     /db_xref="GeneID:59323697"
     mRNA            <761021..>761716
                     /locus_tag="HG536_0A04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281380.1"
                     /db_xref="GeneID:59323697"
     CDS             761021..761716
                     /locus_tag="HG536_0A04180"
                     /inference="similar to AA sequence:RefSeq:NP_012832.1"
                     /note="ancestral locus Anc_2.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137275.1"
                     /db_xref="GeneID:59323697"
                     /translation="MFEACEKWRKEFGTNTILEDFHYEEKPLVARYYPQYYHKTDKDG
                     RPVYFEELGAVNLTEMYKITTQERMLKNLVWEYEAFVKYRLPACSRYCGHLVETSCTI
                     MDLKGISISSAYQVLSYVKEASYIGQNYYPERMGKFYLINAPFGFSTAFKLFKPFLDP
                     VTVSKIFIFGSSYKKDLLKQIPAENLPTKFGGQSEVSEAEGGLYLSDIGPWRDPKYVG
                     PEGEAPQAFSVKN"
     gene            <761962..>765042
                     /locus_tag="HG536_0A04190"
                     /db_xref="GeneID:59323698"
     mRNA            <761962..>765042
                     /locus_tag="HG536_0A04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281381.1"
                     /db_xref="GeneID:59323698"
     CDS             761962..765042
                     /locus_tag="HG536_0A04190"
                     /inference="similar to AA sequence:RefSeq:NP_012831.1"
                     /note="ancestral locus Anc_2.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137276.1"
                     /db_xref="GeneID:59323698"
                     /translation="MKYSRPAVSSSGFSTGQSFNVASFMRNVEEMQGTFDGTVQWCSD
                     LASENWKISHILVTEQGSLECQSDSKTRTTVSENSGNAIEIPRIDHLQGCKIHLIDKN
                     NNNVPIVQVITKSQTDYFLAKDNASFEGLLYSLIWWSSLNSKGIFNKISLRPAPVVES
                     SDGEAANLLVSQLVVYGPLPTRRIPVIKQLSRPSFLRKSRTEEGWFPAMGVLKSDGKL
                     DLLLQSDGSLLYSLDIRALLRSEIRLLDPSLQNDNMLFLGTISELRKELGLFKRQKFI
                     LGGPAVKNDPSIILKFPLSIDVEDWLVALKAFALAEYLSITGSHDSDRLRLSNRFKLS
                     IVEGNFPGISKASHGGLPQLYVELSIWDRTWGRTAIVQGTDVPFWREEFVFDESVKIN
                     NLTIEVKQRSQNKKDDETVGFVRITQEMINDMSLDKETRLPVLDSKKTRFNIGTICIR
                     IVSSLNFILPAVNFHRFESALNEVNLSQLVNSARSFSLGSDLAFEDIAGILLDVFQAL
                     HKEDDWFSALIDRELLELDGSITKNSLNNKTSTHIYGTLFRGNSILTRSMESYFYRVG
                     KEYLDLSIGPILRSIIDYEGSCEVDPERIKENDPVKKKAVLDENRGRLLAMVESIWIA
                     IYSTSNDIPMPIKNQMTTLRKKLEIICVDDGVTRILNCVSGMLFLRFFCPVILNPKLF
                     DLVRSHPSEQSRRTVTLVSKVLLNLSNLSCFGNKEPYMKGMNCFIDDHRDELLDYIDK
                     VTQKKLDFAPKKLKLTNSVIRPKLLMSEEILAELPINPHLIDRYLRETELSAALAICA
                     INKREIGKLPHTISLGQISKNAPGIKVPIDGRRTEISNLEFIEKTTSNVEISDQKPSK
                     HLEQNYETVVENNREVNADAQSEMMEQLERESVLLYHKVKHLKRLLADYEFPVRDSEK
                     RQMYAQFLTDNTYFSKSKQILIDSQHQLGEVEGASRLFKRADAVNLLDNIVPRVSSHS
                     SSSGSLSRSDSSFSVTRKLNRFKTQKVNNPDLRDSSDKESLHSNGSSIKRWFRR"
     gene            complement(<765111..>767888)
                     /locus_tag="HG536_0A04200"
                     /db_xref="GeneID:59323699"
     mRNA            complement(<765111..>767888)
                     /locus_tag="HG536_0A04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281382.1"
                     /db_xref="GeneID:59323699"
     CDS             complement(765111..767888)
                     /locus_tag="HG536_0A04200"
                     /inference="similar to AA sequence:RefSeq:NP_013797.1"
                     /note="ancestral locus Anc_2.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137277.1"
                     /db_xref="GeneID:59323699"
                     /translation="MSHENVLFEPETLPVDEFEEYELEDEALIVDAAIHSVSSQHACA
                     YCGIDSPTCVIKCNSCQKWFCNSKQGTASSHIVNHLVLSHHNVVSLHPDSDLGDTVLE
                     CYNCGCKNVFLLGFVSARGEAVVVLLCRIPCAQAKNANWDTDQWQPLIEDRQFLNWVA
                     EEPSDEQKLKAKLITPSQMSKLEAKWKSNKDATINDIDAPEEQEEIPPILLKYQDAYE
                     YQRSFGPLIKLEADYDRQLKESQALEHISVTWSLGLNNRHLASFALSTFESNELKVAV
                     GDEMFLRYSGLQHPEWEGRGYIIRLPNSMQDEFTLELKPSKNPPPTHLSTGFTAEFIW
                     KGTSYDRMQDALKKFALDKKSISGFLYYKILGHQIVDIQFDVPLPKEFSIKHFAQLNA
                     SQSHAVEHVLQRPLSLIQGPPGTGKTVTSATIVYHLSKLHHERILVCAPSNVAVDHLA
                     AKLRDLGLKVVRLTAKSREDVESSVSNLALHNLVARSSKGELKKLLKLKQEVGELSIG
                     DTKKFVKLVRKTESEILKKADVVCCTCVGAGDKRLDTKFRTVLIDESTQASEPESLIP
                     IVKGAKQIILVGDHQQLGPVILERKAGDVGLKQSLFERLISLGHVPIRLEVQYRMNPY
                     LSEFPSNMFYEGSLQNGVTIEQRTVSNSTFPWPIHEIPMMFWANYGREEISANGTSYL
                     NRIEAMNCERIITRLFKDGVKPEQIGVITPYEGQRAFVLQYMQMNGSLDRDLYLNVEV
                     ASVDAFQGREKDYIILSCVRANEQQIIGFLSDPRRLNVGLTRAKYGLVILGNPRALST
                     NVLWNHLLIHFREKGCLVEGSLNNLQLCTVQLTRNRPSKTSASRFSFNVDARGFSSDQ
                     DFDTQSLMSFGGQADPFNKAGLAAASELSSFLNNQMWNSDYQISSDKKKASTQEPETE
                     RLRKGIDSLNI"
     gene            complement(<768058..>768732)
                     /locus_tag="HG536_0A04210"
                     /db_xref="GeneID:59323700"
     mRNA            complement(<768058..>768732)
                     /locus_tag="HG536_0A04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281383.1"
                     /db_xref="GeneID:59323700"
     CDS             complement(768058..768732)
                     /locus_tag="HG536_0A04210"
                     /inference="similar to AA sequence:RefSeq:NP_012830.1"
                     /note="ancestral locus Anc_2.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137278.1"
                     /db_xref="GeneID:59323700"
                     /translation="MDIGIFERAVQDPCSEECDCEDDDPLHEEQEQEKEVNRCSCTRQ
                     DKPPKVGLQRAITTNSIIVSPRSTHILAHSRTAPSPMLSRPSRSRASSTSLIRHFSAS
                     EGDERPGPLSRRPSCPTNPSRSSCCGIPTHLYGLEKYVSSALDALSAGDYGFHRYGHT
                     TQEQGGAEAADLLSSSSSSSPSRASVSPSELCQSSASTVSRTQFAKRARKKSFIEISL
                     AKSFSQ"
     gene            complement(<769287..>770222)
                     /locus_tag="HG536_0A04220"
                     /db_xref="GeneID:59323701"
     mRNA            complement(<769287..>770222)
                     /locus_tag="HG536_0A04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281384.1"
                     /db_xref="GeneID:59323701"
     CDS             complement(769287..770222)
                     /locus_tag="HG536_0A04220"
                     /inference="similar to AA sequence:RefSeq:NP_012829.1"
                     /note="ancestral locus Anc_2.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137279.1"
                     /db_xref="GeneID:59323701"
                     /translation="MSHPYPYSCTTAIPEIQYEEYNGARFAYVYWPAATEQTKGCIFV
                     VHGFCEHTKLNNRLMDQLALKGYESFMFDQRGSGMTSPGRLRGLTNEKLVFDDLDHFL
                     LKNLERCAANDIPVFLFGHSMGGGIVLNYACHGTYRSRVAGFSTTGPLIELHASAKPM
                     WITEKLSPLLARCLPNMRIDTKLNLDGISSDPAYRAFLQHDRPLSTPLIGSLRQIYDF
                     LQRGKALLDEKYVKDHFTRDKPVLVIHGTRDTVNDPAASKRFIDHVCPAPDRTLKLVE
                     GARHSILSLEKDVFFNEAFDCFSAWLDQHVPASSA"
     gene            complement(<770322..>771101)
                     /locus_tag="HG536_0A04230"
                     /db_xref="GeneID:59323702"
     mRNA            complement(<770322..>771101)
                     /locus_tag="HG536_0A04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281385.1"
                     /db_xref="GeneID:59323702"
     CDS             complement(770322..771101)
                     /locus_tag="HG536_0A04230"
                     /inference="similar to AA sequence:RefSeq:NP_012828.1"
                     /note="ancestral locus Anc_2.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137280.1"
                     /db_xref="GeneID:59323702"
                     /translation="MSERKAVNKYYPPDFNPLEAEASLRKSAKKLKTKQRDVITIRLM
                     TPFSIRCTKCSEYIAKSRKFNGKKEVLPERYLETIKIYRLSIKCPRCNNMISFRTDPK
                     TSDFVMECGGVRNYSRVKDEDSRVESVDETLQRLVQETNESESERLSGKGEDKMEALE
                     RRLAQIQREQEDDQELERTRLSRLSMQQREQRLRDRNAAAVEENEQDLDKIAEEAFNR
                     RQDHGERLNAPFRKPQPKALIFKKRSKKVNPLGVIKKAAGP"
     gene            <771534..>774020
                     /locus_tag="HG536_0A04240"
                     /db_xref="GeneID:59323703"
     mRNA            <771534..>774020
                     /locus_tag="HG536_0A04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281386.1"
                     /db_xref="GeneID:59323703"
     CDS             771534..774020
                     /locus_tag="HG536_0A04240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137281.1"
                     /db_xref="GeneID:59323703"
                     /translation="MEESSLTFQRPQMEPPEAVKPPEEKPKRKRRKITKSCAFCRKRK
                     LRCDQKRPICSTCAVRGFTQCVYSNEPESNTNGSVAEADSGSHATFVDDLNKLQIEGE
                     AAGGEAVKIKTRYISYGANTNGPLHNLNSIYHISSTEDSLSHKRNILTDFCTLQSKDS
                     GRRICYGATAFKTFMGKYNWDLMQRFMQAWTKLKIIRRQLKKKKNFSMLKELCVAEEP
                     IQAADGSPTSLINDLVQHLPSREKVVSSLNHFFDSSQLFMMNSTLDKDKVFRDFEQGF
                     QSGDPRASDGEKPIVMLIVPPKKNYYKIGVIVMILALTYYRDELPSAVERFLIFLTGV
                     STAKGMYIERTQMLLLRCEYRWVYGHTGGDDSHLMLLVDNLISTATYLGLNRDIPTLY
                     GEQVEDVGSTESLQKLWYWILFADLDIALNLGRPLKVSLYDYDDEEMLSDHSKTFYGV
                     MKRFLKVVRPMFFDLHDRRITPDLSQHCETLIDFIEQEFPPISTYSPSTDTLDKGFLQ
                     TRILCLALEVLMAFYGLRFFALKEITPAVKNGAVKSVILSCSLCVNLILFCFELDKSS
                     FPELIGSDCQEPTPYLNACLSHIATAFVRCVGMVYALSYCEMTYFENGLLVLSGYDET
                     SQCDLSTLRSEGGRCTSFACYFKIACEKLDLLVASTDPILKRLLRRSRCYMIVLGLAT
                     VMRAVIERALESRTRAENSWLSSSCKHNLEGKIAVSRQIEFSTPFPERDATIADTDTS
                     NCPCGISRNDPNSAMTNDYIVDNLAVKTDTEIGPDGFPSGQPMMKLSDQMESEMTQLI
                     EEEFWGSYNLGWQELVENTDLESFFPDLVL"
     gene            <774129..>775517
                     /locus_tag="HG536_0A04250"
                     /db_xref="GeneID:59323704"
     mRNA            <774129..>775517
                     /locus_tag="HG536_0A04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281387.1"
                     /db_xref="GeneID:59323704"
     CDS             774129..775517
                     /locus_tag="HG536_0A04250"
                     /inference="similar to AA sequence:RefSeq:NP_012833.1"
                     /note="ancestral locus Anc_2.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137282.1"
                     /db_xref="GeneID:59323704"
                     /translation="MPKGQIDGLDHSKSKVNELCDVFPDKKRSEVINALESANGDLQN
                     ACTILLAESTGAGNSMLEDSPDPLQELELMFPDVDPSKIGTIYDRCQSIETAITELLS
                     LPLLRLEDDEEQKRAERQVQTSQSADSSGAAKEGTAWKSVSHKIKTIQRYTDVPDCVA
                     RQAFHECSFDITRAIIKLVWTTDYYGSAQATRMSNDDSKEQKPLQNPRGGKVQSAKGF
                     AHSTKNVFDKLDHETEITPQPRCSDDMYMFPESSAKFEELEEILQSNPTMRSISKAFL
                     KRALTFYRGNLSMTTSLALHIIEADLQSATYKSRVDFLDMEKGFKISAENFPRRQATS
                     SGPNKPSTFDPLELQNDEHYRKSQEMIAKIFDVPRLDFHGFTPKNAIIILEICLDKWW
                     MQELSEREMNRQKLSISRALNVVPLKVITGRGIHSVGGVSTLKIRVRRYLNDNNYLYS
                     EESAYFIIEGKK"
     gene            <775664..>777442
                     /locus_tag="HG536_0A04260"
                     /db_xref="GeneID:59323705"
     mRNA            <775664..>777442
                     /locus_tag="HG536_0A04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281388.1"
                     /db_xref="GeneID:59323705"
     CDS             775664..777442
                     /locus_tag="HG536_0A04260"
                     /inference="similar to AA sequence:RefSeq:NP_012834.1"
                     /note="ancestral locus Anc_2.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137283.1"
                     /db_xref="GeneID:59323705"
                     /translation="MDYMSLGIRSRKTGLNVKDNVKKDEYSMENIDDFFNDDDSSVAS
                     TRNKAGRRSTMLSIMSNNENFPSPAVESRRESLVLESKEFKVPSAVADSRRSTRLPQQ
                     YERNLGSSLPLGTIEEHRAGDYDAAEVGGTTPPAEREPLTYGYDDNSFRESPSIRLTP
                     QAEKTVTYNKPPDLIEDDEDTRDFTSLNTSENALLEDELDDDYVGESEEDGDYVEGES
                     ILQDGGSSTDTEDSSDDSDSASQDDESDTDRKRRAKSKNTRYGKRRGFDPDSPTEVYD
                     SDEEYIQSQAADLIGNGNFQRPEGVRRSSRVKVAPLEYWRNEKIVYKKKSDKPVLEID
                     KIITFDHDQDEEEERLLRGPKKQKKRTVRTRPYNYIPTGRPRGRPRKSKASLIKDLNP
                     NSDLLEEIRSGDVSAAEWLKFGILEAKVNISKNQMSDQIIAFAPNVSQSEQTKETGEE
                     FFSLEVLFDKHKDYFASGILKLPTKGKKKLSDSFNAFVTFFVIQGILEVQLAGKSFII
                     TEGSSFQIPAFNEYSFENKGNNEVKMFFVQVTIPTHRLEVEDDSATRSTTIEPNRFEN
                     SDQVEDEREEPQQGLTSSSNMSMSEI"
     gene            complement(<777638..>780292)
                     /locus_tag="HG536_0A04270"
                     /db_xref="GeneID:59323706"
     mRNA            complement(<777638..>780292)
                     /locus_tag="HG536_0A04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281389.1"
                     /db_xref="GeneID:59323706"
     CDS             complement(777638..780292)
                     /locus_tag="HG536_0A04270"
                     /inference="similar to AA sequence:RefSeq:NP_011856.1"
                     /note="ancestral locus Anc_2.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137284.1"
                     /db_xref="GeneID:59323706"
                     /translation="MSQADQEALRYSLTGEEDSQTDQKLVARDISSPRESNKDFELPR
                     APATLNMSALHEESSVKSSDDGLYRSMDPKRAQMEDKTQLTNSATLDDPIQFTRVSSS
                     SAISGISSFEYEEDQRHRGASRGKSQEEIAGEKLWAKEDGSSNNLNTVSGPDSFVVGD
                     NTNSTIRESTAEQQVSHTPNDTFTASESFIDSSTENLGSSSKTMLPSMYTTEPKKQVT
                     TPIMTSVNYQDVSGSVSGSSVLDKVNNSPLKPFITKRESTNSPKNVPTAISSPASASL
                     KNDNGKRKSSGGSRMKGVFSSFVQNIKRNSQSERTKSGNPVKISTPYNAKHLHHVGID
                     AKTGEYVGLPEEWEKMLMSSGISKKEQQQNMQAVVDIVKFYQDVAEASGEDKVFKTFN
                     PGTLGSNNFETPSLRTPSTSSVNRLESKSGSSTPDLGRHTPKFQQSFSSSTPQVNNIR
                     GSPAGNANQDMSSVASNGKFIPSRPAPKPPGQASKQGVLPNSSSQTSLPSRKATVKKD
                     EQPLPPLPSSESARELKTEKRDESALSPMPKTNNITTGKSRENSKKNHAALAEKKAEE
                     RERRTKQLYAKLSQICTEGDPSKIYLNLTKIGQGASGGVYTAYEVGTNASVAIKQMNL
                     EKQPKKELIINEILVMKGSKHENIVNFIDSYLLKGDLWVVMEYMEGGSLTDVVTHCIL
                     TEGQIGAVCRETLAGLQFLHSKGVIHRDIKSDNILLSMNGEIKLTDFGFCAQINEVNL
                     KRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA
                     TNGTPQLKEPDNLSPELRSFLAWCLKVDPEARASATELLQDVFISTCADENESLAPLV
                     KLARMKKIAEKMDSGDEHSGGEELREEL"
     gene            complement(<780810..>785153)
                     /locus_tag="HG536_0A04280"
                     /db_xref="GeneID:59323707"
     mRNA            complement(<780810..>785153)
                     /locus_tag="HG536_0A04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281390.1"
                     /db_xref="GeneID:59323707"
     CDS             complement(780810..785153)
                     /locus_tag="HG536_0A04280"
                     /inference="similar to AA sequence:RefSeq:NP_012915.3"
                     /note="ancestral locus Anc_2.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137285.1"
                     /db_xref="GeneID:59323707"
                     /translation="MEDMQHNDDQRSGSSDYVMEDDHSSTENRFSYQDEEDGTSSSSG
                     DYVDDEDADHTGLEDEIYIDEENEGEELASNNEDMGSDSSQEAARAFSVQGFLGNLAQ
                     TLSEGASPARNRSRQGPMSLSDVFPEILSVLNEGGQVGQTGRGGRSERIQRLVNNVAN
                     AVDDPYIAMESIRELSEHLLMMDQVIVERIFPIDKLVASIVGLISDRNLKNELELQLV
                     SCRCLYNLFEISPESMAVAVDQNVIPALQELLQEISYIDLAEQVLETLELISRVHPKD
                     ILRSGSLTSCLQYLDFFTIHAQRKAVAIVANACSRVQLQDFDTIKELLTILKPIFVNA
                     EDQVMIVKLLNSLYGICGGLRRDYMLEELFTVDVLTQILQLVATSETHLDCKLKCLEI
                     VTVLVSISSQLALEVIEKCDIARVISDCFGHYAKSSDAALHETLMFVPKPLLHSMARA
                     ISVLFPAEYEQILSVDTMKEAGLKINSDNLDKLLKNLTPLMVEIYVNAVDFEVRRYVL
                     IALARISSRLTPENIASVDGYMIRLASSALAQNQSLLEKENDKLLVVTGSIAGILSLL
                     DVLTARFAPEILPKLKREGIFSLLQILQSTLSKLKGEGQNSPIDNQESASSDRNDLND
                     QESEEEDDDSHGLQFGIIDIPDEAEPKRIKFNILRPLTLSYTYNKIFELSKNLLLLSE
                     GNEQTVIKELQEIEDVVKYLDSLKTETFSNQTWFDLWSNLKACIFSGSFEISSFEFVS
                     TGLATALARVVGEHGFKSSVPRKTFFEVFGPSSSKFVEILQSALTRIESFEIVDCGLA
                     GDEGRVASLGKQVKIKLLYDSDAQTDSVPEQLTNITISIHCISSFSALNEFLRHRIAQ
                     ARFLHSLLPNLSTPATFESETGAIENVKNWMFDFYNDDEKFKLSETIFGAIYKASKAG
                     GSPLSDIWHSVQTIKFKRADTHEIKEPMRVASIYRHRQDSERNCFKPAEDILTLLKFT
                     KISQLPNDIFINAKLSAKLSRQLEEPLVIASGILPAWSLQLTKDYNFIFPLETRLFFL
                     QCISFGYGRLVQMWRNRVESLKDSNADDTLQHLGRITRHKLRISRETMFLSGLKILDK
                     YGASPSVLEIEYQGEVGTGLGPTLEFYASISRDFTKKSLGMWRCEDYGGRGAENEERY
                     VTNPLFPAPLNPSKDNTRIVELFRYLGIFVARSMLDNRILDFCFSTLFFELAHRQCRM
                     TDGNRKINDVEEKLQLLRSIDPHLAKSLRYLRNGKDSTELEQMALTFTLPGFDIELKE
                     NGKQLLVTPDNVDEYVNRILDYTLHDGVQKQLESFIDGVSSVFPYSSLLLLTPEELVE
                     LHGRLEEDWSPQTLYASISADHGYSMGSSTIHELISIMSSFKTSDRRLFLQFLTGSPK
                     LPIGGFKGLKPRLTVVLKHPEDGRNPDAYLPSVMTCANYFKLPKYSSEEMMRSRIAQA
                     MNEGSNAFLLS"
     gene            <785487..>786203
                     /locus_tag="HG536_0A04290"
                     /db_xref="GeneID:59323708"
     mRNA            <785487..>786203
                     /locus_tag="HG536_0A04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281391.1"
                     /db_xref="GeneID:59323708"
     CDS             785487..786203
                     /locus_tag="HG536_0A04290"
                     /inference="similar to AA sequence:RefSeq:NP_012916.1"
                     /note="ancestral locus Anc_2.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137286.1"
                     /db_xref="GeneID:59323708"
                     /translation="MPRSKRSKLVTLAKTDKKGRENKERIFDEVREALDTYRYTWVLH
                     LDDVRTPVLQEIRTAWTGSKLILGKRKVLEKALGLHREDEYSDNLHKLTKYCGGVTGL
                     LFTDEDVKTVKEYFETYAKSDYSRPNSRAPLTFTIPAGIIYSRGGQIPTDEDIPMVHS
                     LEPTMRNKFQIPTKIKAGKITIESPYTVCKEGEKLDVRQALILKQFGIAEAQFKVKVA
                     AYYDKESSAVEKVGINMGEP"
     gene            complement(<786264..>786758)
                     /locus_tag="HG536_0A04300"
                     /db_xref="GeneID:59323709"
     mRNA            complement(<786264..>786758)
                     /locus_tag="HG536_0A04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281392.1"
                     /db_xref="GeneID:59323709"
     CDS             complement(786264..786758)
                     /locus_tag="HG536_0A04300"
                     /inference="similar to AA sequence:RefSeq:NP_011857.2"
                     /note="ancestral locus Anc_2.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137287.1"
                     /db_xref="GeneID:59323709"
                     /translation="MKIDEQISQLLLQEECGSRRKLTLILVVGDGPRNHIEHGLSSES
                     GKLSSVAAVAASRADVDVLFLSKLQYLFMYLMKFEAEEALTAIRYNYFVIYGLDQGIL
                     SAATTGEQSLGDRLRVANLICNAAFRIKRKHGLLDVRLIPWDDQSDTAERLARIERYW
                     RHIC"
     gene            <786962..>788218
                     /locus_tag="HG536_0A04310"
                     /db_xref="GeneID:59323710"
     mRNA            <786962..>788218
                     /locus_tag="HG536_0A04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281393.1"
                     /db_xref="GeneID:59323710"
     CDS             786962..788218
                     /locus_tag="HG536_0A04310"
                     /inference="similar to AA sequence:RefSeq:NP_011859.1"
                     /note="ancestral locus Anc_2.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137288.1"
                     /db_xref="GeneID:59323710"
                     /translation="MSAVISTRGVVPARILLRRLWKRSQSTSSTGTPTTNSHETEPVE
                     PPKAVENAGDAQKPIMDEVFSLRQKQFNDTIVEQLKILSQTNLDEVGELGVDLNEPLT
                     PKERQLDEELTDFLRKYSQSNKLINTDENVQDNPQRSIGITAAQNKKYPYLIPSARDK
                     PYTSQELFLRQMRHASHTAKLGAYIEKVYFPHKDIEDPPAAEKMSINKLLAAGVHLGQ
                     STSLWRPSTQPFIYGEYRGVHIIDLNKTLAYLRRASKVVEGIAERGGIVLFLGTREGQ
                     KRGLEEAAKRSHGFYISTRWIPGTLTNSTEISGVWERHEVDFADEPTGRVLTPDESLA
                     IVKPDLLVVLNPTENRNALNEAMQVRVPTIGIIDTDSEPSLVTYPIPGNDDSLRSVNL
                     LLGVLARAGERGVQNRLQKVAQANQA"
     gene            complement(<788367..>789623)
                     /locus_tag="HG536_0A04320"
                     /db_xref="GeneID:59323711"
     mRNA            complement(<788367..>789623)
                     /locus_tag="HG536_0A04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281394.1"
                     /db_xref="GeneID:59323711"
     CDS             complement(788367..789623)
                     /locus_tag="HG536_0A04320"
                     /inference="similar to AA sequence:RefSeq:NP_011860.1"
                     /note="ancestral locus Anc_2.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137289.1"
                     /db_xref="GeneID:59323711"
                     /translation="MSTPPLKPRSSGNNLTVRSRNRRTSSVGKIDLGDTVPGLGTMAE
                     SKESRDASNERMKALAKASENDMDLLRKFWLTYREMSYRHTWLTPLLILLVVYAAYFT
                     SGNRTESNPLHMFVAISYRIGETDMYGKGIKDLSFVFFYMIFFTFLREFLMECVIRPM
                     AIMLNVKSKHKIKRIMEQVYAVFYCGVSGPSGLYIMYHSDLWFFKTTPMYSTYPDLNN
                     HFHFKIFYLVQAAFWAQQACVLVLQLEKPRKDYKELVFHHIVTLLLIWSSYVFHFTKI
                     GLEVYITMDVSDFLLCLSKTCNYLDSAFTAPVFILFVVCWIFLRHYVNLRILWSVLTE
                     FRTEGNYVLNFATQQYKCWISLPIVFILISALQLVNLYWLALIARILYRMLWKGIQKD
                     ERSDSESDEENEEQEEAEAVKHEKAK"
     gene            <790868..>792256
                     /locus_tag="HG536_0A04330"
                     /db_xref="GeneID:59323712"
     mRNA            <790868..>792256
                     /locus_tag="HG536_0A04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281395.1"
                     /db_xref="GeneID:59323712"
     CDS             790868..792256
                     /locus_tag="HG536_0A04330"
                     /inference="similar to AA sequence:RefSeq:NP_011861.1"
                     /note="ancestral locus Anc_2.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137290.1"
                     /db_xref="GeneID:59323712"
                     /translation="MSVTSAILRATDGNLRADNWQYILEVCDRVQDDPEDGGEEAIEV
                     IEERLEQKDANVILRTLSLIVSLAENCGSRLKQLISSKRFTQKLQSLVENRSVHITVK
                     RELAKVVQQLSHSFTGDPSLRYMGDLLSLIASKYPHLLVSEQPDVPSKAEMSAESKQK
                     EDKELEEALKLSLVEYEQQQESQGRQQPRAERSVNGNENMQQNNSKDDDALPPGPTVV
                     KKVRAMYDLSSSEPDELSFKKGDVIVVLEQVYRDWWRGTLYGKVGIFPLNYVTPVKEP
                     TQLERELERQNENALLCQKANVDKLYYTLQRSKDSRDGDLTQDPAINDLYGTVTPLRP
                     QIAKSIGKYARKREDLASLREVLANAEATYNQLLDRATNAYTSPMPAQRYPTMDQPRK
                     GYAFSSEHTRDPHAWNGSAQSMSGSQRQNYGQSQHDQGYGHDYRKSQVPMQYGAQSSA
                     GQNVDPYNPNNN"
     gene            <792434..>793231
                     /locus_tag="HG536_0A04340"
                     /db_xref="GeneID:59323713"
     mRNA            <792434..>793231
                     /locus_tag="HG536_0A04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281396.1"
                     /db_xref="GeneID:59323713"
     CDS             792434..793231
                     /locus_tag="HG536_0A04340"
                     /inference="similar to AA sequence:RefSeq:NP_012918.1"
                     /note="ancestral locus Anc_2.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137291.1"
                     /db_xref="GeneID:59323713"
                     /translation="MSSTAFESIISQIISDSPSGEITEVWNDLIAIAGPSAKDAILDS
                     IEQYNIQNTVPVDIDGKSVIISSYNKEGSKFYDPVDHKLFSVDHLNRKGLDIEPYNST
                     TLNTFQQTILDGLQNYASTNFPGQVTLAVYPVVEEPAKVAIIIVSTKYNPSNFWNGDW
                     RSQYIYDSSSKELEGNIDVQAHYYEDGNVRFKSAKEVRVSNLDDVVKAIQEAEEDFER
                     NLDTSFSELNEKQFKTLRRKLPITRSKVNWGKAIGSYRLGKDAAQGN"
     gene            complement(<793242..>793602)
                     /locus_tag="HG536_0A04350"
                     /db_xref="GeneID:59323714"
     mRNA            complement(join(<793242..793499,793567..>793602))
                     /locus_tag="HG536_0A04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281397.1"
                     /db_xref="GeneID:59323714"
     CDS             complement(join(793242..793499,793567..793602))
                     /locus_tag="HG536_0A04350"
                     /inference="similar to AA sequence:RefSeq:NP_012919.3"
                     /note="ancestral locus Anc_2.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137292.1"
                     /db_xref="GeneID:59323714"
                     /translation="MSGSRYTQIENRNDQKLESLAGKLATFRNINQEIGDEAAADSSV
                     INQISNSFDSMVNNVRNSSSRLTRSMNAGNNVWRMVGLALLLFFIVYTLFKLF"
     gene            <794574..>795150
                     /locus_tag="HG536_0A04360"
                     /db_xref="GeneID:59323715"
     mRNA            join(<794574..794702,794863..>795150)
                     /locus_tag="HG536_0A04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281398.1"
                     /db_xref="GeneID:59323715"
     CDS             join(794574..794702,794863..795150)
                     /locus_tag="HG536_0A04360"
                     /inference="similar to AA sequence:RefSeq:NP_011862.1"
                     /note="ancestral locus Anc_2.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137293.1"
                     /db_xref="GeneID:59323715"
                     /translation="MSTDSTIKASNWRLVEVGRVVLVKKGQAAGKLAAIVEIIDQKKV
                     LIDGPESGVPRQAINLGQVVLTPLTFALPRGARTATVSKKWTAANLTEKWNATSWAKK
                     IAQRERRSALSDFERFQVMVLRKQKRYTVKKALAKA"
     gene            complement(<795327..>797036)
                     /locus_tag="HG536_0A04370"
                     /db_xref="GeneID:59323716"
     mRNA            complement(<795327..>797036)
                     /locus_tag="HG536_0A04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281399.1"
                     /db_xref="GeneID:59323716"
     CDS             complement(795327..797036)
                     /locus_tag="HG536_0A04370"
                     /inference="similar to AA sequence:RefSeq:NP_012921.3"
                     /note="ancestral locus Anc_2.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137294.1"
                     /db_xref="GeneID:59323716"
                     /translation="MSIRVSSRSTKGQNKHLQAMMEQEPGSYYKSRRSGEQHDDGGLK
                     AENGDGGNEDEGTVRCPVCGANDENYDAENDAYGDMVQCDGCNSWQHIRCMTNGEDNI
                     DRLLNADGTYFCDQCNPSKYTHLLEHGDKEYQLDDGADHEKPYENPDDNIDDDDDDED
                     VVSGKRQRSRQHQRRSVSSSAGNVSTKRRKSSTVSDEAEGDTRLRHNAVKMFKDLFSK
                     FIIPDTIEAKVYEQPSDVNDSEELADRMSKNLEKELYEACFDMESSRLNKFYPEKVRS
                     LFSNLKDKKNLILKTHVINGHIPLSKLARMNAQELANPDLQAFKEKIESQSLDQLIIE
                     QPDKPKWIKTHKGEELIEAQDEFQPEEDAFYSKHVISRHDESDANEVGTSKPKEIAFE
                     LPEQMEMTKESNKESQDGLIEVDLLYPDIDVEFSGLLKYLGASKELKNNPYMKAFGDA
                     HLSVEGRLSRGKVLSYLHEMQATRAFLLYELIPRRQEDIENSSAANYQKLYEFLTSHE
                     KIIGIKNKQRYEKNIYLIPSTIGDTCFAIESILEKNDSRGLLTHNIKKIFLLIVIKPE
                     LVF"
     gene            <797900..>799144
                     /locus_tag="HG536_0A04380"
                     /db_xref="GeneID:59323717"
     mRNA            <797900..>799144
                     /locus_tag="HG536_0A04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281400.1"
                     /db_xref="GeneID:59323717"
     CDS             797900..799144
                     /locus_tag="HG536_0A04380"
                     /inference="similar to AA sequence:RefSeq:NP_012922.1"
                     /note="ancestral locus Anc_2.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137295.1"
                     /db_xref="GeneID:59323717"
                     /translation="MNAVRNFFLSERPPYSHVADLETSFDPRVTLNKLQRYKPTVKDV
                     FHYTFLGSIFLFVFITNPAPWLYKVLVYSFLGLLFMIPITSQFFFNALPILTWVALYF
                     TSSYFPASHRPKITVKVLPAVETVLYGDNLSDILATSTNMFLDILAWIPYGLFHFGAP
                     FVVAIILFLFGPPTVLRGYAFAFGYMNLIGVIIQNTFPAAPPWYKILYGLESAHYGMH
                     GSPGGLARIDKLLGINLYTSGFTNSSVIFGAFPSLHSGCATMEALFFSYCFPKLKPIF
                     IVYVCWLWWSTMYLTHHYFIDLVAGSVLSYTIFQYTKYTHLPVDTSLFCRWSYADVET
                     YDVSKMNPLRADPNDVENVPLSNLELDFELNSMDEASRTSSIFDGPTSTSRSSATSNT
                     SLAEFQHDYASASPRLNKSRFD"
     gene            complement(<799494..>799883)
                     /locus_tag="HG536_0A04390"
                     /db_xref="GeneID:59323718"
     mRNA            complement(<799494..>799883)
                     /locus_tag="HG536_0A04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281401.1"
                     /db_xref="GeneID:59323718"
     CDS             complement(799494..799883)
                     /locus_tag="HG536_0A04390"
                     /inference="similar to AA sequence:RefSeq:NP_012923.3"
                     /note="ancestral locus Anc_2.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137296.1"
                     /db_xref="GeneID:59323718"
                     /translation="MLYELVGIVRVLSPSMPNKEAKDLVATIGKLVIQNRGVVRKILP
                     IGNKLLPKVMKKDQEQHFQGYHFLMLFDSSAAVQSEILRTLKNDPRVIRSSIIKVQND
                     KQLDMASSVERSLGYNSILEKVNRNFM"
     gene            <800149..>800915
                     /locus_tag="HG536_0A04395"
                     /db_xref="GeneID:59323719"
     mRNA            join(<800149..800208,800283..>800915)
                     /locus_tag="HG536_0A04395"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281402.1"
                     /db_xref="GeneID:59323719"
     CDS             join(800149..800208,800283..800915)
                     /locus_tag="HG536_0A04395"
                     /inference="similar to AA sequence:RefSeq:NP_012924.2"
                     /note="ancestral locus Anc_2.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137297.1"
                     /db_xref="GeneID:59323719"
                     /translation="MNVFQWAFGKSITPQERLKRNQRALERTQRELDREKRKLETQEK
                     KLVADIKGSAKNGQVAAAKVQAKDLVRTKNHIQKFDNMKTQLQAISLRIQAVRSSDQM
                     TRSMREATLLLAGMNRSMNLPQLQRISMEFEKQNDLMDQRQEFMDESIDNVMGDELDE
                     DEEAEEIVNKVLDEIGVDLNAQLHKAPQDVVVNSAVEPAQLAAERMDATGGNGPNSAD
                     DELQARLNSLKR"
     gene            complement(<800993..>801601)
                     /locus_tag="HG536_0A04400"
                     /db_xref="GeneID:59323720"
     mRNA            complement(<800993..>801601)
                     /locus_tag="HG536_0A04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281403.1"
                     /db_xref="GeneID:59323720"
     CDS             complement(800993..801601)
                     /locus_tag="HG536_0A04400"
                     /inference="similar to AA sequence:RefSeq:NP_012925.3"
                     /note="ancestral locus Anc_2.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137298.1"
                     /db_xref="GeneID:59323720"
                     /translation="MATNITWHPNLTYSERKALRNQEGCTIWLTGLSASGKSTIACAL
                     EQLLLQKGVAAYRLDGDNIRFGLNKDLGFSEKDRNENIRRISEVSKLFADSCTISITS
                     FISPYRIDRDGARELHKESGLKFIEVFVDVPLEVAEQRDPKGLYKKAREGIIKDFTGI
                     SAPYEAPENPEIHLRSDLKSIEECSATIYEYLLKEGLIRQDL"
     gene            complement(<802467..>804554)
                     /locus_tag="HG536_0A04410"
                     /db_xref="GeneID:59323721"
     mRNA            complement(<802467..>804554)
                     /locus_tag="HG536_0A04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281404.1"
                     /db_xref="GeneID:59323721"
     CDS             complement(802467..804554)
                     /locus_tag="HG536_0A04410"
                     /inference="similar to AA sequence:RefSeq:NP_012926.1"
                     /note="ancestral locus Anc_2.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137299.1"
                     /db_xref="GeneID:59323721"
                     /translation="MDEHLISTINKLQDALAPLGGGSQSPIDLPQITVVGSQSSGKSS
                     VLENIVGRDFLPRGTGIVTRRPLVLQLVNRRVKKDSHNVDSAANELIDLHVSDDKANN
                     KSQSEDNAEEWGEFLHLPGKKFYNFDEIRQEIVRETDKLTGPNSGISPIPINLRIYSP
                     HILTLTLVDLPGLTKVPVGDQPPDIEKQIKDMLLKYISKPNSIILSVNAANTDLANSD
                     GLKLAREVDPEGMRTIGVLTKVDLMDQGTDVIDILAGRVIPLRYGYIPVINRGQKDIE
                     RKKTIRDALKDERSFFENHPSYSSKAHYCGTPYLAKKLNSILLHHIRQTLPDIKAKIE
                     ATLKKYQNELFNLGPESMDSPSSVVLSMITDFSNEYAGILDGEAKELSSQELSGGARI
                     SFVFHEVFKNGIDALDPFDQIKDSDIRTIMYNSSGSAPSLFVGTEAFEVLVKQQIRRC
                     EEPSLRLVSLVFDELVRMLKQIISQTKYARYPALREAISNQFIEFLKEAIVATNEFVV
                     DIISSEQTYINTAHPDLLKGSQAMAMVEERLHPRQPALDPKTGKPIQGQPPSAKTAAA
                     EEKSGFFGGFFSTKNKKKLAALESPPPVLKATGQMTERETLETEVIKLLISSYFSIVK
                     RTVADIIPKALMLKLIVKSKKDIQKVLLEKLYGNQDINELTKENEITIQRRKECKKMV
                     EILRHASDIVSSV"
     gene            <805123..>806877
                     /locus_tag="HG536_0A04420"
                     /db_xref="GeneID:59323722"
     mRNA            <805123..>806877
                     /locus_tag="HG536_0A04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281405.1"
                     /db_xref="GeneID:59323722"
     CDS             805123..806877
                     /locus_tag="HG536_0A04420"
                     /inference="similar to AA sequence:RefSeq:NP_012927.3"
                     /note="ancestral locus Anc_2.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137300.1"
                     /db_xref="GeneID:59323722"
                     /translation="MNYQKVYGITGPVSTAGSTAAENKLNDELIQELKKEGSFETEQE
                     TENRVKVLKILQELAEEFVFKVSKNKNMSDGMAKDAGGKIFTFGSYRLGVHGPGSDID
                     TLVVVPKHVMREDFFTVFDGLLRARPELEEIAPVPDAFVPIIKIKFGGISIDLICARL
                     DVAQIPRSLTLSDKNLLRNLDEKDLRALNGTRVTDEILELVPKPIVFRIALRAIKLWA
                     QRRAIYANVFGFPGGVAWAMLVARICQLYPNACSAVILHRFFKILSEWKWPQPVVLKP
                     IEDGPLQVRVWNPKIYAQDRSHRMPVITPAYPSMCATHNITDSTKRVILEELERGVQI
                     TNDIFTSKLKWTDLFTKHNFFYKYKFYLTIMAATKGTDEQHLKWSGMVESKVRLLVLK
                     LEAMAGIKLAHPYTKPFEAAYYYTTDEERQKIVDSCGTYKTEDDLKQFRRVTDDSRND
                     PDFKDKPIVYITTMYIGLDVSVEDKKEKIDIHVPCNEFFNLCRNFDDQYQNSDTYSLV
                     IKYVKQYDLASDVYEEGETRPVKKKSKRKKLEKASATSKRPKSVVSESKEADGGANSA
                     EQRDSDRAQSSSAEVTKA"
     gene            <807222..>808544
                     /locus_tag="HG536_0A04430"
                     /db_xref="GeneID:59323723"
     mRNA            <807222..>808544
                     /locus_tag="HG536_0A04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281406.1"
                     /db_xref="GeneID:59323723"
     CDS             807222..808544
                     /locus_tag="HG536_0A04430"
                     /inference="similar to AA sequence:RefSeq:NP_011863.1"
                     /note="ancestral locus Anc_2.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137301.1"
                     /db_xref="GeneID:59323723"
                     /translation="MMPLSKLKAMSVHGSSASSLSKDLYSDGPVDTDDLDENDESGQN
                     ILLNIISQLKPGCDLSRITLPTFILEKKSMLERITNQLQFPDLILDAHNEKDKLQRFV
                     KVVKWYLAGWHIAPKAVKKPLNPVLGEHFTCYWDLPNKQQAFYIAEQTSHHPPESAYF
                     YMIPESRIRVDGVCIPKSRFLGNSTAAMMAGLTVLQFLDLTDSNGKPEKYTLSQPNMY
                     ARGILFGKMRIELGDHMIIKSPDYEIDIDFKTKGFISGTYDAIAGTVKDKNGKEYYEI
                     TGKWNDVMYIKDLTDKNSRKTILFDTHKSKVSKPKVRPLNEQGEYESRRLWKKVIEAL
                     AARDHEVATEEKYKIESYQRELAKKRVEDGVEFHPKLFRRAKPEEDLDYYIYRKIPNG
                     EDYEEQIKSILEIAPILPGQQFTEKFAIPAHKKSQLQEKELSKTSRLE"
     gene            complement(<808610..>809026)
                     /locus_tag="HG536_0A04440"
                     /db_xref="GeneID:59323724"
     mRNA            complement(<808610..>809026)
                     /locus_tag="HG536_0A04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281407.1"
                     /db_xref="GeneID:59323724"
     CDS             complement(808610..809026)
                     /locus_tag="HG536_0A04440"
                     /inference="similar to AA sequence:RefSeq:NP_012929.4"
                     /note="ancestral locus Anc_2.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137302.1"
                     /db_xref="GeneID:59323724"
                     /translation="MVCQQRRKLENNYTDYERLRKLLQLPENDTKEPDWLYLKIERYV
                     TKIIQTIDSAVAEEWPPYFCLVEILKEVPEAADLSTFSTWRTNLHNFEEKYGTISLIR
                     NHPVVPPNLSGNALLSRNARHYGLKKLFLLKIRNCN"
     gene            complement(<810184..>810975)
                     /locus_tag="HG536_0A04450"
                     /db_xref="GeneID:59323725"
     mRNA            complement(<810184..>810975)
                     /locus_tag="HG536_0A04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281408.1"
                     /db_xref="GeneID:59323725"
     CDS             complement(810184..810975)
                     /locus_tag="HG536_0A04450"
                     /inference="similar to AA sequence:RefSeq:NP_012931.4"
                     /note="ancestral locus Anc_2.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137303.1"
                     /db_xref="GeneID:59323725"
                     /translation="MNLTGISHRFYVSCTVKNGSLPLARSLHTTHISSDFFSWFKARK
                     AEENEAKVPTKATTELIKEIESGKKSKSVANTQKLKLTSENFIGKEPGQLDRAEHQRL
                     VREAKFNNWISKDIVSSERRLDELLIESYNESYPGDKISASSDAKLDAKFPDLVTKFK
                     FTKFLQAKSGCMISDYKLTILNRPSQYKEFFMDEILSGKQARYKEAEPHAIHLTQERF
                     SSPNIYVVPDVDVKSQNKNYRKIMQEVRLSEAEISRRAMEDAARS"
     gene            <811227..>811715
                     /locus_tag="HG536_0A04460"
                     /db_xref="GeneID:59323726"
     mRNA            <811227..>811715
                     /locus_tag="HG536_0A04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281409.1"
                     /db_xref="GeneID:59323726"
     CDS             811227..811715
                     /locus_tag="HG536_0A04460"
                     /inference="similar to AA sequence:RefSeq:NP_012932.1"
                     /note="ancestral locus Anc_2.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137304.1"
                     /db_xref="GeneID:59323726"
                     /translation="MGLILSCCREGELDENEALLASQQNGYGAHEDYNALQQQMKEHE
                     ERLRARENTLKEIVTNTNDKLIDISMISNSGIVIQGTDLKNPDPDALENASGSTTRDN
                     QEHTPEQNRSSKSNFVPLDTKTAMSQEMKKHLKLLHQTIFETLDDELRVEPRGQLIVT
                     LY"
     gene            <811919..>813589
                     /locus_tag="HG536_0A04470"
                     /db_xref="GeneID:59323727"
     mRNA            <811919..>813589
                     /locus_tag="HG536_0A04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281410.1"
                     /db_xref="GeneID:59323727"
     CDS             811919..813589
                     /locus_tag="HG536_0A04470"
                     /inference="similar to AA sequence:RefSeq:NP_012933.4"
                     /note="ancestral locus Anc_2.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137305.1"
                     /db_xref="GeneID:59323727"
                     /translation="MPVKKRKAPEEEEEKVVKYVAGKQPRTGDLPNVDYNIPLYPESE
                     LYQDDWVIPKFNLFISFTLNYLIESYKTVFKDFIKLPSRKFHPQYYYKIQQPISINEI
                     KSRDYEFPDGSHTFLLDVELLAKNCASYNEPDSLIVKNSIQMVQYIEYEVLKAKNVTR
                     NYLISDDVRPRLLNYLDRVIDATDKDIELEYGATKTDADGTMKISEPFMHLVEKDELP
                     DYYEVIHRPSALAPVKQNLEVGYYAKIYDFIIDTQLVFQNALVFNDSTTLIYQDAQKL
                     LRYFNHLIQYRFFPELRDVSERGEIKLEYDKVEYEQYLANGGNDQTEEVSKDDDEADY
                     DFNHLEGLGNGYNRAILSEDYLLGPNKLEMQNKKQKLSTPIEEPPRVLKYNILASMQK
                     EMTSEEHTMQRVPYDLVKQVCIYSSKNLYRQATTPAMGGKPSCNQNWVEFIFCGDQLS
                     QNENMFSLTLQPVQTFLTLTATMNDKKAVTSLTVNKENINSERATLNSMKQQQDNNRE
                     KTELQEDNAGSEKFDIRLNEGLNYVEFKCEQPESEKKEVMRFWINILP"
     gene            <813722..>814999
                     /locus_tag="HG536_0A04480"
                     /db_xref="GeneID:59323728"
     mRNA            <813722..>814999
                     /locus_tag="HG536_0A04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281411.1"
                     /db_xref="GeneID:59323728"
     CDS             813722..814999
                     /locus_tag="HG536_0A04480"
                     /note="ancestral locus Anc_2.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137306.1"
                     /db_xref="GeneID:59323728"
                     /translation="MKEQANGFNPEHCRVYGKLFGPMNRVLVNLGGWRRLAHRRYLRL
                     LVAVAILSPLIFYCLHGSSILSENDLNENQGLQSVDVGRPKIYESTSGKGNDILLTLV
                     RNSELIDMIDTIERFERSFNSKYHYQWWFMNDEEFTEKFKEEVSSRVSGGARFIKVPG
                     EMWTYPANIDKEKAAASREDYSKKKVMYGESESYRFMCRFNSGLFYKLNELRDVEYYW
                     RIEPGVHFDCGITYDVFQYMRQNNKLYAFNMALQEDVRTIPSLWNTTIEFFKKNPQYL
                     ADKNNAEFVTDDGGSSYNLCHFWSNFEIANLRFYRSDAYDKYFQYLDDKGGFFYERWG
                     DAPVHTLAASFMLPVDSLHFVANTGYMHNPNQDCPVDEEVRDILHCDCNPRKDFTWHK
                     WSCVSKFFDVNNYPRPTSVANLKEYYPYVLENT"
     gene            <815313..>815641
                     /locus_tag="HG536_0A04490"
                     /db_xref="GeneID:59323729"
     mRNA            join(<815313..815321,815414..>815641)
                     /locus_tag="HG536_0A04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281412.1"
                     /db_xref="GeneID:59323729"
     CDS             join(815313..815321,815414..815641)
                     /locus_tag="HG536_0A04490"
                     /inference="similar to AA sequence:RefSeq:NP_011864.1"
                     /note="ancestral locus Anc_2.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137307.1"
                     /db_xref="GeneID:59323729"
                     /translation="MVSYISKLATKTAPHFGRVNSSNLMSYIPNLAIWGAASTAGLFV
                     FTAGWPTFQDTFYKKIPILGSYWEKEIPPEDRIN"
     gene            complement(<815850..>818558)
                     /locus_tag="HG536_0A04500"
                     /db_xref="GeneID:59323730"
     mRNA            complement(<815850..>818558)
                     /locus_tag="HG536_0A04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281413.1"
                     /db_xref="GeneID:59323730"
     CDS             complement(815850..818558)
                     /locus_tag="HG536_0A04500"
                     /inference="similar to AA sequence:RefSeq:NP_012934.1"
                     /note="ancestral locus Anc_2.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137308.1"
                     /db_xref="GeneID:59323730"
                     /translation="MSGEKLEFKDRVVVVTGAGGGLGKVYALEYAKRGAKVVVNDLGG
                     SLGGSGGSTRAADVVVEEIKKNGGVAVANYDSVNEHGEKIIQTAIDNFGRIDVLINNA
                     GILRDVSFAKMSAKEFGSVVDVHLNGGYKLCKAAWPHMLSQKFGRIINTASPAGLYGN
                     FGQANYSAAKLGLVGMAETLAKEGYKYNIRVNAIAPLARSRMTENVLPPHILKQLGPE
                     KIVPLVLFLTHESTQVTNSIFELAAGFYGQIRWERSSGQIFNPNPETFTPEAILNKWE
                     SITDFRDKSFNKVQHPVQLSDYNDLITKAKKLPAQNDQGSVKIESLRGKVVIITGAGG
                     GLGKSHAVWFARYGAKVIVNDIRNADVSASDINKQFGDGTAIPDAHNIVTEAPQIIEN
                     ALKNFGRVDVLVNNAGILRDRSFKKMTDDEWFAVIEVHLYATFAMCKAVWPVFLKQKS
                     GYIINTSSTSGIYGNFGQTNYAAAKAAILGLSRTLAIEGGRKGIKVNIIAPHAETAMT
                     KTIFTEKELVNHFEPSQVSPFVVLLASEELQRKGGGKGVNGQLFEVGGGWCGQTRWQR
                     SEGFTAVTDSIEPEVIKNNWKQITNFESGTINPSTTEESSMAILQAVQQAQSSKSSKD
                     IFRYTERDCILYNLGLGATSQELQLTYENDPNFHVLPSFAVIPFMTSIRALNMNKLVE
                     NFNFAMLLHGEQYFRLGEYPLPTKGSLKTVAKPLQILNKGGKAAIIVGGFETYDVKTK
                     KLLAYNEGSFFIRGARTPGGKQIIKGERAKFAVQKFEAPDRKPDFEIEVATHKDQAAL
                     YRLSGDYNPLHIDPNLAKAVRFPRPILHGLCTLGVSAKALLDKFGPYSELKVRFTNVV
                     FPGDKLKVKAWKQPNGIVIFQTVDLDRDVVVLNNCAIKLVGSDSKL"
     gene            complement(<818815..>820323)
                     /locus_tag="HG536_0A04510"
                     /db_xref="GeneID:59323731"
     mRNA            complement(<818815..>820323)
                     /locus_tag="HG536_0A04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281414.1"
                     /db_xref="GeneID:59323731"
     CDS             complement(818815..820323)
                     /locus_tag="HG536_0A04510"
                     /inference="similar to AA sequence:RefSeq:NP_009847.4"
                     /note="ancestral locus Anc_2.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137309.1"
                     /db_xref="GeneID:59323731"
                     /translation="MFIAFYITDSKYSLVFQYLLSSKSPSFEHLRTKVQEVCPKLMSD
                     ANTTESGTRTNDGNGNLNAVRQPVGKNLELYKYYSSTNKLYYFCLTSACSSGSKCSPF
                     VFMEDMDRLFLEYFDKDQLTASKIKNNYDRITMIFYVCVSGGVPAAGKLYSNSVKKVV
                     PVRSDLSKIITSTAHTLQVAVQRQGQQHGERFGNKQSRFETDSSLESEMVPWRSAGLK
                     YTNNEFYVDMTEEIHVTYQKSRKTSGSNLRFDSSKMTMVCGTINGRATVRCYLSDTPS
                     VELQLDLAGNDMGVPALHNCIENKTDLSNLKFIPPDGKFSLIQYSIDLDQVSQSRRYN
                     SCVGLITLDFKDQLGTKKDEFELTVNIANSREVESIQDLCIGLELQPPTDNNSQNRDT
                     TQDSEFKIKVLRNTHGRFDNSVVSGKGAWIFDKDTPTGSLPVLRGCVENSTGLSCDAK
                     VQRVSLSYTHTGQLISGIRVKAININSQGTTGTKPFKGVKYMTTTGDYEIRS"
     gene            <820841..>823234
                     /locus_tag="HG536_0A04520"
                     /db_xref="GeneID:59323732"
     mRNA            <820841..>823234
                     /locus_tag="HG536_0A04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281415.1"
                     /db_xref="GeneID:59323732"
     CDS             820841..823234
                     /locus_tag="HG536_0A04520"
                     /inference="similar to AA sequence:RefSeq:NP_009848.4"
                     /note="ancestral locus Anc_2.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137310.1"
                     /db_xref="GeneID:59323732"
                     /translation="MNVDNGGNDQNVASEQSNGVTDSNPFSNIGTPSFNLSQIPRNVL
                     QNLTPAQVQMIQQRHRQLLMNRIQQQTSFTPPVQQSQPQTKASEQAQAEARARAQAQA
                     LAEAQTQARAQAQMQASQHLPQQRTQPLPGQQMSMSRNIPTNQPLDGGAAAQHAGMSR
                     SSGGDSGSPQAPINLPPQIAQLPLPMQQQVLSHLKQQAIAKNNPAVVAAVTVAQQQLQ
                     QQLQQQQQQQHSRVPLPQPHESPASAQVQGQQNVPTQHALGSQIHQQQMPVVSGAPTD
                     GQAFHLSQQNMNLPNAGPLPAMPKFDLPKYQTIKFDPPETKLPHPTFWSEQQPSTDTL
                     LYEQIIQRDKANKLDLAKETNGYEPFSIYGFSNKEYLGKLWHTLKYYQELKATRMKSI
                     TNTSQNIPSASIWGDGYSGYGNGVTNSLSQVIPETLIDGRSQFYQDRLKIYEQAMNEE
                     SEELVPIRFEFDQERDKFFLRDTLLWNKHDSILKIEDFVDDMVRDYRYAPISRDQIAE
                     TISQTMKEQVAEYQSDPYLDLNQERPGGDDMRIKIKIDIVVGQHQLIDQFEWDISNTE
                     NCPEEFAESVCQELSLPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSVIDDDDIRS
                     RMLPLITIDDVFRAPSEAKLYTPNLLQISAAELERLDKDKDRDARRKRRQGRSGRRGV
                     VVVGNGGGSNSAIASTGAGGPSGANGTIEVSLPDVADIPRTFRTPIPSTILPGAIDLG
                     PSVGSYDLSTTTEYKPRPIMPPAELQPCHIIDHIPGSSLLLCIKLPKSTRIEAEDLN"
     gene            <823557..>824468
                     /locus_tag="HG536_0A04530"
                     /db_xref="GeneID:59323733"
     mRNA            <823557..>824468
                     /locus_tag="HG536_0A04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281416.1"
                     /db_xref="GeneID:59323733"
     CDS             823557..824468
                     /locus_tag="HG536_0A04530"
                     /inference="similar to AA sequence:RefSeq:NP_009849.1"
                     /note="ancestral locus Anc_2.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137311.1"
                     /db_xref="GeneID:59323733"
                     /translation="MAGEGSSQSQIVGNSRSMIDAEVQGASTQDASIASVAEDEDVQL
                     GEETGRFFPLLLRNRVAKHTRAVGRHFNVLDRLFKRNRRQVIHLQQGASYDGVFSNLS
                     AKPDINNDATTGSEDNPPTYDEAAVDMAPSYYGVDEDGSGMYYNEICIEGLPVGNLAN
                     LIWNMVVSSSFQFIGFLITYILHTSHAAKQGSRFGLGLTFMGYAYSMSPNDVLSKVGK
                     DKQVDRVKLSDPTDHDDLHLYSSPTVQDDFEPKLAPGAHPQKQELPLLAVFTGLLGIF
                     IMLKSLYDYVQIKKMERKFLSQEQSSP"
     gene            complement(<824577..>825470)
                     /locus_tag="HG536_0A04540"
                     /db_xref="GeneID:59323734"
     mRNA            complement(<824577..>825470)
                     /locus_tag="HG536_0A04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281417.1"
                     /db_xref="GeneID:59323734"
     CDS             complement(824577..825470)
                     /locus_tag="HG536_0A04540"
                     /inference="similar to AA sequence:RefSeq:NP_009850.1"
                     /note="ancestral locus Anc_2.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137312.1"
                     /db_xref="GeneID:59323734"
                     /translation="MSSQKRQVDPAKSFLAGSLAGAAEACITYPFEFAKTRLQLVDKA
                     SKATRNPLVLIYNTAKVQGIGSIYVGCPAFIVGNTAKAGVRFLGFDMIKNLLRDPQTG
                     ELSGPRGVIAGLGAGLLESVVAVTPFEAIKTGLIDDKQSANPKYHNNGRGMLRNYGSL
                     IRDKGVRGLYNGVLPVSMRQAANQAVRLGCYNKIKIMVQDYTGSPKDQPLSSGLTFIV
                     GAFSGIVTVYTTMPLDTVKTRMQSLNASEYTSTLNCFARIFKEEGVKTFWKGTTPRLG
                     RLILSGGIVFTIYEKVLDVLG"
     gene            <826130..>827212
                     /locus_tag="HG536_0A04550"
                     /db_xref="GeneID:59323735"
     mRNA            <826130..>827212
                     /locus_tag="HG536_0A04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281418.1"
                     /db_xref="GeneID:59323735"
     CDS             826130..827212
                     /locus_tag="HG536_0A04550"
                     /inference="similar to AA sequence:RefSeq:NP_011865.1"
                     /note="ancestral locus Anc_2.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137313.1"
                     /db_xref="GeneID:59323735"
                     /translation="MAGAHESANVRAKVVCERDMTRQGAVAIDKNSMDYIMRSAVAGG
                     ISGSCAKTLIAPLDRIKILFQTSNPHYTKYAGSLVGLVEAAKHIRINDGLRGFFQGHS
                     VTLIRIFPYAAVKFVAYEQIRNVLIPSKDYEVHWRRLVSGSLAGLCSVFLTYPLDLIR
                     VRLAYVTEHKKVKLGKIVRTIWEEPVSATLAKKWYVPLWFAHWSNFYRGYIPTVLGMI
                     PYAGVSFFAHDYMHDLLRVPVLAPYSVVSLSEEEESRRSQKRQRVPLKTWAELVSGGL
                     AGMASQTAAYPFEIIRRRLQVSALSPRTMYDHKFQSITEITKIIYKERGWRGFFVGLS
                     IGYIKVTPMVACSFFVYERMKWHLGI"
     gene            complement(<827364..>828683)
                     /locus_tag="HG536_0A04560"
                     /db_xref="GeneID:59323736"
     mRNA            complement(<827364..>828683)
                     /locus_tag="HG536_0A04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281419.1"
                     /db_xref="GeneID:59323736"
     CDS             complement(827364..828683)
                     /locus_tag="HG536_0A04560"
                     /inference="similar to AA sequence:RefSeq:NP_011866.1"
                     /note="ancestral locus Anc_2.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137314.1"
                     /db_xref="GeneID:59323736"
                     /translation="MSSWKEQWKLIAVTAICAAAATKCLDVALKLRSDDDSAAKAKIL
                     KALETNEYDDSLFREQLARNYAFLGEEGMEKLKQQYFVVVGAGGVGSWVVTMLVRSGC
                     RRIRVIDFDQVSLSSLNRHSCAQLSDVGTPKVDCLKQHLLRIAPWCEIEAINELWTKE
                     NAERLLLEDGEPTMIIDCIDNIDTKVDLLEFAYNRKIEVISSMGASTKSDPTRINVGD
                     LTTTEEDPLARSVRRRLKKRGITTGIPAVFSAEKPDPRKAKLLPLPDEEYEKGQVGEL
                     SALKDFRVRILPVLGTMPGIFGLTIATWILTKVSGYPMNPIEGKNRIKIYDGIYQSLA
                     GQMTRIGMPDQRVPIALKEVSYIVEEVFRGKSPVSGFSTRLTLSKWDPKKPVSLQNVV
                     VLTKEEQKIHEDRVLNGGEPLEKVYPKQILDLVNKRFQEEEYYSQFR"
     gene            complement(<828886..>830247)
                     /locus_tag="HG536_0A04570"
                     /db_xref="GeneID:59323737"
     mRNA            complement(<828886..>830247)
                     /locus_tag="HG536_0A04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281420.1"
                     /db_xref="GeneID:59323737"
     CDS             complement(828886..830247)
                     /locus_tag="HG536_0A04570"
                     /inference="similar to AA sequence:RefSeq:NP_012897.3"
                     /note="ancestral locus Anc_2.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137315.1"
                     /db_xref="GeneID:59323737"
                     /translation="MDRPIDEIVKNLLKFVVRGFYGGSYILVLDAVLFHSVLAEEDLK
                     QLLGINKTDLGPLVARLRSDGLLSMHKQREYPPNSKSVERAYFYIKFPHAIDAIKWKV
                     HQVVQRLKDDLDKNSAPNGYMCPICSTKYTQLEAVQLLNYDRTEFLCSLCNEPLVEDD
                     SGKKNKEKQDRLNRLMDQVQPIIDYLKKIDDSRIEENTFEIALARLIPPQNQSRAAYT
                     YNPKKGSTMFRPGDSSMGVGMDGSSLGNDSSRRAGANSQATLHVNITTASDEIAQRAL
                     QERQAEEKRKQNAVPEWHKQSTIGKSALGRLDEDEEFDPRTTAQANMSLEETNGGVKQ
                     EMGIDEFYHKHRPLTEQELEERENERTLNEYYASLAKKQAEAKEEDEDEDEEDEDEDE
                     AAYDDEFEDVVDQNEKQVNQAANGAVTLEDGQQSNKMQETSPSNNIEDDEDDDMDIEF
                     EDV"
     gene            <831297..>833264
                     /locus_tag="HG536_0A04580"
                     /db_xref="GeneID:59323738"
     mRNA            <831297..>833264
                     /locus_tag="HG536_0A04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281421.1"
                     /db_xref="GeneID:59323738"
     CDS             831297..833264
                     /locus_tag="HG536_0A04580"
                     /inference="similar to AA sequence:RefSeq:NP_012896.1"
                     /note="ancestral locus Anc_2.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137316.1"
                     /db_xref="GeneID:59323738"
                     /translation="MMMRSRASIDVAQIIARHSRGRLYARLYSSSTKPTLATTTRDTT
                     FQKTYDDANVQKIPVGSTAKKLFGKPKKTRLSVDGPIECPLESFQLLNSPLFNKGSAF
                     TQEEREAFNLDALLPPQVNTLDEQVERAYKQLCYLKTPLAKNDFMTSMRVQNKVLYFA
                     LVRKHIRELVPIIYTPTEGDAIAAYSHRFRRPEGIFLDITEPQSVERRMAVYGGDKDV
                     DYIVVSDSEGILGIGDQGIGGIRIAISKLALMTLCGGIHPGRVMPVCLDVGTNNKKLA
                     RDELYMGNRFSRVRGKQYDELVDKFIQAVKKRFPNAVLHFEDFGVKNARRILDKYRSE
                     LPCFNDDIQGTGAVVMASLIAALKHTKRDLKDTTVIVYGAGSAGLGIADQIVSHMVTH
                     GLSKEEARSKIYLMDRRGLITQSLEAGSTKAQHLYAKPDEDWAGVNTRSLLDVVSRVK
                     PTCLIGCSTQAGAFNKSIVQEMYKHNPRPIIFPLSNPTRLHEAVPEDLLNWTDNNALV
                     ATGSPFPPVNGYRISENNNCFSFPGIGLGAVLSRAKIISDTMISAAVDQLAALSPLEE
                     GNSKPGLLPPLEVIQDTSSKVATAVILQALKEGSARIEEEDVPGQPGKKVQVPRDFNE
                     CLAWVKNQMWEPVYRPMIKVDHDPSIHTHQI"
     gene            complement(<833339..>834508)
                     /locus_tag="HG536_0A04590"
                     /db_xref="GeneID:59323739"
     mRNA            complement(<833339..>834508)
                     /locus_tag="HG536_0A04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281422.1"
                     /db_xref="GeneID:59323739"
     CDS             complement(833339..834508)
                     /locus_tag="HG536_0A04590"
                     /inference="similar to AA sequence:RefSeq:NP_011867.1"
                     /note="ancestral locus Anc_2.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137317.1"
                     /db_xref="GeneID:59323739"
                     /translation="MNALSYINNNLVVPLEKLNRNGSDRSQDDDRDESDGTTGVKPVK
                     AVRQEQGSRLSVYLWMVVLFLPRYLVMRPIQFVWWLICSPLLLVEYGVKSRLKRGQRR
                     RDSVAENGPVLRAISENDEDDLAGGDEIILQRDAVKGSLSKASGSAGRRHSVTSRNKS
                     GVRSECSSNVVFGTKRMGRFLFPKKLIPKSVLHAERRKRLVVDLDETLIHSASRSTSH
                     SNSSQGHMVEVRFAVSGVSTLYYVHKRPHCDLFLSKVSKWYDLVVFTASMKEYADPVI
                     DWLESSFSGRFSKRLYRNNCILRDGVGYIKDLSTVCGPMENSSNVSLGEVILVDNSPV
                     SYAMNVENAIQVEGWISDPSDNDLLTLLPFLEALRHTTDVRDVLALKNGEQAFLQ"
     gene            <834804..>835571
                     /locus_tag="HG536_0A04600"
                     /db_xref="GeneID:59323740"
     mRNA            <834804..>835571
                     /locus_tag="HG536_0A04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281423.1"
                     /db_xref="GeneID:59323740"
     CDS             834804..835571
                     /locus_tag="HG536_0A04600"
                     /inference="similar to AA sequence:RefSeq:NP_013785.1"
                     /note="ancestral locus Anc_2.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137318.1"
                     /db_xref="GeneID:59323740"
                     /translation="METQHLSLVVRAAEQNFPATIRVQDQTLHRQVIAIDSQDHRVDT
                     SSGCLSHYADRDATERLLWELVEMLDHNLGSVYARVTRELYHNTRPWRINKWDEMLTR
                     GLVYVVYVTRSGAATGRRRRGRSTPLLFLSFMLTEENGLIHSDPARVWSVLYLYEIQL
                     LPCVRGRGLGHTLVSEYLAGTARAVREGARMTADQFFGVELTVFGENDGAIRFYRRLG
                     MRRAADSPEERHDDVISQKPLYYLYVMRIDNVPPGYL"
     gene            <836224..>837555
                     /locus_tag="HG536_0A04605"
                     /db_xref="GeneID:59323741"
     mRNA            <836224..>837555
                     /locus_tag="HG536_0A04605"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281424.1"
                     /db_xref="GeneID:59323741"
     CDS             836224..837555
                     /locus_tag="HG536_0A04605"
                     /inference="similar to AA sequence:RefSeq:NP_013787.1"
                     /note="ancestral locus Anc_2.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137319.1"
                     /db_xref="GeneID:59323741"
                     /translation="MENYPIRQQQGQLQANPREDGLHGSDMSGIRRGDEPQQQQQQQQ
                     QQQQQQQQRHPVPLQPNYQYEYPYKYPSVSNVMYAGNNPPRNSVSYYVNEQDSSHQLS
                     KQSSGVNVLYPNVLPGMYHQGNVFQAGTQPQSSAPPPQQHPQQQQYYQYPPNMPLTAP
                     QFPPHQYYPIYPPVGGLSQPRDTAAQRSRQLVLLDNSNSNGMLPSLQIQQPLIQQTAG
                     KHHLSIPFQPPHTQARIAPADDPRLTYQQPLPLPSVAPSGWINDTNDNSERRADGNVP
                     RIKDSIDGADDIDNYDEDGDRKSGRRILDQGSVHKCHLCNKSFKRRSWLKRHLLSHFP
                     DRHFACPWCLSKHKRKDNLLQHMKLKHTDYVLQELRSHNIKVDGGFLTISNSNNNSNN
                     SNNNSSNNSSSTSTSSSSNNIRSLLYEGKLNKDEVKKVLNSLIDKHNNAHN"
     gene            complement(<837599..>838102)
                     /locus_tag="HG536_0A04610"
                     /db_xref="GeneID:59323742"
     mRNA            complement(<837599..>838102)
                     /locus_tag="HG536_0A04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281425.1"
                     /db_xref="GeneID:59323742"
     CDS             complement(837599..838102)
                     /locus_tag="HG536_0A04610"
                     /inference="similar to AA sequence:RefSeq:NP_013787.1"
                     /note="ancestral locus Anc_2.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137320.1"
                     /db_xref="GeneID:59323742"
                     /translation="MALSIKQFINVAGIVKDLKSFNFSLYGQWFGYINIFLCIALGIA
                     NLFHVSAVIAFGIVAIVQGLIILFVEVPFLLKICPLSDNFIEFIKRFETNGSRTIFYI
                     VMAVIQWCSIAVQATSLIVVAVGLTISAVSYAIALGKHQEFQNTHILKNPTDDDFPHE
                     AVVREML"
     gene            <838300..>840270
                     /locus_tag="HG536_0A04620"
                     /db_xref="GeneID:59323743"
     mRNA            <838300..>840270
                     /locus_tag="HG536_0A04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281426.1"
                     /db_xref="GeneID:59323743"
     CDS             838300..840270
                     /locus_tag="HG536_0A04620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137321.1"
                     /db_xref="GeneID:59323743"
                     /translation="MASRIMTNLDDSGYHTASDHEYDEVESLRKAIPSRTAANETVPT
                     KKDLGYISRRLQSSAFISDLQHGLSFNNALTRLQTMKALMEQLVSDAIDNNVESGDDF
                     QDCASSHDSLEDKGVEEPKGITRVTTPKLIPMYNDVVIPQDKYPDNGAHEDATENERE
                     MAELEPLTVISSHEKKDHKILRSRIRQINDLKVQPKQKAIMIQKLMMGNVKIANDQVD
                     KRCAGSSDDSELISVESITTPDDLRPVFQRPGVLGCPHYQRACKLLCGVCNKWVPCRL
                     CHDELQHDNPHVLDKDRIYWIMCMRCQNVQRPSRACEKCLEEFASYCCEKCKLYDNDE
                     AKDIYHCDKCGICRLGLGLGVDFFHCDGCQACLSIELQDNHKCIERATMSNCPICGEY
                     MFTSVKPVVYMSPCGHAIHQHCFDEYTRHSYKCPHCQVTVLNMDAQFRVLDKEIEEQP
                     LPEPYSNWMCIVSCNDCKGRSKCNYHILGLKCGHCLSYNTIQVKLIKPENGEEDNRIN
                     SAALEQFSHSMNHSLSENLLRDHFQTEEISPIINMDNSMLSNFDQYMNGYFKEAHRDG
                     DKESHNVNDFINTKNLFGQEKSENDGCSSNIAESQGMSRVGSLTGKFKQLIGDSLPVQ
                     RSITDVFQMWRQEGGSGQENLPQQSSPDDPDK"
     gene            <841237..>842610
                     /locus_tag="HG536_0A04630"
                     /db_xref="GeneID:59323744"
     mRNA            <841237..>842610
                     /locus_tag="HG536_0A04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281427.1"
                     /db_xref="GeneID:59323744"
     CDS             841237..842610
                     /locus_tag="HG536_0A04630"
                     /inference="similar to AA sequence:RefSeq:NP_012893.3"
                     /note="ancestral locus Anc_2.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137322.1"
                     /db_xref="GeneID:59323744"
                     /translation="MSSTIQIPNLNSGNSPKQEDSNSSTNNILSIGTDHLQYQPLDPP
                     ETQFRELHQFSTRQAQSLSHYPTQAFQPQYHVPPPNQQQQQQQPQQQQLHQQQQQQQQ
                     KQQQQQLEQQQQLQQQQQLQQQQQQQQQQQQQQQAYYQQPYTQFANQPNQHLQQAQQR
                     QPQYSNQHLQQIQQQPNPGSAPQEFNYTQGNSGLQAFNQQQLSELMYNSFLSHLAQKQ
                     VSSALGSALGTASHINPATAVAAGSSFLTQPVQRYFHNNMNASPTMMEAAHPAMMQPS
                     QQIQLQNAQPVAKKMSSTQSRIEKRKQLKKQGPKRPSSAYFLFSMSIRNELLQQYPEA
                     KVPELSKLASAKWKELSDDEKKPFYEEFRTNWEKYRVLRDEYEKTLPPKRPSGPFIQF
                     TQEIRPVVVKENPDKNLIEVTKMIGERWRNLDPATKAEYTENYKRRLKEWESCYPEEA
                     EEKEFKK"
     gene            complement(<842825..>843472)
                     /locus_tag="HG536_0A04640"
                     /db_xref="GeneID:59323745"
     mRNA            complement(<842825..>843472)
                     /locus_tag="HG536_0A04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281428.1"
                     /db_xref="GeneID:59323745"
     CDS             complement(842825..843472)
                     /locus_tag="HG536_0A04640"
                     /inference="similar to AA sequence:RefSeq:NP_013789.1"
                     /note="ancestral locus Anc_2.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137323.1"
                     /db_xref="GeneID:59323745"
                     /translation="MTNLEMGEPSNPIAKRVGQAKDALRRPAAPGVQRMLAVPLGSKL
                     TPELNHTEKSELAIQAGCSTLGAGGYRSKVRLKPGHSALDWHELVSGKGKKQGLVVGI
                     EKLLNEDFERLQHLNHPQSLMQLQRGVPTYMIRPPLRIDKEMLQKHSSLDDCWCVIRG
                     NVYCLTYYFDFHPGGVDILLKNCAGKDGTKAFEKYHRWVSFDKLLETCLVGVYVI"
     gene            complement(<843779..>844189)
                     /locus_tag="HG536_0A04650"
                     /db_xref="GeneID:59323746"
     mRNA            complement(<843779..>844189)
                     /locus_tag="HG536_0A04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281429.1"
                     /db_xref="GeneID:59323746"
     CDS             complement(843779..844189)
                     /locus_tag="HG536_0A04650"
                     /inference="similar to AA sequence:RefSeq:NP_013790.1"
                     /note="ancestral locus Anc_2.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137324.1"
                     /db_xref="GeneID:59323746"
                     /translation="MDSELQALREARLAELKKGSPGPSSGSENGSGGANGGVGQLIAG
                     YLQPQALERLSRVSLVRPDRAQAVEQYLARIVSQGALTHKVTEDEIVQILHGVAREQN
                     KKNDTKIIFDRREAAIDDHEVTKNGDEDDDDFFD"
     gene            <844543..>846633
                     /locus_tag="HG536_0A04660"
                     /db_xref="GeneID:59323747"
     mRNA            <844543..>846633
                     /locus_tag="HG536_0A04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281430.1"
                     /db_xref="GeneID:59323747"
     CDS             844543..846633
                     /locus_tag="HG536_0A04660"
                     /inference="similar to AA sequence:RefSeq:NP_013791.1"
                     /note="ancestral locus Anc_2.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137325.1"
                     /db_xref="GeneID:59323747"
                     /translation="MKSYLEPAKRSENAGDEINQEDSLSPSLFKTPNNVRKSKNESND
                     TASRSNSPSGPNSRRPRRSASQKVDYDLKKRRIIPSDDYSMKQRGRNPSCSSLEKNRD
                     DDEGDEVDDEEGATFKSVIECDEEGNVIQMNEPEKIKDAINGATGLPLSQGPPEKVKK
                     ESLWNYKRALSSPNSFVSLSSSEDRSGLELKIYRPKLKTEKSETITRLSSLRQRIHPK
                     DIYKDKRDKYIKPEYENASKKDLEHHPSAHIKIKATVSKDSKTKLFGQNSLTHLAATT
                     ARGSSRGSTPAQEVENDDFCSSCLQTGSFLCCDTCPKSFHFLCLNPPLDPDNLPEGDW
                     SCTQCAFKQNHPNLSQVKKVEKEFIGTKLPINARLFGKLLFQLEATNPRQFKLPQSIK
                     DTFQHVKSGSRAQYCDEREKEHLSEKQLFDSPYGQCITKQDTYNPDIHIDQDTGKLLV
                     CYRCGTSKMGTWDNPEKSRLIMRCDYCKTPWHLDCVPHVPRASLKNLGTNWKCPLHAP
                     TKGVFHKQRRLVRAQKYVEPQQSCGFKNDGEIDIVLDEISAPASRGMMESLKRDGDFP
                     PISILREKSIKLDFLDKVLQAKKVQRENDFKSQERLIDKLVTSHERSKKNENSSLDEV
                     LSFLYFTLSGTPNLKKLWDFKELCKVAEQQSIEQELKEDRMTNEELKQLVILKKLLES
                     KPKEDILKILNLNK"
     gene            complement(<846719..>850510)
                     /locus_tag="HG536_0A04670"
                     /db_xref="GeneID:59323748"
     mRNA            complement(<846719..>850510)
                     /locus_tag="HG536_0A04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281431.1"
                     /db_xref="GeneID:59323748"
     CDS             complement(846719..850510)
                     /locus_tag="HG536_0A04670"
                     /inference="similar to AA sequence:RefSeq:NP_013793.1"
                     /note="ancestral locus Anc_2.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137326.1"
                     /db_xref="GeneID:59323748"
                     /translation="MVSVSKSKLGFNKAIISTVDNLIQTDELLNRLIALHQELSILEQ
                     GKVDLSTLDRYRNDLNNRKLLKHKDNGVKAFVACCLSDILRLYAPDAPYTESQLVEIF
                     RLILSQFELLGNPDNGYYIQQTYLITRMLEYRSIVLVTDLPNSDKLLEDLFKIFYDDS
                     RAFQPKLFKVIAGILGEVISEFDTVPTPVLKLIFNKFLTHNPEDVPDGLEVAPNCGYN
                     VSLILCDAYSSRMSRHLTKYYSEVLYHVTNEESNNAYEIRWSASRTIEKLHKLVFRLW
                     QTSPDLTSAVIGFVYHELSADNEMMRKQATKLVGQLLTVTSSLNFAVTHRESYNAWLS
                     KIADVSADVRLQWTCSLSAILATRDDIAPDLNKGLTKTLIDSEYSVRKASVAVISELS
                     IANVWKTIIDPTVYECLLPLTREKNREVRELCISTVADLYSDSVETIERTAENVRIWE
                     IIDTIPSVLFNLYYINDRHISEQVDRVLFKSLLPLEADDRKRVQRLLKVVAHLDGKAL
                     TSFFAFNKRQMQIALALSKLVDFCALPNDNESKLQKTIAWLASGFSDRLKASAALEAL
                     KEINDKRIFYLIKSCITNDVSFVTLKNSMDELLVKIRDPGLFRKNNVRSMSTIMPKDI
                     ATQVEILLYRSAPIIYNFSSIPILLDTGASTGQDDLVWKRKLLDEISKVNPALFKDHV
                     KTLKNIVENEHYLASGQESLTLSEALKTVYKISKTLSDQVNLEDTTFFCKLKTLALEG
                     DPITSKYAVKLIALSPFAQEKFREIKSDILPLDKKHNRFASHILVLAEIYKFCPHVLD
                     KDSTEIVSFLIQEVLLANQVVGDSNEEDKWIEDADLTTSKYLPLSAKLYALKLFTSKL
                     KSISSEGFTDELTAAFTEKTVKLFFYLIASGGELIPESNEENYPTPSNYQTKLRSYAG
                     LQALKLSCIPFFNDFIKPANITTLINLVEDESLPVRKEFLDSLKNCISRQAISIKFLP
                     LVFFTAYEPNEDLKTSTKTWVNYTFGKESFRKNTTFERALPRLISAIAHHPDIVEGFD
                     SEDESYLEGLTIVIDYLVFYFDSIAIQENFSMLYYLSERVKNYKDVIAEENDSEAANQ
                     SKNSTISSTRIYIIGEIAQMILLAIKDRKGWQHSAYPGKLNLPADLFAPFGTIEEAQA
                     SFKTYLPEKYTERLQMNIKAKVARLLHTSQTQKQKLQKRMLNNEYQEVAKKKKKQKRH
                     AVSNRAIDEDSDSEANQAFTVAGKDNNGTVSPLSKKSLRTRKKVDYRDDDNSESENEL
                     D"
     gene            complement(<850728..>852608)
                     /locus_tag="HG536_0A04680"
                     /db_xref="GeneID:59323749"
     mRNA            complement(<850728..>852608)
                     /locus_tag="HG536_0A04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281432.1"
                     /db_xref="GeneID:59323749"
     CDS             complement(850728..852608)
                     /locus_tag="HG536_0A04680"
                     /inference="similar to AA sequence:RefSeq:NP_011855.1"
                     /note="ancestral locus Anc_2.540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137327.1"
                     /db_xref="GeneID:59323749"
                     /translation="MVADDAYYLTPHEAALAVVATAMKKARLQIGTLTLNSLLGGILF
                     SAGSIMAVAAHSENPTLMRDNPGLADSFSGVLFGIGLFYVVIMGADLYNSNILFFSVG
                     LLRRAVSVYDLVVSWFVSLLGNLAGSLFVSYLFCHVSKVSSSELWKTGSRNLVESKAS
                     FSFMETFLKGIAGNFFVCLAIYLQLMAKPIHVRLILIILPVFTFVSCGFTHVVADMAL
                     SFIGMLNGADVSVGEYIWKLLIPAAVGNAIGGSAFGLVVPFYLHLVVVENDRKKLSLP
                     EYDARDEQPELNTDSRVVRVSPLEEKEEELENEEEEESESLGKRETDVPDGSGGDSSD
                     IGTSLSPQRSLNSDESSLREYSHSYHGTPALRTVSLKSVTSRRSSRSLRSVGARSPPG
                     VFPVRGMREPLGRERTIENPYFDALEEPLDESHEHERKKVGWQGSLSPPAKSIDAKRS
                     SSGYSVLEDKPGAKLEKAITKLVENSHRTKTLGQLPRTTQETFPHNRPDLSPSYTAAI
                     AEIPRWHRTGKHEGLSRQIRSSETTTDSSSIERSLRRAEINHIAAVAANSVAGVADFD
                     TLDFPVSHSPRTLHRTRLRPPPEQFEGSIKDEASMKANSVSIGVLQNDSNNGQQSIQR
                     IT"
     gene            complement(<852990..>856118)
                     /locus_tag="HG536_0A04690"
                     /db_xref="GeneID:59323750"
     mRNA            complement(<852990..>856118)
                     /locus_tag="HG536_0A04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281433.1"
                     /db_xref="GeneID:59323750"
     CDS             complement(852990..856118)
                     /locus_tag="HG536_0A04690"
                     /inference="similar to AA sequence:RefSeq:NP_012892.1"
                     /note="ancestral locus Anc_2.541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137328.1"
                     /db_xref="GeneID:59323750"
                     /translation="MSNNSSTFHELRPICIDISRLAFQPKEVFNPQSVPLRDALAKLE
                     AKLASYEDASIQANLADYIFIPISSLLKQESLGEAQSSYVLLIISHLLRVSWRRDGIL
                     AEELAQQLLPLLPFLISRDPTNDKLEKISQDCKRAGCCALYEYSKSLAQQSYSPQFFS
                     SKNSKNLRALAHGISVLLTILEQSSKDWQTQLMILDTLRILYCDIVRDGEVLSFILPG
                     NISSFARILMLPGLTTNYKVVIKSLDVMKHLILLVYDDLSLNVHDNRLRDIKELRSLD
                     DLHEEALSMEAVLIEKPDKDGQSTHRSTAWLRATSSQLRMALERIIPKLQKRSNIEIS
                     KALVDLASDLLSRCAKSLHNCERCLVEVLLRCKMDPKLQLLPHTACLRELLRDELASI
                     NTKIQFQDVDAIRSLNYGLKYFTEISATDDTMLVSDLYKSALTSIESGVETATFNKVG
                     RAVLEQSSNVVMADFSDELVNSKNLPAIFPSLSKELEEALSQLFMTTGRLASKNGQLK
                     SIIESLLSDQVGQSTITKAIALWLSSQIMLTVQEDCSAPEYALLNLDSAELDKQPCYD
                     ILEFGKDLAQEIVTCAEGKKLSRLSEISLVVIVNSIETVCRVLGREFSSELVDYLYII
                     VENLASSSPTVRHFAQSCSLTIAHVLYNNSVQDMILQNVDYLADSIASRLNCGLTERV
                     STVFMVVSKLAGYETIECFRDIIETFFKFLDYYHGYDSMCLEFFQLFEVIALEIQKRY
                     FTADAGNHHIAYHSDRHCIGSPWGMSNLQQVLAIMDKQSPAQEHDSMSILEKDPKSFQ
                     EYFDSKLRVADSDDEDDDDSDQELDEDPTELSTGKQGANDENRWVSPVPRESYRILLQ
                     ILGYGDRLLTHRSKPLKIQILKVINLVIPMLASQYNSFLPQVAQIWETLVLCSLNDDL
                     SIVKPACDCLRELIRNAGDFITTRFLELWKTWQEKSPLLRELAVSNANSNIAIKSITL
                     HRKFPTITQTALTSQTQVLMEGMMVAGLTIPDLTSREMIYCCIQVHGWKSVAARSLAI
                     ADTIHAILQETH"
     gene            complement(<856466..>857014)
                     /locus_tag="HG536_0A04700"
                     /db_xref="GeneID:59323751"
     mRNA            complement(<856466..>857014)
                     /locus_tag="HG536_0A04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281434.1"
                     /db_xref="GeneID:59323751"
     CDS             complement(856466..857014)
                     /locus_tag="HG536_0A04700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137329.1"
                     /db_xref="GeneID:59323751"
                     /translation="MFRRSVIGQTRLFSTARAILGKKVYFEPSINGTKVGRIEFELYD
                     DVVPKTAENFRALCTGEKGFGYKGVPFHRIIPQFMLQGGDTDLTDGFGGKSIYGSKFA
                     DENFTKKHDKAGLLSMANAGPNTNGSQFFITTVECPWLDGKHVVFGEVSKGMDIVKQI
                     EAYGTMSGKPKAKIVIEEAGEL"
     gene            <857215..>858933
                     /locus_tag="HG536_0A04710"
                     /db_xref="GeneID:59323752"
     mRNA            <857215..>858933
                     /locus_tag="HG536_0A04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281435.1"
                     /db_xref="GeneID:59323752"
     CDS             857215..858933
                     /locus_tag="HG536_0A04710"
                     /inference="similar to AA sequence:RefSeq:NP_011853.1"
                     /note="ancestral locus Anc_2.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137330.1"
                     /db_xref="GeneID:59323752"
                     /translation="MESTYRIALQFPEEEQAIWAYRSFTNASQPPHPHNTVPAEKSCK
                     IRDWRVGDLSISSIKEMDLAADAEDKDLLLSQYLGHGIIRLFRLNEKDSAATTEHDLL
                     TIPGDDTMVSILFVPTYFTVRDLLHYYIGDEIVNNQVSNFRILRNKKCELGFNFMVLM
                     KFKDPLMAKGFKDEFNGKRFSKMDPETCHVVSIKEVVFERSVFDKKEGTEIPYLLSDP
                     FTTQRYDNLKIPAQVELPTCPVCLERMDSETTGLITIPCQHTFHCQCLEKWKNSRCPV
                     CRYSSIRLSRNSAVRQNGENSGCSTCGCHDNLWICLICGNIGCGRYNSKHAIQHYDDT
                     SHCFAMDMQTQRVWDYAGDNYVHRLVQNEVDGKLVEVEVEAERPIPSSQPQSSGHSGS
                     KTMEKDSSAASFMRNKEYHLEYVQVLVSQLESQREFFEMKLQQAQSANTEGSEVDLLR
                     KEIEELKVSFKECQQTFKQQNAANARQRDEDKLVIQGLQENLDHISRERDKIAIEKEQ
                     LAKEKQELEEQVHDLMFYLESQEKFKDADASVREGTIIIQDPKQSSTDNNSKPKKKSK
                     SKRKPR"
     gene            <859241..>860203
                     /locus_tag="HG536_0A04720"
                     /db_xref="GeneID:59323753"
     mRNA            <859241..>860203
                     /locus_tag="HG536_0A04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281436.1"
                     /db_xref="GeneID:59323753"
     CDS             859241..860203
                     /locus_tag="HG536_0A04720"
                     /inference="similar to AA sequence:RefSeq:NP_011852.1"
                     /note="ancestral locus Anc_2.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137331.1"
                     /db_xref="GeneID:59323753"
                     /translation="MATNSIKLLAPDVHRGLAELVAKRLGLPLTDTVLKRDPSGEVSF
                     SIGESVRDQDIFIITQIGSGVVNDRVLELLIMINASKTASARRITAVIPNFPYARQDR
                     KDKSRAPITAKLMADMLTTAGCDHVITMDLHASQIQGFFDSPVDNLYAEPSVVRYIKE
                     NVNFKESIIVSPDAGGAKRAATLADRLDLNFALIHKERARANEVSRMVLVGDVTDKIC
                     IIVDDMADTCGTLAKAADVLLQNNAKSVIAIVTHGVLSGRAIENINNSRLDRVVCTNT
                     VPFEEKMKICPKLDVIDISSVLAESIRRLHNGESISYLFKHSPL"
     gene            complement(<860253..>860924)
                     /locus_tag="HG536_0A04730"
                     /db_xref="GeneID:59323754"
     mRNA            complement(<860253..>860924)
                     /locus_tag="HG536_0A04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281437.1"
                     /db_xref="GeneID:59323754"
     CDS             complement(860253..860924)
                     /locus_tag="HG536_0A04730"
                     /inference="similar to AA sequence:RefSeq:NP_012891.4"
                     /note="ancestral locus Anc_2.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137332.1"
                     /db_xref="GeneID:59323754"
                     /translation="MDGLLINTEDIYTLTLNEILANHGKGPLTWDVKVHLQGLPGPQA
                     AARVIETYDLPLTADEYEKLNLEVQSKRWGDCAFLPGALELIKHLKLNGVPIALCTSS
                     GKVKFEQKTQHLKEGFKLFDAIITGDDERIPSGRGKPFPDIWQIGLKELNEADGTSFQ
                     PEECLVFEDGLSGVKAGLAFGGYVIWVPHPGAYKYLGDTKGLLNGNGEVLESLEDLEL
                     DKFGL"
     gene            <862613..>862930
                     /locus_tag="HG536_0A04740"
                     /db_xref="GeneID:59323755"
     mRNA            <862613..>862930
                     /locus_tag="HG536_0A04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281438.1"
                     /db_xref="GeneID:59323755"
     CDS             862613..862930
                     /locus_tag="HG536_0A04740"
                     /inference="similar to AA sequence:RefSeq:NP_010669.1"
                     /note="ancestral locus Anc_5.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137333.1"
                     /db_xref="GeneID:59323755"
                     /translation="MANITFKNGEMAKKAVAKFNGAPIDGGRSRLRLNLIIDPTQRPA
                     RSLSERIRAVAPKNVKPTSAKKGPTKKAALAKKQKQQKPKQPKKSLEDLDKEMADYFE
                     EKQ"
     gene            complement(<863076..>863476)
                     /locus_tag="HG536_0A04750"
                     /db_xref="GeneID:59323756"
     mRNA            complement(join(<863076..863379,863448..>863476))
                     /locus_tag="HG536_0A04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281439.1"
                     /db_xref="GeneID:59323756"
     CDS             complement(join(863076..863379,863448..863476))
                     /locus_tag="HG536_0A04750"
                     /inference="similar to AA sequence:RefSeq:NP_219495.2"
                     /note="ancestral locus Anc_5.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137334.1"
                     /db_xref="GeneID:59323756"
                     /translation="MSANPFKNLGKNVIYVSIGAIASVLVAKRVVRSKKEAQYSPSAS
                     ANHEEHKAGTEGYYDNLAQVRPGFPLPSQKQTEAIERKSEFEGPGMSVLSRKRGDRLG
                     FLDRKRDE"
     gene            <863609..>864568
                     /locus_tag="HG536_0A04760"
                     /db_xref="GeneID:59323757"
     mRNA            <863609..>864568
                     /locus_tag="HG536_0A04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281440.1"
                     /db_xref="GeneID:59323757"
     CDS             863609..864568
                     /locus_tag="HG536_0A04760"
                     /note="ancestral locus Anc_5.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137335.1"
                     /db_xref="GeneID:59323757"
                     /translation="MSVKPQEAEELVHAIAGAGGGVLSIALTYPLLTISTRLQAESKD
                     TKKEKKTLWQIVDEIVGKDGLTGLYAGLESAVLGMAITNFVYYYFYESAGRSFKRLRR
                     KTQLNTVEAMLSGAIAGSATAVASNPIWVANTRMTVTKSNKSTISMMLQIIRDDGVLA
                     LFKGLKPALILVANPIIQFTVFEQLKNFVLNVQAGQSVLPPSWAFLLGAIGKLVATGI
                     TYPYITLKTRLHMVGDRSTDKRPEIAQSERRVTALEIIKREGISGIYQGIGYKLVQSI
                     LTAAFLFYFKEGLVLWSMKALRVLRQVRWRSLNQHRIKISAQR"
     gene            complement(<864622..>865515)
                     /locus_tag="HG536_0A04770"
                     /db_xref="GeneID:59323758"
     mRNA            complement(<864622..>865515)
                     /locus_tag="HG536_0A04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281441.1"
                     /db_xref="GeneID:59323758"
     CDS             complement(864622..865515)
                     /locus_tag="HG536_0A04770"
                     /inference="similar to AA sequence:RefSeq:NP_014773.4"
                     /note="ancestral locus Anc_5.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137336.1"
                     /db_xref="GeneID:59323758"
                     /translation="METDSVVIAEQKDRDLEANALKDTINGSIAGAFGKLIEYPFDTV
                     KVRMQTQDAKTFPTTWSCIKYTYKNEGILRGFFQGIGSPIFGASLENAVLFVSYNQCA
                     QFLEKHAKVTSLQQTVISGAFAGACASLVLTPVELIKCKLQVSNLQNLQAGIKKPTKI
                     LPTIKLVLQERGVMGLWQGQSGTLIRETFGGVAWFSTYELLKNYLKSLHDDGRDSDTW
                     ELLVSGASAGLAFNASIFPADTLKSVMQTEHMGLLQSAKRVMAKSGVAGFYRGLGITL
                     IRAAPANAAVFYTYETLSKLI"
     gene            <866102..>866437
                     /locus_tag="HG536_0A04780"
                     /db_xref="GeneID:59323759"
     mRNA            <866102..>866437
                     /locus_tag="HG536_0A04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281442.1"
                     /db_xref="GeneID:59323759"
     CDS             866102..866437
                     /locus_tag="HG536_0A04780"
                     /inference="similar to AA sequence:RefSeq:NP_010670.3"
                     /note="ancestral locus Anc_5.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137337.1"
                     /db_xref="GeneID:59323759"
                     /translation="MKYLAAYLLLVQGGNASPSAADIKSVIEAVGVEAEEARINELLS
                     SLEGKGSLEEIIAEGQQKFATVPAGGAGVSGGAAAGAAAGGAEAAEEEAAEEAKEESD
                     DDMGFGLFD"
     gene            complement(<866497..>867168)
                     /locus_tag="HG536_0A04790"
                     /db_xref="GeneID:59323760"
     mRNA            complement(<866497..>867168)
                     /locus_tag="HG536_0A04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281443.1"
                     /db_xref="GeneID:59323760"
     CDS             complement(866497..867168)
                     /locus_tag="HG536_0A04790"
                     /inference="similar to AA sequence:RefSeq:NP_010671.4"
                     /note="ancestral locus Anc_5.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137338.1"
                     /db_xref="GeneID:59323760"
                     /translation="MYQQIADFIRNELARQSTSKIDDLDGQVPFEVLSALKADLQRRN
                     SERFQITKQDALCKQVYDLEREWRKKQIKEVIELIGEIPRYSIGTEIKEKEHGVSIDK
                     LIEDVLKLPNMAVAEESQEAPETDFRLLNEYTNLRNELIKKCNAIKLGELKLQEKEYQ
                     AKLINSLLDAINESTTPDVSEYFETYHKRVFAGLQDSRYLLEDAIKSHGSDPEKRTKL
                     QELMD"
     gene            867544..867615
                     /locus_tag="HG536_0Atrna1D"
                     /db_xref="GeneID:59324250"
     tRNA            867544..867615
                     /locus_tag="HG536_0Atrna1D"
                     /product="tRNA-Asp"
                     /note="codon recognized: GAC"
                     /db_xref="GeneID:59324250"
     gene            complement(<867689..>868558)
                     /locus_tag="HG536_0A04800"
                     /db_xref="GeneID:59323761"
     mRNA            complement(<867689..>868558)
                     /locus_tag="HG536_0A04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281444.1"
                     /db_xref="GeneID:59323761"
     CDS             complement(867689..868558)
                     /locus_tag="HG536_0A04800"
                     /inference="similar to AA sequence:RefSeq:NP_010672.1"
                     /note="ancestral locus Anc_5.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137339.1"
                     /db_xref="GeneID:59323761"
                     /translation="MNAVQMVSFETKPKMSSDPNTPSSVSSTQEAHYKPNGEDQNLSN
                     AASPRVVKSVTHDGEFVTIGDQTFRRQDLANIFVNDLDSETYRRRPRVQRLANPVPLG
                     LASFSFCCLVLSLVNARVRGVTVNQLLVSSFLFFGGAIELFAGLLCFVTGDTYAMTVF
                     SAFGGFWISWGCVFLDQFGVAAAYADDPKMFQNVTGFFLAGWAVFTFLVWLCSMKSTW
                     GLFLLLGFLELTFLMLCIGSFIGNDKCLMAGGYFGILSSCCGWYSLYCGISNQDNGYI
                     PLRAYPMPNAATV"
     gene            complement(<868808..>869443)
                     /locus_tag="HG536_0A04810"
                     /db_xref="GeneID:59323762"
     mRNA            complement(<868808..>869443)
                     /locus_tag="HG536_0A04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281445.1"
                     /db_xref="GeneID:59323762"
     CDS             complement(868808..869443)
                     /locus_tag="HG536_0A04810"
                     /inference="similar to AA sequence:RefSeq:NP_014774.1"
                     /note="ancestral locus Anc_5.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137340.1"
                     /db_xref="GeneID:59323762"
                     /translation="MCPRNRLKSIKAVIFDMDGTLCLPQPWMFPAMRQAVGLHDSSID
                     ILTFIDRLSTPLERAEAHRRIQQVEAQAMAEMQPQPGLVTLMRFLTKHGISKSICTRN
                     LQEPVDFLIDRFLPAEYSHFDYILTREFKPTKPSADPLLHIARSLGIEPAHIAMVGDS
                     RDDLLSGRAAGCTTVLVHHASNASLLASDEDAQMIDFVVRDLAELVTLLSV"
     gene            complement(<870343..>871719)
                     /locus_tag="HG536_0A04820"
                     /db_xref="GeneID:59323763"
     mRNA            complement(<870343..>871719)
                     /locus_tag="HG536_0A04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281446.1"
                     /db_xref="GeneID:59323763"
     CDS             complement(870343..871719)
                     /locus_tag="HG536_0A04820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137341.1"
                     /db_xref="GeneID:59323763"
                     /translation="MTKKKSLEEFVEECRKVHDDKYNYSITNYTRWDCKIEYTCPIHG
                     VQSQRADNHRRGMGCKLCGRERIRKTFALTTEKFIETCKKKHNNRYSYPDTVYVNYES
                     AVKIECARHGEFVQKAGCHLIGSGCQKCAVFNKSSGPALKPADYDEFVGLSITVHGDV
                     YDYSQVKYKNHYVTVDIVCRDHGPFRCTPTVHLKGKGCATCQNFDAFVQKAKSIHGDK
                     FQYDKSTYIRSKTKMRILCREHGEFWQIPADHARVTRKGGFYCPSCSLENKRLTIDEV
                     KERSRNIHGLAYKFDKLVLGKSLEEEAIFYCIKCAKYFSQKPVNHLKGSGCSWCCESK
                     HEKKIRNWLQTMDYQFESQKRFPDLRYEKSLRCDFYLEQFNLIIEFDGIQHFEPVEAW
                     GGFEEFLRVQARDRAKDDYCTEKRINLLRMKDGQDVIQGVQDLIELIKANETGHVLHM
                     IYGKLATF"
     gene            <871913..>872557
                     /locus_tag="HG536_0A04825"
                     /db_xref="GeneID:59323764"
     mRNA            <871913..>872557
                     /locus_tag="HG536_0A04825"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281447.1"
                     /db_xref="GeneID:59323764"
     CDS             871913..872557
                     /locus_tag="HG536_0A04825"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137342.1"
                     /db_xref="GeneID:59323764"
                     /translation="MSAMIVRKPGHLFLEELEIPFEDEGDYVVVKHAALFASTVTSKV
                     LQFPNVKFFNATAVEDLVTRPAGPNGELTVAGVVTNWTLVTQAHDLQSCMDPNVIELA
                     GYKNDGTRDVSKKHGVILSTTGHDGPFGAFSAKRIVSIDKNSQLKGMKGLDMNNAEAD
                     VVKNSGKYKAVDSMYFAGMEVAELAGCNRMGPTFGAMLVSGIKAAEEILKHFAE"
     gene            <872782..>873048
                     /locus_tag="HG536_0A04830"
                     /db_xref="GeneID:59323765"
     mRNA            <872782..>873048
                     /locus_tag="HG536_0A04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281448.1"
                     /db_xref="GeneID:59323765"
     CDS             872782..873048
                     /locus_tag="HG536_0A04830"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137343.1"
                     /db_xref="GeneID:59323765"
                     /translation="MILWLELSQYWKYVEQDAVVLPASRLIKVCLIITVSVLMIWIAM
                     LMITSIYYHTVLEKVLGCLMGYICVTVMYWLIPRSPFCNKLFYC"
     gene            <873513..>875042
                     /locus_tag="HG536_0A04840"
                     /db_xref="GeneID:59323766"
     mRNA            <873513..>875042
                     /locus_tag="HG536_0A04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281449.1"
                     /db_xref="GeneID:59323766"
     CDS             873513..875042
                     /locus_tag="HG536_0A04840"
                     /inference="similar to AA sequence:RefSeq:NP_014775.3"
                     /note="ancestral locus Anc_5.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137344.1"
                     /db_xref="GeneID:59323766"
                     /translation="MEPYEPADDMVDNNPFGEPVEQPEAQEQREEGQEEVEPAQEPGS
                     GAEQIDLLPERTKSGKYRLLVKVTALERVGNVTSKRENPVVVFDVSTNVPTFRKSQHR
                     KVRKTADEFRQLFKFLNGAIQESFIASLPPTYTSLGINNEEDYTQTMGRFQQWFNRIC
                     DDPLVVRNEEVAFFIESDFGSYSPISESKLPASGLRRKTLKQLSPPYDEVVELAEFRP
                     LVKSVHWVSQDIQAKLAKVCKGRKILAQEENALGQGFVALHEDQQLYKNFGKVLTANG
                     DIDSIMATLDLGTLHDGLEWIVRDTYVVKEALTNRHLIMRDLLQAQQTSKMRQERARK
                     LRAKRDISPLKVDEALRQLKAATRDESELTVKLQRITANMCIEKNLWLSWFEDFLSSS
                     IRDYTMRKIEYERKKLSLLERIRSDVRKADTKGGLSRLGREASLAKMKQDRQLSQTLD
                     GDNWTGDVRRRSQVQFDKLSQTEFDKALNLQEPSSQRDLHDKSSLDARHAAIMLGLPT
                     F"
     gene            <875397..>877925
                     /locus_tag="HG536_0A04850"
                     /db_xref="GeneID:59323767"
     mRNA            <875397..>877925
                     /locus_tag="HG536_0A04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281450.1"
                     /db_xref="GeneID:59323767"
     CDS             875397..877925
                     /locus_tag="HG536_0A04850"
                     /inference="similar to AA sequence:RefSeq:NP_010673.1"
                     /note="ancestral locus Anc_5.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137345.1"
                     /db_xref="GeneID:59323767"
                     /translation="MVAFTVDQMRSLMDKVTNVRNMSVIAHVDHGKSTLTDSLVQKAG
                     IISAAKAGEARFMDTRKDEQERGITIKSTAISLFAEIGEEDIKDMKQKTDGSSFLINL
                     IDSPGHVDFSSEVTAALRVTDGALVVVDTVEGVCVQTETVLRQALGERIKPVVVINKV
                     DRALLELQVSKEDLYQSFSRTVESVNVIISTYADEVLGDVQVYPSQGTVAFGSGLHGW
                     AFTIRQFANRYAKKFGVDKVRMMERLWGDSYFNPKTKKWTNKDTDTDGKPLERAFNMF
                     VLDPIFRLFAAIMNFKKDEIPVLLEKLEIGLKGEEKDLEGKALLKVVMKKFLPAADAL
                     LEMIVMHLPSPVTAQNYRAEQLYEGPSDDPFCLAIKNCDPKADLMLYVSKMVPTSDKG
                     RFYAFGRVFAGTVRSGQKVRIQGPNYVPGKKDDLFLKAIQRVVLMMGSKTEAIDDCPA
                     GNIVGLVGIDQFLLKTGTLTTNEAAHNMKVMKFSVSPVVQVAVEVKNANDLPKLVEGL
                     KRLSKSDPCVLTYIAETGEHIVAGTGELHLEICLQDLENDHAGIPLKISPPVVAYRET
                     VEAESSQVALSKSPNKHNRIYLKAQPIDEEVSLAIENGKINPRDDFKVRARIMADEFG
                     WDVTDARKIWCFGPDGNGPNLVVDQTKAVQYLNEIKDSVVAAFQWATKEGPIFGEQMR
                     SVRVNILDVTLHADAIHRGGGQIIPTMRRATYAGFLLAEPKIQEPVFLVEIQCPEQAV
                     GGIYSVLNKKRGQVVSEEQRPGTPLFTVKAYLPVNESFGFTGELRQATGGQAFPQMVF
                     DHWSTLGSDPLDPTSKAGEIVLAARKRHGMKEQVPGWQEYYDKL"
     gene            <878156..>880036
                     /locus_tag="HG536_0A04860"
                     /db_xref="GeneID:59323768"
     mRNA            <878156..>880036
                     /locus_tag="HG536_0A04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281451.1"
                     /db_xref="GeneID:59323768"
     CDS             878156..880036
                     /locus_tag="HG536_0A04860"
                     /inference="similar to AA sequence:RefSeq:NP_010674.3"
                     /note="ancestral locus Anc_5.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137346.1"
                     /db_xref="GeneID:59323768"
                     /translation="MSLPADLKLLYAEWLQEFINALNPRQEQLAATYDKARRNLLDAE
                     GTIYYPRDLKKIRGIGDTIMRKLEKSLQRYCKEIGVEVPTPPVRESPQRETNRTSTAL
                     RLGHTEPSGNRNGQECLMAKKRRKYIPKKRSGGYGILLALLEANAITRGISKDDIIEL
                     AEKYCNSSMKPNYMTKELRGAWSSIKSLIKHELVIEQGRPKIYLLTDEGQAMAKTLKL
                     ADNITFAIEKGKAASELEFSKDADSEASANFRDLFDGEAYETISKPGSHGSSLVDVTF
                     QDSNMMPTNNQSRISHARTLAISTPLTRKVLNVKPVAVANDSPSNDSILRRRFIGVRY
                     ELWPKGSYEVYPIIDYREVRSQSDRDFFSKALDRKGTKCEIRQLALGDIIWIGKNKKT
                     GTECVLNTIVERKRLDDLATSIRDNRFMEQKSRLEKSGCRNKYYLIEETMGKSMDGMT
                     EAIKTALWVILVYYRFSMMKTNNADDTVEKLQALQTVIAKEYSEKNLIVIFPNDLKNQ
                     DDYLRVLDEFRSEFERGRDIECCHTYQCFQEILGKGELSTVGELTIRVLMFIKGVSIE
                     KAVAIQRIYPTLSHILKAYSECQSELDSKLLMFKRLGDAPGAKKITKSLSEKIADVFG
                     TF"
     gene            complement(<880086..>881759)
                     /locus_tag="HG536_0A04870"
                     /db_xref="GeneID:59323769"
     mRNA            complement(<880086..>881759)
                     /locus_tag="HG536_0A04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281452.1"
                     /db_xref="GeneID:59323769"
     CDS             complement(880086..881759)
                     /locus_tag="HG536_0A04870"
                     /inference="similar to AA sequence:RefSeq:NP_010675.3"
                     /note="ancestral locus Anc_5.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137347.1"
                     /db_xref="GeneID:59323769"
                     /translation="MEADQQQEQQQQRARSSATLCSDVEDVYSDLYSTFSQLTSTTAD
                     DVDQSPCKLSPRMLFISAGACVCGLLFGYDTGVISGVLLVMAPQDISQEKITEFQKEV
                     VTAIACLGSFFGSMLGFPLSDRYGRRTTMALCCVVFIIGGVWMALSTSLSVLATGRLV
                     VGIAIGVAAQCVPVYLSEVSPANIRGTVLTLNSMAITGGQLASYIMALLLADRKHAWR
                     YLFGLSAIPALIFLLLFRFMPESPRWLVLKGEFPRAHATLRVIYPAATPSQVSLKLRR
                     LVLDVCKLRKYEDIEQPLIARPSLFARCARLSSSKQSQEVNPDGSTNSILSSTHVPVA
                     RQHQRRQKHRMEPRTRRALIVGCVLMFFQQASGFNAFMYYATLIFADLNVQNPLVPAT
                     LIALTNFLFTLVAFQLVDTVGKRSMLLHSIWIMTLGLLLASFAFSEANTPLVLFCIIL
                     FVASFASAMGNIPWSSVELLPLNRRSFGASCISCTNWLTNMFMSLSFLSLVDHFGISH
                     TMWIFAVFTALNWIFVYYWYPEVKGLTLEEIGKVFENGIDVHYVYRNYH"
     gene            <882003..>883400
                     /locus_tag="HG536_0A04880"
                     /db_xref="GeneID:59323770"
     mRNA            <882003..>883400
                     /locus_tag="HG536_0A04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281453.1"
                     /db_xref="GeneID:59323770"
     CDS             882003..883400
                     /locus_tag="HG536_0A04880"
                     /inference="similar to AA sequence:RefSeq:NP_010676.1"
                     /note="ancestral locus Anc_5.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137348.1"
                     /db_xref="GeneID:59323770"
                     /translation="MFNLSLGFRVGLKKGGTGRRDHLAGVERAEGYRQQDMSFKGFTK
                     AMARAPQSFRQKFNMGEQVEDPVYEDAERRFKELEIEVKKLSEESKRYSSAVNGMLSH
                     QIGFAKAMEEIFRPISGKMSDPNATVPEDNPEGIEASEQYRAIVAELQETLKPDLKLI
                     DEKIMAPCSDLLKTIGYIRKMATKRNHKKLDLDRRYNTYKKYEKKESTNPKDEEKMFK
                     AQAEMEVAQQEYDYYNEMLKNQLPVLFGLEAQFVQPLFVSFYFMQLNIFYTLYNRFQD
                     IKIPYFDLDSDILEAFQYKRGNVEEQCDALTITHFKVGYSKAKLEMTRKRYGSQSPTS
                     PTAAPASGYPGSPTSAAAASGYGAYGAQQQPAQQSPVTTDSYQHAGAPPPAYAAVSSA
                     SAAPLAAGPPATSADTVTALYDYQAQAAGDLSFPAGAVIEVVQRTADSNGWWTGRYNG
                     QQGLFPGNYVQVNKN"
     gene            <884019..>885956
                     /locus_tag="HG536_0A04890"
                     /db_xref="GeneID:59323771"
     mRNA            <884019..>885956
                     /locus_tag="HG536_0A04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281454.1"
                     /db_xref="GeneID:59323771"
     CDS             884019..885956
                     /locus_tag="HG536_0A04890"
                     /inference="similar to AA sequence:RefSeq:NP_010677.1"
                     /note="ancestral locus Anc_5.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137349.1"
                     /db_xref="GeneID:59323771"
                     /translation="MTNSGSGAVAPTKSPISQLWKQLGGNPKSMSTDSLSLPSPVEPD
                     HRLNSEMGAVHMPVLSPKENSGEFGSSNKRLSGVWGASSPSSNEYRMYRDNFLSNRHG
                     FTGRVFGVSLSESLSVASAEVIVQSELVSFGRIPIVVAKCGAYLKANALETSGIFRIA
                     GNSKRVKELQYIFSSPPDYGSKFVDWDAYTVHDVASLLRRFLNNLEEPLIPLDLYEAF
                     RKPLRDRPRILRHMAKQVVPSPAAENEDTILLRRPDTATDKDDRDNDGDEEKEEDDPA
                     VAEEKKRKSQRHRKRLIRDIKAAIKDYENLFISISNDTKQLTIYLLDLLSLFARQSQF
                     NLMSGRNLAAIFQPSILSHPQHDMDPREYELSRLVTEFLIEYSYKLLPHLLRLARDEQ
                     QRPIQQGRENGELEAPKPRKLVVTNENNESVTVSPSAPIDIPALDSSAAQDNPPTSTT
                     VAPNTTTFESPTKSSTRQPLKVPKIRRPHSRSIGSAPVPPDVIASSRRRSRLFPWLPK
                     PGILSDNGGDFTATEEEGDESNFDDENRETMVSSPVSAQSTSLPRHHLHIPPMNRTFS
                     GNSTTSSLTRRPMSAILGGSRNGSMDALENASANQANESTLARTTLLEDSETEEGTTR
                     SRKRDSWFQRLRSRSRSNTRS"
     gene            complement(<886073..>887944)
                     /locus_tag="HG536_0A04900"
                     /db_xref="GeneID:59323772"
     mRNA            complement(<886073..>887944)
                     /locus_tag="HG536_0A04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281455.1"
                     /db_xref="GeneID:59323772"
     CDS             complement(886073..887944)
                     /locus_tag="HG536_0A04900"
                     /inference="similar to AA sequence:RefSeq:NP_010678.3"
                     /note="ancestral locus Anc_5.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137350.1"
                     /db_xref="GeneID:59323772"
                     /translation="MARESNIVKIVGKENFQRLRSLRCLIVGAGGIGSELLKDCILMG
                     FGEIHIVDLDTIDLSNLNRQFLFRHRDIKQPKSTTAVKAVQHFNNSKLIPYQGNIMDT
                     VQFPLRWFDQFDIIFNGLDNLAARRYVNKIAQFISKPLLESGTSGFDGYIQPIIPGET
                     ECFDCTKKETPKTFPVCTIRSTPSQPVHCIVWAKNFLFNQLFNEETSSVDETSTDWGT
                     ENKEEIERIRQETNELHELRQIILSRSEEHIKDILTKLFVKDIEKLLRIDNLWKTRTK
                     PAVLAQSLIEDASQAVMSEAQSLSSLWDIREQIIQFFAITKKLMQRVHNGETNIEFDK
                     DDEDTLLFVATAANIRSHIFNIPMKTVFDIKQIAGNIIPAIATTNAIIAGLSTLTALR
                     VLNLLPYEPTKKSTDLNMAFTAKASNLSKDRYITNPKLAPPNPSCPVGGKVCRGVIKI
                     TQEGLNEIKLSKLITIIRQKYQYPEEISVVDTNNQRLLADFDFDDLMERTLSQVNLHD
                     GSVILFSDEEGTAEATYRKSLELYIEVIDGSLEGGIRLPDVEVPTIAVPQNIADIDHA
                     EKKQEKSINDESVIDVDFDEKSEAPCAKRRAPEKAPENALKRVRKDEEYVDGLIELD"
     gene            <888657..>889769
                     /locus_tag="HG536_0A04910"
                     /db_xref="GeneID:59323773"
     mRNA            <888657..>889769
                     /locus_tag="HG536_0A04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281456.1"
                     /db_xref="GeneID:59323773"
     CDS             888657..889769
                     /locus_tag="HG536_0A04910"
                     /inference="similar to AA sequence:RefSeq:NP_014779.1"
                     /note="ancestral locus Anc_5.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137351.1"
                     /db_xref="GeneID:59323773"
                     /translation="MLRSQICRRAVNRLLATAPKQPSIGRFTGKPNPTTGKYTVSFIE
                     GDGVGPEISKSVKTIFAAAKVPIEWESCPVTPLLVNGVTTIPEQAQESINRNLVALKG
                     PLATPIGKGHRSMNLTLRKTFGLFANVRPARSVEGFKTTYDNVDLVLIRENTEGEYAG
                     IEHVIVPGVVQSIKLITREASERVIRYAFEYARAVGRPRLVVVHKSTIQRLADGLFVT
                     VAKEMAHEFPDIKLQTELIDNTVLNVVSNPAQYSDAVSVCPNLYGDILSDLNSGLSAG
                     SLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEHANKI
                     QNAVLSTIAAGPETRTADLAGSATTSSFTEAVIKRL"
     gene            complement(<889848..>891503)
                     /locus_tag="HG536_0A04920"
                     /db_xref="GeneID:59323774"
     mRNA            complement(<889848..>891503)
                     /locus_tag="HG536_0A04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281457.1"
                     /db_xref="GeneID:59323774"
     CDS             complement(889848..891503)
                     /locus_tag="HG536_0A04920"
                     /inference="similar to AA sequence:RefSeq:NP_014780.3"
                     /note="ancestral locus Anc_5.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137352.1"
                     /db_xref="GeneID:59323774"
                     /translation="MKLRIRRIARTLRRVAILLVLLFFYFARSSFIVHVKNTFYEPTS
                     EEYRYGLIDEVRSIRCYRWYRHCGTLFARQSASSDSVLSWSRISKNLTDESLYSIEST
                     LFYMTFLYVHQWEPSSEKSPITELAISRHSSLIPIQVTQDVQKLIKVSDSSVFHDHIH
                     RQEKNVLNIFGGEQSDLDIVHSLGEDWQYNGGGIWCKRRTDQSPITSLEIYLGSGFHE
                     SRPNWKEVIHEYDRSLGSRRLPLSVTREISGPKEKADLLDYNYAGISLNAHGDSSKIL
                     QVSDVHFRCSDETAAVLNEFQTKHFISDVITREWPDLVVITGDFLDGQNSLDYQTCIM
                     KLVQPMIRLKIPYVFTLGTSDHSRFATGSQIRDFLSNLPFCINKASSSDGHTVMTASF
                     KTGAGVVVYAFDSFQPIKPFLMEHEAYKHYKYALAFRHLPIPEYRPEGMFPIIGQYNE
                     QSNYKSKLKEEETMHKLLRSFNVKAMSCGHEHSNDCCLQSLGDMWLCYAGSSGVGIDR
                     ANGMEPSVRLFKVDDVHGLITSWKRNFRMIDSVYDYQYIFQEK"
     gene            complement(<891910..>893787)
                     /locus_tag="HG536_0A04930"
                     /db_xref="GeneID:59323775"
     mRNA            complement(<891910..>893787)
                     /locus_tag="HG536_0A04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281458.1"
                     /db_xref="GeneID:59323775"
     CDS             complement(891910..893787)
                     /locus_tag="HG536_0A04930"
                     /inference="similar to AA sequence:RefSeq:NP_014781.1"
                     /note="ancestral locus Anc_5.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137353.1"
                     /db_xref="GeneID:59323775"
                     /translation="MNDMDAIRSLMEMGIARDVAEEALKRTDGDVEAAGNLIFSNELP
                     AGISENVGQSAHVELPAAAGDGCRPGDVDAYAVEVPRSESEGWEEIEVEDEYNQDEAS
                     LEESCLKSQISVPTVVAPLPPNFLFENYFALFCLFVSNYLPHIVAKPDFKDLNYDKDW
                     YRGNSLRSPDCRVALVSKDDGGEEEAEIVPEGQLSAEEREYTLQPELLWQLQRLSCVV
                     NSRISDRAFVRAKMFAIALEPQVQRKLGDVEHLYEILPSFIKSLTVDLEMCPGFDDND
                     VRQLFISSAFHTPPNPDLQQEPTTKTWLSLFHFLPEEYDTNLYRMFHILLYPEDTVED
                     GDEQLPLPAAEENENSLCDIAPVLTIVFDEMEENTDSVPLAEGVEIPLEFYPQLYTKR
                     CKEKLIMDIIAKRKQSQLDSRAILQEIANLKSFQGKDILKFINSSLDYLQKDGKPQDT
                     IDALLSVKDYITEQKTQKMNEYKKLAHRLQTEWNLSRPEIQVIQTAKDLGLIDEPYLL
                     VMAVITPYMYFSRDRNGQWYYVRSRPHEPGNHIRACSSPLEVQDSIKQFTRQPSESPL
                     MFIYCKEGFIPNDETVWKALENNQGCTKFAKEDQLQLNKMRDQSSSSISTTSASAPPA
                     L"
     gene            <894648..>896909
                     /locus_tag="HG536_0A04940"
                     /db_xref="GeneID:59323776"
     mRNA            <894648..>896909
                     /locus_tag="HG536_0A04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281459.1"
                     /db_xref="GeneID:59323776"
     CDS             894648..896909
                     /locus_tag="HG536_0A04940"
                     /inference="similar to AA sequence:RefSeq:NP_014783.4"
                     /note="ancestral locus Anc_5.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137354.1"
                     /db_xref="GeneID:59323776"
                     /translation="MAQRQQQQQMQLQMQCHEENNGSIRKSSILAGNPASNQAAGGNA
                     GGSSGGSGVHGPLQNTVFIHKLYNILEDEDLKDLIWWSPSGTSFLIRPTEKFSRALAT
                     YFKHTNIASFVRQLNMYGFHKVSNDHSKDVQQQQQQQTQPGPETAGESIKIWEFRHSM
                     GIFKRGDIEGLKLIKRRSSRNIATLNGRKNSASAVSLGPTHPQIEESDAAKQQRSQQQ
                     PSVPPAPPPAPPPQQQQWQTAQQRQQSQFIVSAEEEAQQQSQVGLTAYPSSESVFNQQ
                     FQQQQLETRFAELCQSYSGLRYEYSNLQYRHDGLLEQLRVMNVDVAKLLDFVQSLVSL
                     QGSNCDIFNEKNLKGDPAKLQQFRQHQHEMTALEQEMQKFKANLMQRFQKNLETLQQQ
                     QQHNPSVPQQPPHVLQYGANMLHGHATPSISKDMRPVSGSSIPSNSSAAAAFVPHLFS
                     VPSAPTGAIFQQTGPLISQPDHFSSPRIVMMNPFETTGQSSTVKRNMSILMDPLSSAP
                     NVGGVTVSPSRPIPGTLGSQIPRNPSPLVNSSRPPKQEPPLHTNYSNQQTQINAHTKR
                     TSRISVKDGTFLLKPNKNSTLSTKRSSVNSDCSSRSDSAAMLPTSGSGLATSTVETVG
                     PRDSSAIGLPFRTFYSHGTNGDQAKEDPTKNENLPSRLGTYVTLHNAGSFAPPRSTQT
                     SPKQFELKKSNLEASDQTEPAQQTILSPMPSRSDIQNRRASSGVYSLLNTEAASPRSS
                     TELDTNPKKKTKL"
     gene            complement(<897101..>899674)
                     /locus_tag="HG536_0A04950"
                     /db_xref="GeneID:59323777"
     mRNA            complement(<897101..>899674)
                     /locus_tag="HG536_0A04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281460.1"
                     /db_xref="GeneID:59323777"
     CDS             complement(897101..899674)
                     /locus_tag="HG536_0A04950"
                     /inference="similar to AA sequence:RefSeq:NP_014784.1"
                     /note="ancestral locus Anc_5.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137355.1"
                     /db_xref="GeneID:59323777"
                     /translation="MLRYMIITVASFVFLQVGQQTFEVMVVYEEAIEIPLVDDDEDDE
                     EDDSVEEQDHGHNQEQDTVKEEDDDEEDEANLQVPEISRSATATPLSHRNTVDGEQDE
                     DYEDEEVKSSERARKHARADQSKAPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGI
                     EKVENTTLPATGLFQPVLLINQKNYSSDYLKKDEQMFALRERKTLRNNTQASSIGNTP
                     DIADLKNGTAEPADMTVAAEEDIDLSDANKTLVIHPGSRTIKVGLAKNEVPLVVPSCV
                     AIPKSESSFNTSEIPITADQPSEFEELKATIQQSFKERMRYYKRKVPYNAREQVLTFN
                     RASKPQFIEDKNDPDPKEWINRADRRYYGVEATRCSKENFTVRYPFTKGGSFNVSSPY
                     YASLQDLMHDVISLLEYALSSDGLSITRAQYSQYKVVLVVPDLFEKTHVEMFIRTLLT
                     EMQFQAVAIIQESLATCYGAGQSSSTCVVNIGTTHTTIACIDEGSVLENSLISLNYGG
                     DDITRLFALLLMQSEFPYKNWDLNSSHGWLCAQELKEKYITFQDANVTVQLYNYIKRI
                     PGQPLEQYEFKVFDEVMVAPLALFYPEIIAYLHSKQSQESGNAKLEEQLPASRDIFTS
                     NLNDWRSLSQNECLNGELYCGSNQDERMLSKLLDLQTNIEELQNEDLLEPDRRKNYTP
                     LEKAIIQSITNASISLDVAKMMSFYSNILVVGGGSEIPALDFVLTDRISIWRPRLLSV
                     SSFANFFKKLAKKAKDIRTAAKSANPEDEDKSPQKIKEMIKEELEEYWEGAEAQNGNE
                     HLLPVNVLPPPRDMDPAVLTWKGASVLAQIKLVEELYLTSTDWDIHGSRILQYKCLFA
                     Y"
     gene            <900442..>901428
                     /locus_tag="HG536_0A04960"
                     /db_xref="GeneID:59323778"
     mRNA            <900442..>901428
                     /locus_tag="HG536_0A04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281461.1"
                     /db_xref="GeneID:59323778"
     CDS             900442..901428
                     /locus_tag="HG536_0A04960"
                     /inference="similar to AA sequence:RefSeq:NP_014785.3"
                     /note="ancestral locus Anc_5.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137356.1"
                     /db_xref="GeneID:59323778"
                     /translation="MLRSTFSRTPALRRLFSREATPNDRTIKNLSLPESTKVIIQGFT
                     GKQATFHAKISQEYGTNIVGGTNPKKAGQMHLGQPVFASVKDAMKETGATASGIFVPP
                     PIAAAAIKEAIEAEIPLAVCITEGIPQHDMLYVAEMLKSQDKTRLVGPNCPGIINPGS
                     KVRIGIQPPKIFKPGKIGIISKSGTLTYEAVQQTTLAGLGQTLVIGMGGDAFPGTDFI
                     DSLKLFMDDPATEGIIMLGEIGGQAEIEAAEFLKEYNFSKPNPLPVASFIAGNVAGQM
                     KGVRMGHSGAIVEGSGTDADSKKKALREAGVVVVESPGHLGKALLDEFARLK"
     gene            903007..903078
                     /locus_tag="HG536_0Atrna2G"
                     /db_xref="GeneID:59324261"
     tRNA            903007..903078
                     /locus_tag="HG536_0Atrna2G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGG"
                     /db_xref="GeneID:59324261"
     gene            complement(<903168..>904118)
                     /locus_tag="HG536_0A04970"
                     /db_xref="GeneID:59323779"
     mRNA            complement(<903168..>904118)
                     /locus_tag="HG536_0A04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281462.1"
                     /db_xref="GeneID:59323779"
     CDS             complement(903168..904118)
                     /locus_tag="HG536_0A04970"
                     /inference="similar to AA sequence:RefSeq:NP_014786.1"
                     /note="ancestral locus Anc_5.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137357.1"
                     /db_xref="GeneID:59323779"
                     /translation="MSEWCKENEERIPVAIDPSKYSHRLDLKGCIKPASRTRSVLLIL
                     NQKINIPSVFLKLWGLFKLKVCADGGANRLYDFFDGNEPARAYYLPDYIIGDFDSLKP
                     EVEQYYRNAGVILIKQRSQFSTDFTKALHLISIHFNDASFVSQISQSKQENHSIEINS
                     GIHDWYYRILGSSGHRESEKISLLAIGAIDGRFDQTMHSITQLYKLSSSASQFRLSYL
                     SATDLIFFVPSGGVLLEYTADFREKCIGNCGLLPLNGPTEIYETAGLKWDVGLWETSV
                     ASGKLSSSNRFAGIDKCYINVKDGIVMNVEVYIDRLAEYI"
     gene            <904325..>905311
                     /locus_tag="HG536_0A04980"
                     /db_xref="GeneID:59323780"
     mRNA            <904325..>905311
                     /locus_tag="HG536_0A04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281463.1"
                     /db_xref="GeneID:59323780"
     CDS             904325..905311
                     /locus_tag="HG536_0A04980"
                     /inference="similar to AA sequence:RefSeq:NP_010680.1"
                     /note="ancestral locus Anc_5.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137358.1"
                     /db_xref="GeneID:59323780"
                     /translation="MDKHKYRVEIQQMMFVFGETNDPPVETTSLIEDIVRGQVMEILL
                     QATKTAQARNSKTILPEDVIFLIRHDKAKVNRLRTYLLWKDLRKNAKDQDAVAAGSSS
                     GGPGDEEEKKGAAEKDDKDGGNVMKVRKSQIKLPWDLQFMFNEQPLENNDDDEELDED
                     EREANLATLKKLKMADDRTKNMTKEEYVHWSDCRQASFTFRKAKRFKDWSGISQLTDS
                     KPHDDVIDILGFLTFEIVSSLTEAALKIKKHEQRLQLQKDELQQNGSDFNFEVTKMHR
                     KKRLFDGPDNVVNPLKRKHVEEAWRTLQTIDMKHRALTNFRGGRFSSRPIIM"
     gene            complement(<905383..>907674)
                     /locus_tag="HG536_0A04990"
                     /db_xref="GeneID:59323781"
     mRNA            complement(<905383..>907674)
                     /locus_tag="HG536_0A04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281464.1"
                     /db_xref="GeneID:59323781"
     CDS             complement(905383..907674)
                     /locus_tag="HG536_0A04990"
                     /inference="similar to AA sequence:RefSeq:NP_014787.3"
                     /note="ancestral locus Anc_5.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137359.1"
                     /db_xref="GeneID:59323781"
                     /translation="MKKATTLTELLNGYGGARKSGEEASDEEAIAYIEDQKRESMRDE
                     DETMESIDTSMGLNSSPSLATSEIASQEKSGGSVQSFLMNSRLRKADPQPVKGSVEKA
                     EVISLDDDFNDEQNLENEGAEELLTTVSRVTAPSNFKKTALKDLFNSFKPSTEKQVKL
                     NSSVVSSSFIGSESRKSKRVVAINQAPFPSRQLIEPPDDIIDRKGLKICLNARETVAP
                     QTIPFTLDEYKTLKIRDGLNSRFRRVKIVKTRRKYSVLWPELLKPKSLKEVLLEPSLK
                     ENVSEWVAQAFIKLKKPTTRNKMLKRQRIEDDPLDSFIVDDEMDDARLREDFVPLMIL
                     FGDGIGKNVLIEVLMKDHGGQIYEVNASSNRSKKDILESLLEFSTTHYVKGQGSKGII
                     LLDDVDVLFKEHDKFFWQTIEKVLLTTRRPIIMLCRDLNFVPSNLVHLAVSENSLFHC
                     KRVSHQTVTKFLERYCRKLDVEIDQSILQVLVTCSKKDIRKCLMDLEFCCTPPGELKV
                     PEASPQPKPPKQNLAEALECAELLSWTDVLESKTYWKSSILHDADKTLMTPHTQAMVG
                     NMSDEQQRLQSDYMVDYRLHLVDNVNQAQLPFELNIGEYLKEILPNTELAKLTKYSKL
                     QRARYDKMKKASISYLSTRIEKKGLAGVRFRKTRNSRKIQEILEGFDGSCSSQDHNES
                     VVFDFEINTSTSIKEQINPYVLEIAKKEFQIKQENRKLFLEQCEGVEKAQYNEVAWRL
                     TRERLLKPIWFQADPKPVIDSWR"
     gene            complement(<907860..>908681)
                     /locus_tag="HG536_0A05000"
                     /db_xref="GeneID:59323782"
     mRNA            complement(<907860..>908681)
                     /locus_tag="HG536_0A05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281465.1"
                     /db_xref="GeneID:59323782"
     CDS             complement(907860..908681)
                     /locus_tag="HG536_0A05000"
                     /inference="similar to AA sequence:RefSeq:NP_014788.1"
                     /note="ancestral locus Anc_5.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137360.1"
                     /db_xref="GeneID:59323782"
                     /translation="MVAPTALKKKDTVSENAGGDGASRIIGVDNTREIDEDDDDVMVG
                     QEEEAVADESTTEQDKEQQIRESKAVVLDEQGKPRFGSANLAKNAKVKLESRKVAVPP
                     HRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA
                     FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENA
                     TRTRIVLADAKIHILGGFTHIRMAREAVVSLILGSPPGKVYGNLRTVASRLKERY"
     gene            <909057..>911066
                     /locus_tag="HG536_0A05010"
                     /db_xref="GeneID:59323783"
     mRNA            <909057..>911066
                     /locus_tag="HG536_0A05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281466.1"
                     /db_xref="GeneID:59323783"
     CDS             909057..911066
                     /locus_tag="HG536_0A05010"
                     /inference="similar to AA sequence:RefSeq:NP_014790.4"
                     /note="ancestral locus Anc_5.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137361.1"
                     /db_xref="GeneID:59323783"
                     /translation="MSWNKSLMVPSRCSLPVHRLSRAFLGRNILTNFAHRSLLTSTDA
                     CTKENISQVKCFNSRSVGFPVRQACGFEMKRFLSRLVLRSRLSTLCAQSIRRSESAGI
                     VVNRSFHCGKVFLNQSNQQNGNHEDFLSKNTDYLHIQNILLQKNQERMNKKRMLSEAT
                     NFYERFKVNTKWLLIRNNRPFSANEISTMFSWLLISQIAWIILGTTTFVSILLLIFNT
                     VFAKEMVGRCIGKLLNAFLDDIDIKFQDALVPKWKNGCIRFNKVELRTVGKDQDVVEG
                     AGCREGSNLEFQLKFHQIELTLSLKKWLFGHGAIKDLSLYGMRGDVNIDYAYEPNPQR
                     LFIDWFSNKDYELGKVQLTDSCVNVYDKQLDMKYRVSIYNLSMPQLRFRWILPDFFNA
                     DVATGAINHALFTIHKRQHKLVYLNDMEKDLSPWKRISRLRLDAINVKDLGLNKSNTF
                     NWFEDGELEITADVMLPHEDSEPQHDADKKKYMVFDLRFKFKNARARFPDEAPRLSSG
                     EEIISLEELKPLISYINTQNSYCRSMASIENTNSVWNSSNVSISKTRSYPNVTVIPSA
                     AQWAHSEDEVGPKGQEIIRFHDQPQHNGNELVLRCRIVKNIQELKDKVMFQETGIYDT
                     LSMELYVDLIRMVEEWEYNKKNDWMKLWGTTVASQLLLFGLGAMV"
     gene            complement(<911361..>912011)
                     /locus_tag="HG536_0A05020"
                     /db_xref="GeneID:59323784"
     mRNA            complement(<911361..>912011)
                     /locus_tag="HG536_0A05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281467.1"
                     /db_xref="GeneID:59323784"
     CDS             complement(911361..912011)
                     /locus_tag="HG536_0A05020"
                     /inference="similar to AA sequence:RefSeq:NP_014791.1"
                     /note="ancestral locus Anc_5.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137362.1"
                     /db_xref="GeneID:59323784"
                     /translation="MSSGFSLKIAKKPKKGSKPTKKGGSQKKQSVFGGDQKNATRSKI
                     SLTHVERYTEEKPKELIIKPGILRSSLWEIPAGPEENQVKYGLTYNETNRGQGLPAQS
                     STTRKPLQSSNLRWLEELPEVTNEDEYEEVPVEEFGEALLRGMGWDGTRENSDLQEKN
                     YSKLPHEQGRPLYSGIGAKGAEASQAMGKISESSFMPLVRINRKTGERVDSTKTEG"
     gene            <912153..>913520
                     /locus_tag="HG536_0A05030"
                     /db_xref="GeneID:59323785"
     mRNA            <912153..>913520
                     /locus_tag="HG536_0A05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281468.1"
                     /db_xref="GeneID:59323785"
     CDS             912153..913520
                     /locus_tag="HG536_0A05030"
                     /inference="similar to AA sequence:RefSeq:NP_010681.1"
                     /note="ancestral locus Anc_5.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137363.1"
                     /db_xref="GeneID:59323785"
                     /translation="MIQRWQRPAFRVGETLLYQRWGLVVNLRHASGGPLHQKKALPEA
                     KKSKVTGNLWEPLGTHWKKVKGQLKDTRSILSRHVSQFSYHVAKARMSIMEANKKLAE
                     QEQEGADQRLTYDRDMETSETIRDLPSQRELHRRRWSRKLEFYFDSLQETIFTATRAL
                     NDVTGYSSIERLRKSIEIMENNMEDCRETLRNLKDKYATAIEERKQSQKQLNELLQRK
                     STWSPADLERFTQIYKDDALNQKREQALKLEVSAKETQQEKLSDDLYRAILTRYHEEQ
                     IWSDKIRRTSTWGTFILMGVNIILFLVFQLLLEPWKRRRLTRSFEDKVKNALDDYAAR
                     QDMKLEQLRANIAQPAAISTILDEQIDRAQADDASTEELTATASSSEPAQEVTAAYNL
                     EDEISERRSLVRRLRMWIQDLLYKFCPPAISHVHSKTILSNLELYVYSTLLILLGALS
                     ARFMP"
     gene            <913727..>915007
                     /locus_tag="HG536_0A05040"
                     /db_xref="GeneID:59323786"
     mRNA            <913727..>915007
                     /locus_tag="HG536_0A05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281469.1"
                     /db_xref="GeneID:59323786"
     CDS             913727..915007
                     /locus_tag="HG536_0A05040"
                     /inference="similar to AA sequence:RefSeq:NP_010682.3"
                     /note="ancestral locus Anc_5.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137364.1"
                     /db_xref="GeneID:59323786"
                     /translation="MEELGVVNPVETAVAERNTVKSYGALLSQLNNNGTNISSSGNTD
                     VYLTLKKLEKELELLILQGEYIKDEQRHLKRELLRAQEEVKRIQSVPLVIGQFLEPID
                     ENTGIVSSTTGMSYVVRILSTLDRELLKPSMSVALHRHSNALVDILPPDSDSSISIMS
                     ENEKPDVTYADVGGLDMQKQEIREAVELPLTQADLYQQIGIDPPRGVLLYGPPGTGKT
                     MLVKAVANSTNASFIRVNGSEFVHKYLGEGPRMVRDVFRLARENAPSIIFIDEVDSIA
                     TKRFDAQTGSDREVQRILIELLTQMDGFDQSTNVKVIMATNRADTLDPALLRPGRLDR
                     KIEFPSLRDRRERRLIFGTIAAKMSLAPETDLDSLIIRNDSLSGATIAAIMQEAGLRA
                     VRKNRYVILQSDLEEAYAAQVKTDNDVDKFDFYK"
     gene            complement(<915089..>916618)
                     /locus_tag="HG536_0A05050"
                     /db_xref="GeneID:59323787"
     mRNA            complement(<915089..>916618)
                     /locus_tag="HG536_0A05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281470.1"
                     /db_xref="GeneID:59323787"
     CDS             complement(915089..916618)
                     /locus_tag="HG536_0A05050"
                     /inference="similar to AA sequence:RefSeq:NP_014792.4"
                     /note="ancestral locus Anc_5.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137365.1"
                     /db_xref="GeneID:59323787"
                     /translation="MNLRRLEVLGLAIGLFLSVQLSYIHPDEHFQSLEVLAWRFFGIN
                     GAIPWEFQSETAARSFVPLLLNYGPLFCVFKATKVDNPLVILRLVRIQNYLTFIATSR
                     YVMKRLYGAFSAKWCNFFIATSYISGCFQSHSFSNSFETIVLLIVLALYNELLPHVRD
                     HKTQAYKISCLLGFLISLGCFNRITFPAFILFPSLVVFWRFFRTHQGPLALLLVSSTV
                     SSLVFILIDTRMYQSNGLTVAPLRNLLYNFDEANLEKHGLHPRYHHILVNLPQMLGPA
                     ILLTNPRRHNFKNSSRGLVISAIASGMLFLSIFRHQELRFLLPLGPLLFACLNPNASI
                     ASINSAFIIKLWLVFNVILGTIYGVYHQGGVLKVLGRFQEQKAVGVHVWWKTYSPPTW
                     MYMNKELVVSTTMLEQGIETVDQIPFEAISNHVIDLKGCADGLLNSTLHSFLENGANV
                     KLIAPDSLAGRLDSLQRSGSLTLTPSDRISGHLDLDHLDISDLSTFQPGISVYSVELS
                     R"
     gene            <916872..>919721
                     /locus_tag="HG536_0A05060"
                     /db_xref="GeneID:59323788"
     mRNA            <916872..>919721
                     /locus_tag="HG536_0A05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281471.1"
                     /db_xref="GeneID:59323788"
     CDS             916872..919721
                     /locus_tag="HG536_0A05060"
                     /inference="similar to AA sequence:RefSeq:NP_010683.3"
                     /note="ancestral locus Anc_5.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137366.1"
                     /db_xref="GeneID:59323788"
                     /translation="MHDEQAILACVEQTMVADAKVIKEAEQQLFEYQKQPGFTTFLLQ
                     VVSNEEIPTHIRLSSAIYFKNKIFRSWNTPNREDGIKPEEQLVIKENLIQSLVKNSEN
                     NHIRPHLTESVRGILDNNDDWDLTGVINELLNSGKEEYVYSGLLLLFQTCIAHRWDMA
                     DNRKEIDRVVSVVFPTVENIASQLVNREDYRANELMYLIIKCFKYACLNNFPQYFSNL
                     EKLNAWIQLHLYLCAKPLPKEVFALDPSDRCLDKRVKVNKWGFGNLNRFIHKFSRVTK
                     SVSEQFVSYVFNNIIPTILQEYFKVIQAWRDNSLWLGEASLHYLIQFLEKCLVTEEVY
                     PLIQPHVSTIIEKVIFPCLSANEESVQLLEEDPEEYTRRYFDLNKESSTADVASCDFV
                     FVIGHKRPSELDKVLPFVNGVFVSYNEHPEDISVAFKQEGAMRMISTLFTFLDSPESL
                     EAIFSHYIVPFLSQSRYPFLVARALETISVYGNEFQDMDTLSRLFQLTYDHFMNSNVL
                     PIQIEAADALKALVVSNPKIHSHISAQVPGIMEKLLRLSKEFQIDILSEVMEVFVERF
                     ADELTIFAEDLAANLADQFLQLGRSLVDNSGNSYSTGDQDSEIQASALLQTMTTMVMS
                     MSKVSLIDKFLPVVKFVVVNAQISFLTEIVDLMDSLALSSQALFNQFTPAIWEMVHDL
                     LDSFQTYAMDYFEGYLIFFETLVTHGFPQDQTFLQPFLEILSVKLDSDIDYDVESVLD
                     ILVFYALSMRDIQLFDRALRASSNDELQLDDGDIVKTFLANLSVKPVETLQISENEGA
                     TLVLLTKWFSCKFSSVFSIKLQIMAILSLFKLPELPGCVKGFTSQFAEKLVSLMEKLP
                     DAIRKRDAISKGEEGVEEMFGNDANPDEDDYFEDYEEDLKETVLDQINIFQEVHSFFA
                     RLQASDAEKYQTIINSLNDDKRHSLQVILEFVSQN"
     gene            complement(<919809..>920270)
                     /locus_tag="HG536_0A05070"
                     /db_xref="GeneID:59323789"
     mRNA            complement(<919809..>920270)
                     /locus_tag="HG536_0A05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281472.1"
                     /db_xref="GeneID:59323789"
     CDS             complement(919809..920270)
                     /locus_tag="HG536_0A05070"
                     /inference="similar to AA sequence:RefSeq:NP_010685.1"
                     /note="ancestral locus Anc_5.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137367.1"
                     /db_xref="GeneID:59323789"
                     /translation="MANELEDVSLPKATVQKIISEVLEPDLTFSKEAREIIIKSGIEF
                     IMILSSMASEMAENDAKKTIAPEHVIKALEELEYNEFVPFLEQQLAEYKGSQRIKEKR
                     DAKFKKSGLSEEELLRQQEELFRQSRSRLQSSVSGASSDGGSTGVKAEDDH"
     gene            <920690..>922588
                     /locus_tag="HG536_0A05080"
                     /db_xref="GeneID:59323790"
     mRNA            <920690..>922588
                     /locus_tag="HG536_0A05080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281473.1"
                     /db_xref="GeneID:59323790"
     CDS             920690..922588
                     /locus_tag="HG536_0A05080"
                     /inference="similar to AA sequence:RefSeq:NP_010686.1"
                     /note="ancestral locus Anc_5.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137368.1"
                     /db_xref="GeneID:59323790"
                     /translation="MSALDLPVVASEYDCDGRYLCYVTVVLNKQRVSVQLAERGTAIN
                     ENVLYLDDSNLKVCALKWGRLVSTDTVCVFLALNNGEIWIYSPLANEVVHKLSTGNGS
                     QVNDVAVSKSGDTLWCVDAQDRIYQFGLDDLSLKRQFQVDSCSALNRICPLGDDSRKV
                     LVASHSVFLVDVDTKTVVQTFPGHTTPVTHLVSLTEDYFVTGAANDRFLNVYDLDTGS
                     TKSVLVLQSEVLEFSHSGEHSIAVTTEEGVEIFANPLVSNVANKKRRGNISKQCTKAI
                     NVNYNLNGNVSRLPVLNVSINGDIINLVWLQNATIPYFAHLKWQELPIQYTFDVAAAT
                     DGRSGKDDRSLHGKEVSAVTGYREGNVRITHGDNFKHVDDAIKQWEQEVSQRESEDVD
                     NATESLADKLELATMHVSKKKSSNATTAGTVTIVLSQALQSSDHSLLETVLNNRDEKV
                     IRDTIFRLRPALAVILLERLAERIARQTHRQGALNVWVKWCLIIHGGYLVTIPNLMSS
                     LSSLHSTLKGRSALLPRLLALETRLDSVLNRLHPIHNIDDAVIRTSSLHDEANQQDED
                     DDDEADVEYNEELDDAGLIEDGEDDYEYDESDASEDDLPNGLAAGNHPEDLEASDNEE
                     AGYSDVEM"
     gene            <922817..>923464
                     /locus_tag="HG536_0A05090"
                     /db_xref="GeneID:59323791"
     mRNA            <922817..>923464
                     /locus_tag="HG536_0A05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281474.1"
                     /db_xref="GeneID:59323791"
     CDS             922817..923464
                     /locus_tag="HG536_0A05090"
                     /inference="similar to AA sequence:RefSeq:NP_010687.3"
                     /note="ancestral locus Anc_5.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137369.1"
                     /db_xref="GeneID:59323791"
                     /translation="MSEEKVYISYNNVHQLCQETAPKIRNFNPDIIIAIGGGGFIPAR
                     ILRTFLREPNTPNIRIFAIIVSLYENVQTAAGGTVEQIGVKVHRTQWIDYEQCKLDLV
                     GKNVLIVDEVDDTRTTLHYALSELQKDADEQAKAKGIDVEKNPEFKTTFGVFVLHDKK
                     KPKRADLPPEILEDSKRYFAARTVPDVWLAYPWESKDIVYHTKMAVEQGNDVFLP"
     gene            <923716..>924738
                     /locus_tag="HG536_0A05100"
                     /db_xref="GeneID:59323792"
     mRNA            <923716..>924738
                     /locus_tag="HG536_0A05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281475.1"
                     /db_xref="GeneID:59323792"
     CDS             923716..924738
                     /locus_tag="HG536_0A05100"
                     /inference="similar to AA sequence:RefSeq:NP_010688.4"
                     /note="ancestral locus Anc_5.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137370.1"
                     /db_xref="GeneID:59323792"
                     /translation="MTISAIPIWLDCDPGHDDVIAILLSCFHPAFKLVGLSASYGNAP
                     LENTTYNARSVITAFGKGHEVTVYPGAKKPWVLEPEYASDVHGASGLDGTTLLPVPDC
                     ELNVKESYLDAMEKAIVAYGGEISLVSTGALTSVATLLRDRPHLKKLIKYISIMGGGF
                     DVGNRNSHDSAEFNIWIDPHAANFIFSDPDIKNKCILLPLNVTHKAIATAEVQERIHA
                     NGRSKMRELFYELFKFFEHCYKDAQGFDHPPTHDPLTLMPLLEFYGWEASSVIQFSYR
                     RLDIYAVEHENSPDLGKTCIEKEYELSEGAGIMVGFDLNIEYFWEQVYNALNQAEQAS
                     TIERGR"
     gene            complement(<924803..>926299)
                     /locus_tag="HG536_0A05110"
                     /db_xref="GeneID:59323793"
     mRNA            complement(<924803..>926299)
                     /locus_tag="HG536_0A05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281476.1"
                     /db_xref="GeneID:59323793"
     CDS             complement(924803..926299)
                     /locus_tag="HG536_0A05110"
                     /inference="similar to AA sequence:RefSeq:NP_010690.1"
                     /note="ancestral locus Anc_5.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137371.1"
                     /db_xref="GeneID:59323793"
                     /translation="MTWAAALISVFFILVGHLIFKIVVPPLNFPRNIPTIPFYVIFLP
                     SIMNIDQRKLYDMYLREPLEKYGAAKLFFGSRWNIIVTRPELMAHVFKEEDTFAKSGN
                     QKKIPYAVIAAYTGDNVISAHGQVWRTYRSVVTHGLQHFDEAPFYNNAKLFCDGIEKM
                     SKMDDKKRQDILMGPLIQRLCLDNISQVALGFDFGALTQDDNQLHKHLTNIKKQIFHP
                     FFLTFPFLDLLPIPSRRKAFRDVESFRKQLVSKVQEQLVKNYKFEQTSFASSDLIRAY
                     NNEVIDYKQLTDNIVIILVAGHENPQVLLTTSLYLLGKYNETWQRRLRAEVDAVNGSK
                     ELSELPLLNSFIFEAIRLMPPLNTIINRKTTKACRLGPEIVIPKGTYVGYNNFGTSHD
                     PKYWGSDADEFIPERWGDDIQTIFKNWRHAKNAYMMTAFHGGRRACLGEKLALTEMRI
                     TIAEVLRRFEWTLAPDWQERMTPAGPLSPSNLKLLFKRRLEPKESCSL"
     gene            <926987..>928594
                     /locus_tag="HG536_0A05120"
                     /db_xref="GeneID:59323794"
     mRNA            <926987..>928594
                     /locus_tag="HG536_0A05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281477.1"
                     /db_xref="GeneID:59323794"
     CDS             926987..928594
                     /locus_tag="HG536_0A05120"
                     /inference="similar to AA sequence:RefSeq:NP_010691.1"
                     /note="ancestral locus Anc_5.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137372.1"
                     /db_xref="GeneID:59323794"
                     /translation="MTIIEKFIPITEGKPTGATLKKAVLSAKEDIAIPHNLSDLSTYS
                     KFLALYARNPEDAAYYSIEEKQDCKIKQEWELLFKYLQGTEPTESSISENLVEYIVPS
                     DVADRFTNSLGLPVKVSEYMKEGESQIRGCITTIENENDFNDWFIFHILDQTRLALSG
                     VPFESANAGQSYHEKFADFFQESLKNTIIDDQWEAGGRDYFIKRAKYFTDRNLKIECV
                     LPAFPCKSSNSDKVGGIYPDKGEEFALRRLMKATQDAQKVYPPGMKIWIVSDGHVFSD
                     CIGVDDDVVSSYTAKLHQLYEKIKIPGVDAIGFCGLNDLFFSGAAASKFKTEWIADVE
                     LDHLTGTQICPVSDVSRGILMRGCDTDDGRLRKQISIDGHPRLHLYRGFSRFMLEDLS
                     RLSYFEGSSRKGFKKTISRIAFNMIRRNDAYSNLVELIFPHHMRLSIHAHTNSGPKFG
                     IKVISSEQCRIVKSLDDLEEPKFEDLLHIPTPWHNCVVKVDDNHYVLTKASVVKEALE
                     NGSYVGQWVETSLELGEGGHYRIRKFE"
     gene            complement(<928926..>929441)
                     /locus_tag="HG536_0A05130"
                     /db_xref="GeneID:59323795"
     mRNA            complement(<928926..>929441)
                     /locus_tag="HG536_0A05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281478.1"
                     /db_xref="GeneID:59323795"
     CDS             complement(928926..929441)
                     /locus_tag="HG536_0A05130"
                     /inference="similar to AA sequence:RefSeq:NP_010692.3"
                     /note="ancestral locus Anc_5.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137373.1"
                     /db_xref="GeneID:59323795"
                     /translation="MFFVKDLSLNITLHPSFFGPRMKDYLKTKLLQEVEGSCTGKFGY
                     ILCVLDYDTIDIERGRILPTDGSADFTVRYRAVVFKPFKGEVVDGVVVSCSQHGFEVQ
                     VGPMKVFVTKHLMPQDLVFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
                     GSIKEDYLGAI"
     gene            <929701..>930195
                     /locus_tag="HG536_0A05140"
                     /db_xref="GeneID:59323796"
     mRNA            <929701..>930195
                     /locus_tag="HG536_0A05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281479.1"
                     /db_xref="GeneID:59323796"
     CDS             929701..930195
                     /locus_tag="HG536_0A05140"
                     /inference="similar to AA sequence:RefSeq:NP_014793.1"
                     /note="ancestral locus Anc_5.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137374.1"
                     /db_xref="GeneID:59323796"
                     /translation="MSQKVGHTSLAFARLWHHVDLARDKRTLGRLASAIAITLIGKHK
                     PVYHQSQDCGDYVVVTNCQSLRVTGKKFEQKKYWSHSTKPGHLKLTPMEKVVADKGFG
                     EVLKRAVSGMLPKNKLRKPRLERLKVFDGADHPYKQNITAFAYEQPYVQAKLDKVRVD
                     GKSE"
     gene            complement(<930436..>934104)
                     /locus_tag="HG536_0A05150"
                     /db_xref="GeneID:59323797"
     mRNA            complement(<930436..>934104)
                     /locus_tag="HG536_0A05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281480.1"
                     /db_xref="GeneID:59323797"
     CDS             complement(930436..934104)
                     /locus_tag="HG536_0A05150"
                     /inference="similar to AA sequence:RefSeq:NP_014794.3"
                     /note="ancestral locus Anc_5.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137375.1"
                     /db_xref="GeneID:59323797"
                     /translation="MSAGDEDYYNEDPYGYEDENSPITAEDSWAVISAFFREKGLVSQ
                     QLDSFNQFVDYTLQDIISEDSTLILEQLAQHTTESDNISRKYEISFGKIYVTKPMVNE
                     SDGVTHALYPQEARLRNLTYSSGLFVDVKKRTHEAVDIPGRELKYELIAEESEDDNES
                     GKVFIGRLPIMLRSKNCYLSDATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAG
                     NIVQVFKKAAPSPISHVAEIRSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQ
                     DIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVEDGFVIQDRETALDFIGR
                     RGTALGIKKEKRIQYARDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKD
                     QDDRDHFGKKRLDLAGPLLAQLFKTLFRKLTKDIFRYMQRTVEEAKDFNMKLAINAKT
                     ITSGLKYALATGNWGEQKKAMSSRAGVSQVLNRYTYSSTLSHLRRTNTPIGRDGKLAK
                     PRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSEWGMEPLED
                     YVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMVRDIREKELKI
                     FTDAGRVYRPLFIVEDDEALGQKELKVRKGHIAKLMATEYQDIEGGFEDSEEYTWSSL
                     INEGLVEYIDAEEEETILISMQPEDLEPVQETPEFDEDDDLARRIRATQHATTFTHCE
                     IHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
                     KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRS
                     YMDQEKKYGMSITETFEKPQRTNTLRMKHGTYDKLDDDGLIAPGVRVSGEDIIIGKTT
                     PISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLITTNQDGLKFVKVRVRTTKIP
                     QIGDKFASRHGQKGTIGITYGREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLS
                     KVAALSGNEGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPT
                     YYQRLRHMVDDKIHARARGPMQVLTRQPVEGRSRDGGLRFGEMERDCMIAHGAAAFLK
                     ERLMEASDAFRVHICGICGLMSVIAKLNHNQFECRGCDNKIDIYQIQIPYAAKLLFQE
                     LMAMNITPRLYTDRSKDF"
     gene            <934395..>935108
                     /locus_tag="HG536_0A05160"
                     /db_xref="GeneID:59323798"
     mRNA            <934395..>935108
                     /locus_tag="HG536_0A05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281481.1"
                     /db_xref="GeneID:59323798"
     CDS             934395..935108
                     /locus_tag="HG536_0A05160"
                     /inference="similar to AA sequence:RefSeq:NP_010693.3"
                     /note="ancestral locus Anc_5.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137376.1"
                     /db_xref="GeneID:59323798"
                     /translation="MTRVIANKTSPILSRAAGLVGIRPLATVVEPKERVSDTILKWSR
                     DAIERGDAHFKVGGTKLYFPKARVILLRPNAKHTPYQAKFIVPKSFNKLDLRDYLFHV
                     YGLRAMNITTQLLHGKYTRATPSLPRYRAPQIKKMTIDMAEPFVWPEEPSKKDNAMWD
                     ETMTENVKLYREDAFRLGSDSFKPSKAFGGAVGPFQPVAQPFIPKQLRREMENTRHAT
                     RNKLKRYDQLSQLDKYVNL"
     gene            complement(<935170..>935853)
                     /locus_tag="HG536_0A05170"
                     /db_xref="GeneID:59323799"
     mRNA            complement(<935170..>935853)
                     /locus_tag="HG536_0A05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281482.1"
                     /db_xref="GeneID:59323799"
     CDS             complement(935170..935853)
                     /locus_tag="HG536_0A05170"
                     /inference="similar to AA sequence:RefSeq:NP_014795.1"
                     /note="ancestral locus Anc_5.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137377.1"
                     /db_xref="GeneID:59323799"
                     /translation="MIVSSLMYLISVIVPLLVTVETLTMVCRSSGASASAVDTLVLQL
                     KYWCLYAILFGAVPASLSRAVLATVPLAGLALLAAATAVTAELLRDFTRFAQSQDTRF
                     MFLFNKLSDSNVSWWQWFNYAGAYDENNTARLFVFGQFTQFCVSLANRLPVARTRLLE
                     SSFDALQQWLVAFAQVAGRHWKARMRHVADRSGSGRASCKSSSPGSSKYAEGYDLLED
                     FLEDTKKGQ"
     gene            <936207..>940766
                     /locus_tag="HG536_0A05180"
                     /db_xref="GeneID:59323800"
     mRNA            <936207..>940766
                     /locus_tag="HG536_0A05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281483.1"
                     /db_xref="GeneID:59323800"
     CDS             936207..940766
                     /locus_tag="HG536_0A05180"
                     /inference="similar to AA sequence:RefSeq:NP_014796.3"
                     /note="ancestral locus Anc_5.500"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137378.1"
                     /db_xref="GeneID:59323800"
                     /translation="MGLPEEPQDNSSGSSDVPVYNGFDVKAQEKVRQLARTLTEQSAS
                     GSIGAGGHTADDGAVVERGDAQSLFSVRSRAGVNPVFDGESDAQYDARLDPKSDEFVS
                     AQWIKNMSRLSHEDPDYFKPYSLDCCWRDLSASGASADVAYQSTFVNAPKKYLGQAYR
                     AITPAKEVNRFEILKPMDGLLNPGELLVVLGRPGSGCTTLLKSISSNTHGFKISKESH
                     VSYKGISPRDINKHFRGEVVYNAEADIHLPHLTVYQTLLTVARLKTPANRVKGVSREA
                     WAHHMTEVAMATYGLSHTRNTKVGNDIVRGVSGGERKRVSIAEVAICGSKFQCWDNAT
                     RGLDSATALEFVRALKTQADIANTAAAVAIYQCSQDAYDLFDKVCVLDGGYQIYFGPA
                     KDAKRYFQEMGYVCPDRQTTADFLTAVTSPAERIVNEEFIKKGIRVPQTPKEMSDYWR
                     NSSEYRKLIAQIDAKMAENDEEERVRIKESHIASQSKRARASSPYMVSYMMQVKYLLI
                     RNVWRIRNSSAIALFQVIGNSVMALILGSMFYQVMKGDSTATFYFRGSAMFFGLLFNA
                     FSSLLEIFSLYEARPITEKHRTYSLYHPSADAFASVLSEIPTKLMTAVCFNIIFYFMV
                     NFRRNAGRFFFYFLINIVATFTMSHLFRCVGSLTKTLSAAMVPAAMLLLALAIFTGFA
                     VPETKMLGWSKWIWYINPLSYLFESLMVNEFHGREFPCAQFVPSGPAYQNITGTERVC
                     SAVGSIPGASSVLGDDFLKTSYNYYNKHKWRGFGVGMAYAIFFFAVYLFLAEVNQGAK
                     QNGEILVFPLSVVRRLKKQKKLSQPNSGGDIEKGSGIASTVTDRKLLQDSSESLTSSE
                     DDVGLSKSDAIFHWRDLCYEVQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLL
                     DCLAERTTMGVITGNIFVNGNLRDESFPRSIGYCQQQDLHLTTATVRESLKFSAYLRQ
                     PASVPTEEKDRYVEEVIKVLEMETYADAVVGVAGEGLNVEQRKRLTIGVELVAKPALL
                     VFLDEPTSGLDSQTAWSICQLMKKLANHGQAILCTIHQPSAMLMQEFDRLLFLKRGGE
                     TVYFGELGDGCHTMIDYFERNGAHKCPPDANPAEWMLEVVGAAPGSHANQDYHQVWRS
                     SDEYKAVRQELDQMERELPNKTTSLMDDSEKHKSYATPLFYQIKLVCLRLFQQYYRSP
                     GYLWAKFALTIFDNLFIGFTFFKADRSLQGLQNQMLSIFMFTVLFNNLLQQYLPLFVQ
                     QRNLYEARERSSRVFSWKAFIVSQIVVEVPWNILAGTLAYLIYYYAVGFYSNASAAGQ
                     LHERGALFWLFSIGFYVYIGSMGVLCISFMELAETAANLASLLFTMCLSFCGVMVTKD
                     VIPRFWIFMYRCNPLTYLIEAFLALGIANVNVTCSDYELIKFTPVPGQTCGEYMAPYI
                     QKAGTGYLQDPNATDVCQFCQFSYTNDFLATLGCKYSHRWRNYGIFISFIVFNYVAAV
                     FFYWLAREPKSKGKICKKKEEKSKK"
     misc_feature    complement(941142..941276)
                     /note="FBA1 fragment"
     gene            complement(<943461..>944792)
                     /locus_tag="HG536_0A05190"
                     /db_xref="GeneID:59323801"
     mRNA            complement(<943461..>944792)
                     /locus_tag="HG536_0A05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281484.1"
                     /db_xref="GeneID:59323801"
     CDS             complement(943461..944792)
                     /locus_tag="HG536_0A05190"
                     /inference="similar to AA sequence:RefSeq:NP_014798.3"
                     /note="ancestral locus Anc_5.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137379.1"
                     /db_xref="GeneID:59323801"
                     /translation="MSSRYRVEYHLKSHRKDEFVEWIKGLLATPFVLHAVSHDVDDLT
                     TTQRVRSQYAEIFKDIEGLVSNKIDFDSRNGQLEENDDSEVKYDLIGKSRLNQLVPSI
                     GSFFTELPLEKAFLWEDSQRGISERRMVAPSFNDVRRILNTAQLFYFADKRKKYHYNQ
                     LKLVTFDGDVTLYDDGGSLDYTNPVIPYIVKLLQNDIRVGIVTAAGYDEPSQYERRLE
                     GLIVAVHDSSSLSLEQKHNLTVMGGESNYLFRYYENEDNKFGFRTIEQDEWILSHMTE
                     WDQSDVDQTLDFAEKTLRSLKDRLHLPEETALVRKKRAVGIVPGERYDPVAQRRVHVK
                     LEREQLEEVVLTLQATLETFPPARRIKFSCFDGGSDVWCDIGGKDLGLRVLQNYYSPE
                     DPIRPSQTLHVGDQFAPVGSANDFKARLAGCTLWIASPAETVFFLSRLGFS"
     gene            <945363..>946979
                     /locus_tag="HG536_0A05200"
                     /db_xref="GeneID:59323802"
     mRNA            <945363..>946979
                     /locus_tag="HG536_0A05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281485.1"
                     /db_xref="GeneID:59323802"
     CDS             945363..946979
                     /locus_tag="HG536_0A05200"
                     /inference="similar to AA sequence:RefSeq:NP_014804.3"
                     /note="ancestral locus Anc_5.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137380.1"
                     /db_xref="GeneID:59323802"
                     /translation="MSEQFQPPSRPPPSHSSGEAGGDVERQNNYYYGQQPEGENNQQY
                     QFRQDKYYNLNAPGEGAPIGSFEQAFPTDDKPKWNDWPFTIFFLLCVGGFIVIAGITL
                     RAWAQTYSQTGSGIYTANNTGTLNTNSAILLVFAGVVAIVFSVVGIVLCRMFPKFFIY
                     CGMTVNILAGLGTAVMYLALRYWSAGIVFLVFTLMTAWFYWCMRYRIPFSVAVLKTVI
                     DAMKKCPQTLLISFLGTLVGGAFAMLFSAVIVATYIKYDPKSSNGGCDVSGGGCSNSK
                     KIGLLVLVFFCGYYISEVIRNVIHCTVSGVYGSWYYMSKSDQGMPRWPAFGSFKRAIT
                     YCFGSICFGSLLVSIIETLRQLITLARQSVAASGGGFMAQIGLIFIDWIVGFLRWLAS
                     YFNHYAYCFVALYGRPYLKSAKETWYMLREKGMDALINDNLIGVALGLYTLFASYMAA
                     LLAFLYLRFTRPAYNFSGSFNATLIAFSFVIALQICNIANETIRSGTATLFVALSNDP
                     EVFQASYPERFDEIFRAYPDVLKKLSHQDV"
     gene            complement(<947161..>950061)
                     /locus_tag="HG536_0A05210"
                     /db_xref="GeneID:59323803"
     mRNA            complement(<947161..>950061)
                     /locus_tag="HG536_0A05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281486.1"
                     /db_xref="GeneID:59323803"
     CDS             complement(947161..950061)
                     /locus_tag="HG536_0A05210"
                     /inference="similar to AA sequence:RefSeq:NP_014803.1"
                     /note="ancestral locus Anc_5.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137381.1"
                     /db_xref="GeneID:59323803"
                     /translation="MSLQVADVQKALQCVSSNAEQAKKNEALQFLEEFQKSVGAWKIC
                     HDILTNVDRSFLELHIFAAQTLRNKVSYDLSQLEGNLLQFKDTLMHLVVLHSQKLVVT
                     QLSVALARLAIQYIQWKDPVVEIINCLNPYPSKLLCFLRILPEETLDIGSTPLTEDEF
                     NSRTHELISTIAEDVLKFLISCVEILKSQRRDDADISLEQVMRCLASWCFEFPVDQLL
                     SVEPLISIIFESLLRGPADSPEVFDAAVDCLTVVLRESRDAPNEQLVLALYEQLMKLQ
                     ANLLPNLLEATNGEEQEYETMEGLTRLFVEAGEAWSVFISKSPQIYKPIVTALLMLTC
                     KNDDLDVASYTFPFWFSLKQNLVLPRYQRSKEQYVPIFESLIGGIIKHLQYPQNQFTS
                     GEDEDKFKEFRYHMGSVLKDCAAVVGTSRALHQPLTRIMTAVSNNGSWQELEAPLFSL
                     RTMAQEISLSENKQLPQIFQILCNLPEHPKIRYASTLVLGRYTEWTSKHPEMLKMQLD
                     YLFDGFRQVQEQNSAEIVTASSHALMYFCTDCSSLLSEYIDQLFDFYFQVENILDIES
                     QFELCQGLSAVINKQTAGRISSVLQKSLDHSSAEINDLIPKWKAEPAVFSAQIADKID
                     LVYAIFEELKPRNEYPQQGQEPLVTQIEFIWHMLRSLLVDFGAMSDTVIVERATKLLR
                     RLFEKFHLFCEPILESVAAFLAQGYATTGIGSYLWCSGSIIVVYGDDEALPVPPQLRD
                     AVWQFAVSQSDTFMVNFNKIEDARLNDEYESIMDFFSMISDLIMFYPKEFILTSVLLE
                     GTTDIALKCITKLDNYDAYILVLRCLDDIISWGFKTPPISTAAITLVPDEWREQISKA
                     IIISRGSLLINALFIGLVTNFESSTHSDAVSCIVKCFRLAFEANNNDPTVCAQWVLQA
                     VEQLNSVTLKEKEKLAAAVTNGLSQRDYRKVREGIKTFVAWYLRKNVSPRCY"
     gene            <950256..>950516
                     /locus_tag="HG536_0A05220"
                     /db_xref="GeneID:59323804"
     mRNA            <950256..>950516
                     /locus_tag="HG536_0A05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281487.1"
                     /db_xref="GeneID:59323804"
     CDS             950256..950516
                     /locus_tag="HG536_0A05220"
                     /inference="similar to AA sequence:RefSeq:NP_014802.3"
                     /note="ancestral locus Anc_5.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137382.1"
                     /db_xref="GeneID:59323804"
                     /translation="MVPPINCIFGYLQQQTVVTIWLYEQVGIRMRGKISGFDEFMNIV
                     IEDAVEIPVNVKNGIEEVDKSKKLGKILLKGDNITLITPVDE"
     gene            complement(<950570..>951586)
                     /locus_tag="HG536_0A05230"
                     /db_xref="GeneID:59323805"
     mRNA            complement(<950570..>951586)
                     /locus_tag="HG536_0A05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281488.1"
                     /db_xref="GeneID:59323805"
     CDS             complement(950570..951586)
                     /locus_tag="HG536_0A05230"
                     /inference="similar to AA sequence:RefSeq:NP_014801.1"
                     /note="ancestral locus Anc_5.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137383.1"
                     /db_xref="GeneID:59323805"
                     /translation="MPKTTTNCERLIQSSSWEAQLAEFRSILRVLSMGKGLAKHGFKS
                     GVLPVTRSILKNPTTKQETIVAKVNAPKPKGPKGVGYAEGVAHPKNSHREPSRVKFLD
                     VEELIQKTAAAPSGIKASVTPQQQTKLRKAELRRQYLSEAFRQEEARLIALGKLMEEK
                     KEALEQERKAEISLLNQSKSSDLTIPTLEGILEGPLMRQRTPEEKKLHRMKRKYNREV
                     MEFRAKERKLEDLLHLYHVSDEFIVTEAQLLKKIDEAFANEGSDVLRTRLSMGASRIR
                     SRNESSIGDALFGTLGAGEHVGLPPVKEFLSGEMKSFADQVDLKSSQIIAQKKSDVDT
                     ILQA"
     gene            complement(<951660..>955397)
                     /locus_tag="HG536_0A05240"
                     /db_xref="GeneID:59323806"
     mRNA            complement(<951660..>955397)
                     /locus_tag="HG536_0A05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281489.1"
                     /db_xref="GeneID:59323806"
     CDS             complement(951660..955397)
                     /locus_tag="HG536_0A05240"
                     /inference="similar to AA sequence:RefSeq:NP_010695.1"
                     /note="ancestral locus Anc_5.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137384.1"
                     /db_xref="GeneID:59323806"
                     /translation="MKLHVGCASFVDPSKIRTLVVPVGKWRREEFLGAVAKLQRFSEI
                     RLLDITPIESSLFTPQGFPSGRLFFTFSSSGYNDSLNLFLYDFEPFRKIFVVIGLVNE
                     HGDLESDLAKLKERYPTVISHNLIVVSKDAISTENSNVFHCGPKLEDKLETTLCDIGK
                     NFLLALNHYYSSYKHVTLRSPGAIGGNAVLKTSLTRQIAALNAATATSANASKRLSSI
                     EIATNGIKRSASLKLAKSLTTTENRSQNRSRGRQLKILGNFQLLAGRYTDALASFGEA
                     ITLLHKVRDHLWLGSALDGIAICFLLLSYLQISFQIPSIINVLCPHQASNAISETDSP
                     RNSVSHTPMRSPRGSSSSLSSAAAIDVESANLPKLIKSISEKIMYYYELSLSHTSDYA
                     PQMVYSEILLKTLSFMVCCRSSAGLSSDDLRLIIDGTLPQPAKFDCSTLEPAFTSHEV
                     YFFANRLFDLQLKEMDVESQCDIYMHLAKVYRSLGFERKRAFVLRLLLVAIVSNTDDI
                     LLTPDYRAHLENMAQLYGIKSSLALEAMVDEQGDISWLNLQKRCLQLCLAVASRAKDR
                     KLSAHYSLLLIGRYTHLLTQSEQVNLLNNHIEPLISDGCIDSYWDPYLLRDIKFARLE
                     YTGSAVDGAEFPVEMQMAPFEKQDGEVTELDTHQVFNPFKAVQAASKTSDSNSVQGTF
                     LVGDRAMVSCMVQNPFKFEISIKELNFDAEAGKHVELDQNDITLKTPIFVSPESTRLV
                     NLPVNFKAPTGSELLSISSLKMSVMGLPPRAFTMVPSETGFSDHQKLDGDQTLGNRVK
                     IKILPQQPELQVLRTENITDNSWMMLHGTKQIVSVVFRNKSLSCSIDYLQFSHLTNIE
                     KSFKTDYWKKLPYDDLYGVEKQLEWLKNSCIKILEAPTKMAPNEVAKVKIEIDATSVP
                     LQFDGFDVIVNYGMHASKKSYMYMKTLCLPYEVSLKRSIEVPGIEIVPLNELFAPEME
                     TVDWVEFVMNKRRSEQNFRVGDYVLLLLDIRNSWIDGVSLDLSFQDFRSHQHLIEAEH
                     TTRVVVPIKKIEHQHVPFRARPIPRVFNNRQYIQSGLSEDQEREMREKFWCREHILSH
                     LQCRWHLAKDSSITGEVDFRQFLDKLDDLMVKNLYLDRSPYLVDLALDKTNITRNQSV
                     HARVTITPAAARHATSEPLLLSFMIFDHHTSKVLPSSSRRILYNGTLTRHIVAVKETK
                     LALELIPIEPGTYEICALITNSNEDRPMSLSNQEPVTLLVT"
     gene            <955670..>956455
                     /locus_tag="HG536_0A05250"
                     /db_xref="GeneID:59323807"
     mRNA            <955670..>956455
                     /locus_tag="HG536_0A05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281490.1"
                     /db_xref="GeneID:59323807"
     CDS             955670..956455
                     /locus_tag="HG536_0A05250"
                     /inference="similar to AA sequence:RefSeq:NP_014800.3"
                     /note="ancestral locus Anc_5.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137385.1"
                     /db_xref="GeneID:59323807"
                     /translation="MAGLSFDNYQRNNFLTSKSYSQPKATSTGTTIVGVKFNNGVVIA
                     ADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGSNLELHSLYVNRQ
                     PRVVSAMQMLKQHLFKYQGHIGAYLIVAGVDPTGAHLFSIHAHGSTDVGYYLSLGSGS
                     LAAMAVLESKWKQDLTKEEAIKLASDAIEAGIWNDLGSGSNVDVCVMEIGKDAEYLRN
                     HLTPNVREPKQQSYKFARGTTATLRESIVKICDIEEETVDIVG"
     gene            complement(<956522..>957163)
                     /locus_tag="HG536_0A05260"
                     /db_xref="GeneID:59323808"
     mRNA            complement(<956522..>957163)
                     /locus_tag="HG536_0A05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281491.1"
                     /db_xref="GeneID:59323808"
     CDS             complement(956522..957163)
                     /locus_tag="HG536_0A05260"
                     /inference="similar to AA sequence:RefSeq:NP_010696.3"
                     /note="ancestral locus Anc_5.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137386.1"
                     /db_xref="GeneID:59323808"
                     /translation="MTKSRITVLISGSGSNLQALIDAQSEGKLGNAEIVSVISSSKKA
                     YGLTRAAAANIPTKVQSLYPYTRDIPQDNKEKRAEARVRFEKDLAELVLSDEPDLVVC
                     AGWLLILGPEFLSRTNTVPIINLHPALPGAFDGTTHAIEMAWKKAEDEGKPLKAGCMV
                     HYVIEEVDRGEPLLIKELEIIPGKETLEEYEKRVHEAEHVAIVEATAAALSKK"
     gene            <957788..>960187
                     /locus_tag="HG536_0A05270"
                     /db_xref="GeneID:59323809"
     mRNA            <957788..>960187
                     /locus_tag="HG536_0A05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281492.1"
                     /db_xref="GeneID:59323809"
     CDS             957788..960187
                     /locus_tag="HG536_0A05270"
                     /inference="similar to AA sequence:RefSeq:NP_010697.3"
                     /note="ancestral locus Anc_5.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137387.1"
                     /db_xref="GeneID:59323809"
                     /translation="MTPNAAAGMGRGLHQEIQEVTAQMEMLKVPELKAICRSMSQPIA
                     GRKADLQDRIRTFLKDSCTIGNLDPWRPKAVRILIEKLKLGETLPKYEDLWKTLRTGA
                     YYHPVATGHQPVSSLEQPSRTAGAPSQVGHGYAAWPSEVARSEAPKAAAAKRPCLYFK
                     PTPFYKLIKLIPETAQKINITSVRGACIAKFKLSKADWTMLESDKKYRLYLLCGAYGN
                     APSAAGEYIQFPHPNEIRFNNVQVKDNVRGLKNKLGTAKPADLTPYLRPYPQQNILEV
                     VYAFTKNEYCIYCYIVEVVTPEHLLEEVLKRPKIIKAATLNYIKKCLSEEEDDLITTS
                     TVMTLQCPVSYTRMRYPVKSIMCNHLQCYDALWYIYSQLQVPTWQCPVCQIDIKLSDL
                     AICEYVDEILKNSNEDVEQVELSTDGSWRPLEEESNKPKESSKAADTVVKKEFSEDSD
                     ENDVPLSKLVGNNSMTGTPANEPVVISLDSDTEENTNHETEQNANKATVQNTHNTNSI
                     PSGGWYMDHAPSISGPTLDPRAHGTNTPTVPRQMMEANENSLSFVNRTQQIPNILGKT
                     PLNNGELHQEASLPEPASPTPISSNRGQQTPALSASESPMGLEECNPQISGADELAAS
                     PPSLRRPSNPQTTSILGLTGQVMRPPEIRGSIPPLTNNNGDSRPANGSLHNGLEYNNL
                     INGNENAAEVPQLPPLPSRPLASNIGNARLDSPVQGSGPLASPTGGPLPPAHPRGRRP
                     IVSPFIPKKPYLNLLPQKRHIANTSPPSPNSFGAEPHALGTSASEGLMRSDDVIDLTS
                     D"
     gene            complement(<960238..>960972)
                     /locus_tag="HG536_0A05280"
                     /db_xref="GeneID:59323810"
     mRNA            complement(<960238..>960972)
                     /locus_tag="HG536_0A05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281493.1"
                     /db_xref="GeneID:59323810"
     CDS             complement(960238..960972)
                     /locus_tag="HG536_0A05280"
                     /inference="similar to AA sequence:RefSeq:NP_010698.1"
                     /note="ancestral locus Anc_5.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137388.1"
                     /db_xref="GeneID:59323810"
                     /translation="MVEQNGRRVAGTSTGYADIRKNPLYEVSRTAFGLGVVLGIFLGS
                     LALVRLKNFHLYIVFLCLFHFLEYYITARYNPTKVNVDSFLLNNGVEYIACHTLAILE
                     TLIEYVYAPGFKTGRDSRVASVVVVLGYVFILGGQAARSWAMVTASSSFSHVLEKERR
                     EDHILVKHGIYRWLRHPSYFGFFWWALGTQMVLLNPVSFVLFAIVLWRFFSARIASEE
                     SYLIEFFGNDYVRYRNGVPVRIPFIK"
     gene            complement(<961090..>961836)
                     /locus_tag="HG536_0A05290"
                     /db_xref="GeneID:59323811"
     mRNA            complement(<961090..>961836)
                     /locus_tag="HG536_0A05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281494.1"
                     /db_xref="GeneID:59323811"
     CDS             complement(961090..961836)
                     /locus_tag="HG536_0A05290"
                     /inference="similar to AA sequence:RefSeq:NP_013671.1"
                     /note="ancestral locus Anc_5.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137389.1"
                     /db_xref="GeneID:59323811"
                     /translation="MLVEEINKKTYDPNVYYTSLDSQVASHARSKVTKTSSAYRSTKR
                     VNYSLADLESKLYTQRQDAEDTAASNEGSILDKYTQQQIIQSKKRCMELDTENQKDLV
                     DVPSLLGAITGINRNRIDAASNTAGGGGSSIRHKNKIEIPKNIHLTYRSTKPPVPKKK
                     NTNRIVALKKTLSSKRSLQSYLETLDQVNKSIIYHNVTNKKFFKVLPVITTCSVCGGY
                     DSISSCIHCGSKICSLRCFNLHNETRCVHR"
     gene            complement(<961945..>963918)
                     /locus_tag="HG536_0A05300"
                     /db_xref="GeneID:59323812"
     mRNA            complement(<961945..>963918)
                     /locus_tag="HG536_0A05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281495.1"
                     /db_xref="GeneID:59323812"
     CDS             complement(961945..963918)
                     /locus_tag="HG536_0A05300"
                     /inference="similar to AA sequence:RefSeq:NP_013670.1"
                     /note="ancestral locus Anc_5.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137390.1"
                     /db_xref="GeneID:59323812"
                     /translation="MKVCWRRSSRFLERSMSSHVLQRFPFETQNGEHYWALKDNKSYQ
                     NARPGYKGSTFSQQSKLPSLVVPELGATLNKYLQTIKPYCGDPAEYSRQEMLCKDFAE
                     HMGPVLQQRLVEFASTRRNWMSEFWDNQSYLEYNDPVIPYVSYFYCHKPLPISHKAIE
                     SDPLMKATAIIVTVSNFIEALKDESLPPEVIRGTPFCMNSFHLMFNTSRLPGPPQDNR
                     DTNIFYSIYENNFIVVAFKGNFYKVTTHDPQTNKPLSPNEIWSQLYSIVNAKSAHLQC
                     ETNSGIGFLTSLPRDQWRVAYQELIKNPLSQHSLETIHRASYIVALDDANPVTFEEKS
                     RNTWHGNGYNRYFDKSLQFVVTQNGSSGSVNEHSKMDGTPTCFLNHYVVQEMAKLNPS
                     AFVEAVRKPSEQRGTVTHLPFLVTPPVKQWINTARQAFEKVIGEHDLRVWHYNRFGKK
                     LIKKHGMSPDAFIQQVMQLAVYKYLGKQLPTYEAASTRMFFKGRTETGRSVSEASHNF
                     VTGWQDPDVSPKDKIMLLRESAKYHSNYLKAAAAGLGIDRHFFGMKNMLKPGDPTPPL
                     FSNPLFNYSSTWLISTSQLSSELFDGYGWSQVNDNGFGLAYMLNDDWLHINIVNKPLP
                     SGLSVDKLHYYLTLAADELHDALDAQENIKAKL"
     gene            complement(<964153..>965085)
                     /locus_tag="HG536_0A05310"
                     /db_xref="GeneID:59323813"
     mRNA            complement(<964153..>965085)
                     /locus_tag="HG536_0A05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281496.1"
                     /db_xref="GeneID:59323813"
     CDS             complement(964153..965085)
                     /locus_tag="HG536_0A05310"
                     /inference="similar to AA sequence:RefSeq:NP_010699.1"
                     /note="ancestral locus Anc_5.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137391.1"
                     /db_xref="GeneID:59323813"
                     /translation="MSDNIHTLRNSSGRGRNDNSPLQVLFGIPIVTRYLISSAVVMTL
                     LIRLRIVKTGALLYQFNEVAGHLQVWRPFTSCLILPFEALPAMLELYTIYSCSSDLES
                     RRKPLDYLFYLVFCVTTISLTLTLLCGASESMVLTSGIVSCLTFTWSMDNSNVKVLFY
                     GLFPVWGKYYPILQLFMAFAFGNRDYVVCLVGFLTGYLYACLDTGTLGPFYGWLVRSP
                     NEYYGIFPNGKFGAPQFIKSLLQESQDLRNAKSSGRPRGGQKLGFKDTPGPSSATTSA
                     YTASPSSSTTQRAANTATNHRPAFFPGNGQRLGS"
     gene            <965317..>965991
                     /locus_tag="HG536_0A05320"
                     /db_xref="GeneID:59323814"
     mRNA            <965317..>965991
                     /locus_tag="HG536_0A05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281497.1"
                     /db_xref="GeneID:59323814"
     CDS             965317..965991
                     /locus_tag="HG536_0A05320"
                     /inference="similar to AA sequence:RefSeq:NP_010700.3"
                     /note="ancestral locus Anc_5.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137392.1"
                     /db_xref="GeneID:59323814"
                     /translation="MCAARSNRQILSQGKNYADKKLKKFGTDEVSFDKDSRLEYLTGF
                     HKRKLQRQKKAKEFIKEQERLNKIEERKNIRDERKRQLDERLRNFKQGLELGSEGDDS
                     DDAEGKEEEEAEEWNGFESDCEEAAVKPILKTVYSDNSSVSVETLEANDNFAYLAKIN
                     NVDLNESDKVLKQSIVRAGKYAKFLGMADKDTEKTKQKKKKFRYLTKSERKRNQYKAN
                     SNKRRR"
     gene            complement(<965996..>967069)
                     /locus_tag="HG536_0A05330"
                     /db_xref="GeneID:59323815"
     mRNA            complement(<965996..>967069)
                     /locus_tag="HG536_0A05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281498.1"
                     /db_xref="GeneID:59323815"
     CDS             complement(965996..967069)
                     /locus_tag="HG536_0A05330"
                     /inference="similar to AA sequence:RefSeq:NP_010702.4"
                     /note="ancestral locus Anc_5.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137393.1"
                     /db_xref="GeneID:59323815"
                     /translation="MEGAEIPPDVKSGWGIYILASQRVNVLLLVAIWLWQWMLKLLSS
                     CQLDVSTVIQSRKPNEMVLPLSHAQMQRLSRQFAVRLSRIIVPLQLIGLLCQSWAEAT
                     ERSSNLAQFAILLLPLIQFVIIVGSISRNCQIINYCIKRILLIETSPRPMRNVYILLS
                     DTLTSFTKPLIDFTLYLTTLFLSKDVLWTHCDLLISLFPLNIRIWQCFREFYLGRDKS
                     LLVNALKYISSIPIMVCVWHSRVDPEKHNSNVVHWFQCLNSCFTLVWDVRMDWKINSL
                     RRIRKNHKTSQNVIFPKFVYYMGVLFDFSIKFWWIWTLKRPDHTILFASELQYLEILR
                     RSVWVIFKLESEYVTIRNLATEK"
     gene            <967900..>969066
                     /locus_tag="HG536_0A05340"
                     /db_xref="GeneID:59323816"
     mRNA            <967900..>969066
                     /locus_tag="HG536_0A05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281499.1"
                     /db_xref="GeneID:59323816"
     CDS             967900..969066
                     /locus_tag="HG536_0A05340"
                     /inference="similar to AA sequence:RefSeq:NP_010864.3"
                     /note="ancestral locus Anc_5.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137394.1"
                     /db_xref="GeneID:59323816"
                     /translation="MLKFLTRRAVSAAFLRQNASSGMVLHRSFSAGTRVWQKLETGSA
                     KEGSGFISPQILKIVPDTTDIATLEKQDELIKRRRKLSKEITQMKKLKPVSPGLRWYR
                     SPIYPYLYKGRPVRSLTVAKRGKGGRNHSGRITVRHRGGGHKRRIRLVDFSRTEAGQQ
                     TVQRIEYDPGRTSHIALLKNNKTGKLSYIIACDGLRAGDIVESYRQGIPQDLLREMGG
                     KVDPAILSVRTAQRGNCLPISMIPVGSIVHNVGITPVGPGKFCRAAGTYARIISKIPE
                     KRKAVVRLQSGEHRYVSLEACATIGIVSNIDHQNRSLGKAGRSRWLGIRPTVRGVAMN
                     KCDHPHGGGRGKSKSKKLSMSPWGQLAKGFKTRRGKNQNRMKVRDRPRGKDTRL"
     gene            complement(<969117..>970247)
                     /locus_tag="HG536_0A05350"
                     /db_xref="GeneID:59323817"
     mRNA            complement(<969117..>970247)
                     /locus_tag="HG536_0A05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281500.1"
                     /db_xref="GeneID:59323817"
     CDS             complement(969117..970247)
                     /locus_tag="HG536_0A05350"
                     /inference="similar to AA sequence:RefSeq:NP_010703.1"
                     /note="ancestral locus Anc_5.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137395.1"
                     /db_xref="GeneID:59323817"
                     /translation="MKAYRFVATFSLTLQVSNAILFNDPLRVLEIGQDERIQVKESEK
                     LSLKRRGVGFIDVTDHINLPWGKKIKNAAPVPDYDYPQTASQAGIVNKLITEIDQVAM
                     RDDLAKFCSFFTRYYKSASGYESAQWLSSKLHNLTSELRSDVFEIEHFDHVKWKQFSI
                     IFRVHGIETADNVVVIGSHQDSLNMIFPSLIPAPGADDDGSGTITSMEALRLYVKHLR
                     NGHLPKNTVEFHFYSAEEGGLLGSMDVLGSYREQGRKVVAMVQQDMTGYVANKNDEHI
                     GLVLDDANERLVDFLKVVIDAYVRIPYRETRCGYACSDHASATKNGFPSAFILESENA
                     KTNRYIHTTMDTLDRLDFGHISEHVKISLATVIELSNWNFGK"
     gene            complement(<970374..>971192)
                     /locus_tag="HG536_0A05360"
                     /db_xref="GeneID:59323818"
     mRNA            complement(<970374..>971192)
                     /locus_tag="HG536_0A05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281501.1"
                     /db_xref="GeneID:59323818"
     CDS             complement(970374..971192)
                     /locus_tag="HG536_0A05360"
                     /inference="similar to AA sequence:RefSeq:NP_010863.1"
                     /note="ancestral locus Anc_5.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137396.1"
                     /db_xref="GeneID:59323818"
                     /translation="MSGTREQVFPTRMTLGLMKTKLKGANQGYSLLKRKSEALTKRFR
                     DITKRIDDAKQKMGRVMQTAAFSLAEVSYATGENIGYQVQESVSNARFKVKARQENVS
                     GVYLPQFESYIDSDINDFKLTGLGRGGQQVQRAKEIYSKAVETLIELASLQTAFIILD
                     EVIKVTNRRVNAIEHVIIPRTENTIAYINSELDELDREEFYRLKKVQEKKQQETARLD
                     AEMKQAKMARMAEQQQTSAEGDAVAQEAEEDESDARTSAEPGALVEEQEEDVIF"
     gene            <971391..>973904
                     /locus_tag="HG536_0A05370"
                     /db_xref="GeneID:59323819"
     mRNA            <971391..>973904
                     /locus_tag="HG536_0A05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281502.1"
                     /db_xref="GeneID:59323819"
     CDS             971391..973904
                     /locus_tag="HG536_0A05370"
                     /inference="similar to AA sequence:RefSeq:NP_010704.1"
                     /note="ancestral locus Anc_5.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137397.1"
                     /db_xref="GeneID:59323819"
                     /translation="MNRLNCTQMLSQHFKIPVWCQMEWLDQYIVREDDLAYEYELQRT
                     PQSVVTWGRYLEDWKSQPRSERPLKHVIWLYERFCAEFNDSIDVWKEYIRWLAGKCGE
                     EVHYRFVIDLFLRCLRNFSKDCDELCLMFLEFAIEQADLEAIRIAFDMSLERVPRDSH
                     GRVWDKMLRFIDERLAPLTEEDESVYENEEEELSVLIYKSLFGPSTAAEDESKVDLWS
                     SSIVRRYLEVCPRDKLPDALGRLARTGDYESLFASFHKALNSNDGCLPDKTLPRETNL
                     QYLRALDCLNKGPNYEAFATEMARVFPEMEIKMTTMLAKFYVKNGGHEKVVQLLEDSL
                     AKVATVQDFHVLYETYLNYEKSYIQTVLQELQTKTEPVCEKKWKGQLDNHMDRLQNLV
                     ETYELRLNDLKIRQNPNLVANWSERAALVRTNVDKCSIYSQAILTIDPFKVNVPGSFG
                     KLWCDYANLYWKARDYESAREVYDRGLRVPYPYIEDLENIWSSWVENEMEEAGLEVAL
                     KLLETALRVPENPELLLAEFNEGDRKVPAQGVIFSSLKLWQLYLDFTESLCAQTSEAV
                     EKMVNLYEQAIALKVATPKMFVDYAHFLQDRGEKLASFQVYERAIGLFPPETQFQFWN
                     LYLAESTAEENLLAKEHIREIFEQALEILIPSGIDCKAIFILYSDFEERCGLSNRCVE
                     ILLEGCRKTADLEDKVTLWQICLLKVKELLGNEESRRFYEECIQSLPNSKVIKFAIEF
                     ADTEATLGEIERARGIMKCAAQLLPPGRNALLWESWDEFEVRYGDRESYKEMLKLKRR
                     LEKEMRIETEIESQIEGNIAFVAASKPNAVNPEEIELDL"
     gene            complement(<973944..>975482)
                     /locus_tag="HG536_0A05380"
                     /db_xref="GeneID:59323820"
     mRNA            complement(<973944..>975482)
                     /locus_tag="HG536_0A05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281503.1"
                     /db_xref="GeneID:59323820"
     CDS             complement(973944..975482)
                     /locus_tag="HG536_0A05380"
                     /inference="similar to AA sequence:RefSeq:NP_010862.1"
                     /note="ancestral locus Anc_5.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137398.1"
                     /db_xref="GeneID:59323820"
                     /translation="MRIVSLRLRGLQINDYRKFARYLCSTTICNHSTSKPYDLATELP
                     TKSARATTPLEEYDRLVKIKKLRDDPYQRGIIRSLGSLYDSLLQYSPPEIQAPDALDQ
                     VGWKSSFLGRLMGFRVQKNENDFSGIPKGIYLYGDVGCGKTMLMDLFYSTIPHYLSKK
                     RIHFHQFMQYVHKRSHEIIKEQNLDELGAAKGRDIDPIPFLAAEIASGSRVLCFDEFQ
                     VTDVADAMILRRLLTTLLSKDHGVVLFATSNRHPDELYVNGLQRESFIPCIELIKNRT
                     EVIFLNSPTDYRKIPRPSLTVYYYPEKGLKYNSKECRRKRDNHIDQWYTYFAQTENTA
                     STEHEVLTDFTLTTWGRRFAVPKCTPLCVAQFTFKQLCGQPLAAGDYLSLASNFKAFI
                     VTDIPYLSIYVRDEVRRFITFLDAVYDTGGKLATTAAADFTSLFVEPQDLLNDFELKS
                     NLKESESAVEKVEEEDSLVSQHGFSKEIAKKSQIFALDEERFAFARALSRLSQMSSAE
                     WVER"
     gene            <976020..>978314
                     /locus_tag="HG536_0A05390"
                     /db_xref="GeneID:59323821"
     mRNA            <976020..>978314
                     /locus_tag="HG536_0A05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281504.1"
                     /db_xref="GeneID:59323821"
     CDS             976020..978314
                     /locus_tag="HG536_0A05390"
                     /inference="similar to AA sequence:RefSeq:NP_010861.3"
                     /note="ancestral locus Anc_5.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137399.1"
                     /db_xref="GeneID:59323821"
                     /translation="MELERTFGNLHLSRNCSTRNDLPDEKSLTDLVDITELFFDLGKD
                     LSPQTIIQDPGFNSFEGTHSLEVNNAKLDSSLISLTSEEKRFSCDVACGDTAVERLTY
                     VTAILDRLARFLVCWLNEYQTLPTTVLSCRYVEFLLTISSEREELSYLRTGDRLYDQV
                     LCDAIYGICYFAKFVQKLLKAGVVFEEEDLNFNHMGLDFLSYVEDRELILARLHRSID
                     YVESLQSQESAFLQHLLKLICSLVSLESHLTAYSADTTGLDDLIAEATYLEQQRSSEC
                     DPPSGCFSMGIQRRLSNQFPPKHLVVPTWNYRGFVVMAEDIKAVLMVDKAASMLEAAQ
                     LASFFNKLTQRHVVARALFPLFFIRDDERVLGRYSAFDCISLHLKEFCATATASTTVL
                     SPQMRPVLQEATNIIFEWYQNMAQNTSRYRQGYNRQLLLWDALHAQMESCEYDIASQT
                     AGDELATTTGIFMACSSWVFLMKITAMIEYVLKGFDLEVYKPFEAFAMFWYSYYLSYQ
                     QESCLEKVHEVIETKINSIHSLGKKIKKQKNAQKKIELKAQYRHLMDNNMESLRTNKR
                     YVSYLFMHSSIVKSLSLAQVLQFSILKSFGVIDNKTSASGIFSSDRLLLELRLKPFSS
                     IGVPELLTYEAFESTLNDFLITEPMFSSKLDKALQRISKEVSSALTAIDTIKKCINAG
                     DNNGLLVTGTRLVKEQALKYYDQLQASAKAIELNSTTIAGKLGRSKSSSTSDKFSVRL
                     SVPKDASRFFPLLELTKTKTKRAK"
     gene            <978967..>979464
                     /locus_tag="HG536_0A05400"
                     /db_xref="GeneID:59323822"
     mRNA            <978967..>979464
                     /locus_tag="HG536_0A05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281505.1"
                     /db_xref="GeneID:59323822"
     CDS             978967..979464
                     /locus_tag="HG536_0A05400"
                     /inference="similar to AA sequence:RefSeq:NP_010706.3"
                     /note="ancestral locus Anc_5.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137400.1"
                     /db_xref="GeneID:59323822"
                     /translation="MPPKFDPNEVKYLYLRAVGGEIGASAALAPKIGPLGLSPKKVGE
                     DIAKATKDFKGIKVTVQLKIQNRQATASVVPSASSLVITALKEPPRDRKKEKNVKHSG
                     NIALDEIIEIAKQMKEKSFGKNLASVTKEILGTAQSVGCRVDFKNPHDIIDAINAGEI
                     EIPEN"
     gene            <980223..>982121
                     /locus_tag="HG536_0A05410"
                     /db_xref="GeneID:59323823"
     mRNA            <980223..>982121
                     /locus_tag="HG536_0A05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281506.1"
                     /db_xref="GeneID:59323823"
     CDS             980223..982121
                     /locus_tag="HG536_0A05410"
                     /inference="similar to AA sequence:RefSeq:NP_010707.3"
                     /note="ancestral locus Anc_5.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137401.1"
                     /db_xref="GeneID:59323823"
                     /translation="MSKYKWKDLTKLKSPSMAYDSPLSVLCHIDVNCFYAQVEAIRCG
                     YTKEDPVVCVQWNSIVAVSYAARKYGISRMITIQEAMKKTDKLIPIHTAVFKKGEDFW
                     QYHDGWGPWNPDKDKRLPSSDYKISLDPYRRESRKIFKIFTEYCDLAEKASVDEVFLD
                     IARLCLQSLMCSEQLIPGKENPETIQLMQAKFKDESYDGNQFLPAVPGELKELPFIGD
                     VYNPEDLPLIEDWDDVLFALGSRIAQELRDEIKQTLGYTTSCGLASTKNVCKLASNFK
                     KPDAQTIIKNSCVNTFLDNGKFEITTFWSLGGILGKELIQILKLPQQGSNGYVRENWP
                     TRDSLRKSLSRAVRESPSTSSTIIDASRTNEIADKLYDLVRGQYRVAVTPQTIVKSMM
                     SNKNMTGQACSGLADCFSWLEVFAGELAGRVHELEQEYDKIIRPRTIHILVRAKSGDT
                     HSKSGPFVQNGAKISSQDLLKAGAKLVAELDAKFARGKEHSFYPLININMSISNLDVV
                     DCRKSVIDMFGNQASVQGRQRKANVGNNQSASLANEPFKENWCDECNKTFETSREFQE
                     HADYHIALALSEKMNGTNDCSRRLTFGEKRLLMRRNAPEPPSKRRSKPKSKTAGSSSD
                     IFKYFKKE"
     gene            985131..985212
                     /locus_tag="HG536_0Atrna1S"
                     /db_xref="GeneID:59324257"
     tRNA            985131..985212
                     /locus_tag="HG536_0Atrna1S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59324257"
     gene            <985556..>987622
                     /locus_tag="HG536_0A05420"
                     /db_xref="GeneID:59323824"
     mRNA            <985556..>987622
                     /locus_tag="HG536_0A05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281507.1"
                     /db_xref="GeneID:59323824"
     CDS             985556..987622
                     /locus_tag="HG536_0A05420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137402.1"
                     /db_xref="GeneID:59323824"
                     /translation="MLQNYLLTQLLLLILFLISTAKGLPSSDVNRFSNEETTVNTVTG
                     SNEASLSGTTENYSLQGHDQQSTPLAITGEPVSSKSSDTPVYLVSSPTMSYTDTTLPG
                     SMAENPHSQEAASQSFKVSSKQGTATPDVTSSPPGDSITSSSGKPPNVPTTESSQTTS
                     RASPSFESREPPSSQSDDGSSRTSSLIAISTEANFVSSGFISRADSTRSPEPTQSAAM
                     AYSTSSTVTVQTSSVVGRASDLLSLGKSTPIPTTSLTESEADASSETGMFQSQVVIEE
                     LYDFTETESETSSSTAQAPAFSSLDDSLISTSTHDTPLVTSSIPSTSKSTTLPSLAGD
                     TTSGQFSYIPESSSKQSSIIEPSTSTSDEPVSGSFSKMTIDLVASEITPWESSSGATS
                     TVQTTEARQPTTTSVMEPTTSNPLQPTEEGNQYRTAGSPSSDFATAGSPTQQTEEFTL
                     YSSVPGSGTSSDEKLSIFLITTDSASEPYRETTYFSVPPSSEPSFIATASSNELPVPS
                     SASLTTENAIFATTDITSQSSEDHTTFLITKDLPDTASSATSDTSATINPQFVSLSDT
                     SSVPSSIIIEQTVNTASYLSSPTLNSPTITNWPEATSVELTTEATSSEYLASTIEIHS
                     SPVPNTDHPTGLSDYRTESTITYSENSQDFTLLSSIRQTEASFISNDGDTSSMTVGTT
                     TVSPTP"
     gene            <987665..>990196
                     /locus_tag="HG536_0A05430"
                     /db_xref="GeneID:59323825"
     mRNA            <987665..>990196
                     /locus_tag="HG536_0A05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281508.1"
                     /db_xref="GeneID:59323825"
     CDS             987665..990196
                     /locus_tag="HG536_0A05430"
                     /inference="similar to AA sequence:RefSeq:NP_010708.1"
                     /note="ancestral locus Anc_5.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137403.1"
                     /db_xref="GeneID:59323825"
                     /translation="MELDSQSTEQPSTFAALTLSSLTSLALTVTPGISSLQSLPTTDL
                     TTKPQASSLHDTGKSEPMSLIQSTIQPTASASGIEQVNSYQVSEPRSTSSSATTDIQA
                     SAPISISGSFGQESKTVDSFDSLQPTRLIHSSAKLSATPSTASTQGSQNGDYSLTSTN
                     ARSEPSSESAVSPVGSSQGSDDLAYPKSSQAATVTQNLGMTTESMGALTTIAASSTAS
                     MTTGTWWLPSSIEIQSQTSNAGTSSFNPSVTAILPHVIAPQSTVIPAPGTTKITIGFD
                     RELNFEFLVDHPQSSAQIFAFLPSVLVYPFSANQIKDFNGSKNRNGKFIATCVQSGTT
                     TVAPDSYSFQEIGINLKQTNEYSFVNVSDVTVIEIQPMTLKQRNYLLSIAVVYFPDDF
                     VSELQSYITNTTSGLYHNPNPTLYALAQLIDPSIPLTGLVDGSAGGSSPVSSQDPHSH
                     SQPDASKASSSDGESGSLESTVNSQITFAITKRLVAYLICLVFGTLLWIVASLLMHRY
                     VQNVRNRGANMPIIIEDYEKREYLSADVTSLHSAISSAPNCNGNITQRINKEAASDQH
                     LPGDLVITGDNTVYSVSHDLEYYVAEDGSFYYAGALDSTTDGNESTKHTSPDMEDIDD
                     FLYSAEQQRSSLAMNETSYDIGSLEIDDEGNFVVSDPSEEIEPIALETDNSETVESYN
                     NRNLYKMTETTNSYQSSNEAAQPTDTREASDPSWPIQRFGHGSISRAAYGTYSTDNSD
                     NVAQYLPGGDSIDEYLYDGLIDDFSASGPLEVQIDEMDDDVIDIHVNDLDELDEEMYR
                     RLSKLMEHQQNNESGNLHISNVIAAKAQRSEIKPRSSGRRNDFQF"
     gene            <990411..>992993
                     /locus_tag="HG536_0A05440"
                     /db_xref="GeneID:59323826"
     mRNA            <990411..>992993
                     /locus_tag="HG536_0A05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281509.1"
                     /db_xref="GeneID:59323826"
     CDS             990411..992993
                     /locus_tag="HG536_0A05440"
                     /inference="similar to AA sequence:RefSeq:NP_010709.1"
                     /note="ancestral locus Anc_5.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137404.1"
                     /db_xref="GeneID:59323826"
                     /translation="MSRSGSQRTSKQNNWRRSFKACLNCRARKVKCDLGPLDAPNDPP
                     CRRCRREGKVCEFSEASKRTLRDKSMNLINSETNDDSDGWRTAIVGMINGNRGTPNNA
                     HNISSSGLKWKFDTNSMQSALVFLAKAAGSVAKQDDSMTQLDRQAMSSASSGAQQGSL
                     ISNVSLSISDDSTAVSLQDIDTSSERAAPLIKKLSSVRPKSSRRLTDIQYIGPGKLIT
                     EDEAVKLIEVFFLTMHPFFPHIPLQLHDPRELVRYPLLLCAIITISARYHAFHEIGLK
                     DDDSHRRHIKVHEQLWVNCQKLISKTIWAEASTRSIGTVLAFLLFTEWNPRAIHWNWP
                     DYANQGDDAQNSRMEVSEWSNTEGDGGLSGMAAIRRSDRMNWMLTGTAVRLAQDMGLL
                     EISGKIFTAAHIAETYTAMNVGQRSTLSESLSEINFDALEADRSTESAERIGGNEKFY
                     LEQILQDDESKGRWTGFLHDIKESSSNCGAGPLSDVELEFLNDEYVLYYAASDDSRPR
                     NSPDTLPYPLRFTQVQRAKIELLRIISIGYESIYSGKDRQQLLLNDPRRNLALLQIIS
                     PLIESWGKTYQALQKPAEGSLDDSGSNPSHSRRQSLSLVQTIDGESLICEYNYCQLYV
                     YSLALQVDVRESQLKPNDITRCAKYVELAYNAAKKLLASATRLQRLQLLKCVPVRWIV
                     RIVRSVAFIVKCYLTLMGNTALNDPLTSTILKLTVISPEELLQTIQTAAIILREASPD
                     ELHLCTRYSTILMYLCSEMHNKEPQPPRPARETSRPQHTPQDTTTAFLNDCPNSHRTP
                     SLPAEVLDWFTTSDEIGLDFVESWTEMIEQRYLQNSEDVKEQLLDSFYDQLSSSSLHS
                     PHKH"
     gene            <993645..>995612
                     /locus_tag="HG536_0A05450"
                     /db_xref="GeneID:59323827"
     mRNA            <993645..>995612
                     /locus_tag="HG536_0A05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281510.1"
                     /db_xref="GeneID:59323827"
     CDS             993645..995612
                     /locus_tag="HG536_0A05450"
                     /inference="similar to AA sequence:RefSeq:NP_013708.1"
                     /note="ancestral locus Anc_5.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137405.1"
                     /db_xref="GeneID:59323827"
                     /translation="MPRSIRVGDCFDNDDNGVWSWYLSHIRSGDFEEFSRNELKISLL
                     KRFLNTHFGPASRGQCKQNTKILFVSIPDQVHRDLPLLENFLRDYFHLEHLEHIEITR
                     LTQSRVYNHENHYVLIDRVNNFGDPTFLQFASSKWQSQLSHQRARKLSNPASSIDMDQ
                     KLCGTVTERSGLSSDSTSSDGTRNLGYGYRREPQFVEVNSIQSESTTEPADSNCRAED
                     DIGDGDSASVVLNFSHSLLRRRIEARKLAALKEQQRTKNVEDDEQSSSMPDGSCTIYS
                     PPISENVSINSFEESINDRRSYSGQPISLTITRNEETNNESSDESQEEKTSDVSSISE
                     SMNSLESATSFGEDCDLDNGSESSDYSVLSILPSISISDAMGHFRLVLQSTLLQNPET
                     KEIYTAIRQSNNQPAVADVEDDWLLYDSHFSMNNLQMLTLQDLLDANRSFPKIIFYSM
                     IVVSDEQEELLNLSNTHNGLESSSQMTLQRATNATPAVPRVNSTISVSEDPQEFYASI
                     DDVKASFSKQSGPQTYAATRVQSNATAGHISVRRVNSIGDWAFSHNSDPRISDREKRH
                     NTNGIDTHAESNKQGIQWLSLNKPPSRNRLSKVSTVGSLNVVERSKSTPLPGSLNDMD
                     GECKHWKDKITAFRRKKAQRGHGNERDCVIM"
     gene            complement(<995715..>998018)
                     /locus_tag="HG536_0A05460"
                     /db_xref="GeneID:59323828"
     mRNA            complement(<995715..>998018)
                     /locus_tag="HG536_0A05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281511.1"
                     /db_xref="GeneID:59323828"
     CDS             complement(995715..998018)
                     /locus_tag="HG536_0A05460"
                     /inference="similar to AA sequence:RefSeq:NP_010710.4"
                     /note="ancestral locus Anc_5.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137406.1"
                     /db_xref="GeneID:59323828"
                     /translation="MGNTPSVQQQQQYQQHANAANGQADAIPPFKPGNYASDIVNSRQ
                     QSITSQLFPSRNTRHLKSKKIGSKRDNIYHSHTPSLFKSDYSMENTVKEARESGGSTE
                     NINNNMAGLSLKPSHDNGQVPSFLTPGHSTPTVQPTRQDAVPAADLQNRLKNSLKSPR
                     QFQDAATQNRPSVVALKKNLMNDSEASSTSPRSPSADNSGSECVDIYSALHLQLPKSP
                     ASKTNDENNDADADTSDLDDISDDGYLQCEDVVLNQSFLQNVLRRDMKRKRPKNAKEK
                     LGNTSLVEQSKIDKNAFSYESLENGNLPESKKLKSLGYGTDLPSFQSTSNPTTKEARN
                     DRFDGFDHLHHDLGFNRIDSFEKGSIEHRETERMSPKRHNSSSISPSTSSVLSNAEPE
                     KVHVILKWRDPIEDPSKCKITVISTDIASALNFDPSDKSFHGTFSMEFDENDRTFYVP
                     DLWLPPGIYKFQFIINGEIRHSNALPSATDSVGNIVNWFEVLPGYEKVEPYRNEIEVP
                     NYPHQISEPDNSHRNPSPSQGTLLEPVPNRGERPLLAARHTSSYSNRPERSGTPYSDY
                     TGVSRCNSAMRKSPMMQQTSSSIDLITALKPKKYEYSNEIPELFKAGNFLGQNDENEF
                     PTPPQPPAEPPSYDQPSFLQNVVDCNQDNLFANLQQGGLLDAETAEQLFLDKYPVPDL
                     PVYLNSTYLNKIFNEFQKPNYLSGNSNGLNHIIPHVNLNHLLTSSIREEMISVGCTTR
                     YEGKFITQIIYAPCYYASGSKKESNGN"
     gene            complement(<998381..>1000006)
                     /locus_tag="HG536_0A05470"
                     /db_xref="GeneID:59323829"
     mRNA            complement(<998381..>1000006)
                     /locus_tag="HG536_0A05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281512.1"
                     /db_xref="GeneID:59323829"
     CDS             complement(998381..1000006)
                     /locus_tag="HG536_0A05470"
                     /inference="similar to AA sequence:RefSeq:NP_013707.1"
                     /note="ancestral locus Anc_5.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137407.1"
                     /db_xref="GeneID:59323829"
                     /translation="MSIQTVKRPLELGNDAAYSNELDSTEVVKRAETKKKGAKPGRKL
                     LDDEAKNKRTAQNRAAQRAFRERKERKMKELEEKVKNLEQMNQNSMLETEFLRSQLSS
                     LVSELKRYRPEKDSDVQVLDYLAKHEEAEKAGEHGEPYGSVKRDSDDIEANIRRKMDF
                     TFAFPWKGRKDTDAAQFPSPGSSMVSSSSTSVNSSSSMGRRRSSQRTNSENSANSNKN
                     SLSLGSVPIINQTPSSRSNSSSTSGTGWMDNMFYNDDARQLPQFASGSAKNESVGAPL
                     NYDSTLFSNQFNFDDQFDEQVSEFCSKMNQACGTKECPILSNKSLTGLTPVSVGNDAT
                     MRTRDLVSPSLLTNSWDTKTSPAFGQTSFPSGGLTPGKLTNEFPAGDGFTFAYDDNDK
                     KKQDLLPFIDANIAFPNEDDEGLFFRENPGENNLFSEFLDDTEANDAVDNFVNDNLIN
                     EEPAATSRQQQDKQTPEKDVVPSRDGKLLKCSEVWDRITAHPKYSSIDIDGLCGELMT
                     KAKCSEKGVVVEAEDVQSVLDRHMSKKQPQINL"
     gene            <1000604..>1001728
                     /locus_tag="HG536_0A05480"
                     /db_xref="GeneID:59323830"
     mRNA            <1000604..>1001728
                     /locus_tag="HG536_0A05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281513.1"
                     /db_xref="GeneID:59323830"
     CDS             1000604..1001728
                     /locus_tag="HG536_0A05480"
                     /inference="similar to AA sequence:RefSeq:NP_013706.1"
                     /note="ancestral locus Anc_5.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137408.1"
                     /db_xref="GeneID:59323830"
                     /translation="MSDATELRRRQAEFSKELHGDDIGSKTGVSAFLSKNRSAQKEAV
                     TKYLKHWDGKVDKDAEDRRLEDYNESTHSYYNVVTDFYEYGWGSSFHFSRYYKGENFF
                     AAMARHEHYLAYKAGIQKGDLVLDVGCGVGGPAREISRFTGCNIIGLNNNDYQIAKAK
                     WYSKKYHLEDQLDFVKGDFMNMDFEPNTFDKVYAIEATCHAPSLEGVYGQIYKVLKPG
                     GTFAVYEWVMTERYDESNPKHRKIAYEIEIGDGIPKMFHVDVAKQALTNVGFEVSVAQ
                     DLADNDDEVPWYYPLTGEWKYVQTLTDLGTFFRTSFFGRKFTSAMVSLMEKVGIAPEG
                     SSKVTNALEEAAIGLVAGGREKLFTPMMLFVAKKPLDASD"
     gene            <1002125..>1003795
                     /locus_tag="HG536_0A05490"
                     /db_xref="GeneID:59323831"
     mRNA            <1002125..>1003795
                     /locus_tag="HG536_0A05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281514.1"
                     /db_xref="GeneID:59323831"
     CDS             1002125..1003795
                     /locus_tag="HG536_0A05490"
                     /note="ancestral locus Anc_5.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137409.1"
                     /db_xref="GeneID:59323831"
                     /translation="MPVRYDTKHIDHPVWRDFPTSLADMRHRVIDQPLREVTWFKKEK
                     AAEDESGGDTDIMATDAPDTKGGPAEEDDKRNKYWAIITTGAGLFSDGYINNSISTVS
                     LCLSIIYGDQYLNSRAIQNVSSIAFAGTVVGQLGFGYIADNYSRRAGMLIGTTMLILF
                     TILCAGAWGVGTSGTNAGGLFAAITAYRFFLGIGIGSEYSSSSPAAAEASNLLPAGKR
                     NRYFCWFTNFMIDSGFVVSSFVPLVLLWICGSDHLTPVWRITIGLGALPPLSLFYLRL
                     KYKESAAFRKTKFQKVMPYWTIIKFYWFRLAVVSIIWFLYDFSAYAFGTYSSIIISIV
                     LGEDASLVQRFGWNVVLNLFYIPGAFLGAIFADWWGPRNTLTIGLIVQAALGYVMAGA
                     LEHLRKHIAGFVVVYGIFMTMGEFSAGDNVGLLASKTISVPVRGTLYGVAAAIGKVGA
                     FVGSYVFPDIIRNAGGYDTTSGLQAPYWVASSLCVFSALLGYFFLPPVDQESSNEEDR
                     KFLEYLSSTGYDIIQLGYPEDSKVEFGHESSSDADWKTKEKDHTEEIF"
     gene            complement(<1004097..>1004528)
                     /locus_tag="HG536_0A05500"
                     /db_xref="GeneID:59323832"
     mRNA            complement(join(<1004097..1004327,1004394..1004416,
                     1004507..>1004528))
                     /locus_tag="HG536_0A05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281515.1"
                     /db_xref="GeneID:59323832"
     CDS             complement(join(1004097..1004327,1004394..1004416,
                     1004507..1004528))
                     /locus_tag="HG536_0A05500"
                     /inference="similar to AA sequence:RefSeq:NP_010712.1"
                     /note="ancestral locus Anc_5.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137410.1"
                     /db_xref="GeneID:59323832"
                     /translation="MSSLSSNPILKASDISEELKEDVFAISSEAVDKFELERDIAGSI
                     KKQLDVKYGSTWHVIVGKNFGSYVTHEKGYFMYFYIGPLAFLVFKTA"
     gene            <1004689..>1006479
                     /locus_tag="HG536_0A05510"
                     /db_xref="GeneID:59323833"
     mRNA            <1004689..>1006479
                     /locus_tag="HG536_0A05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281516.1"
                     /db_xref="GeneID:59323833"
     CDS             1004689..1006479
                     /locus_tag="HG536_0A05510"
                     /inference="similar to AA sequence:RefSeq:NP_010713.1"
                     /note="ancestral locus Anc_5.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137411.1"
                     /db_xref="GeneID:59323833"
                     /translation="MNIFADSEEEDNNPFSGTNHLYASGIAAVADGEDDFIPKGIFVE
                     EEEEDVSEVDSGRDKSAVSHKQDDEVHDESFGASSLTANAPFEPYVSLSMSMANGNAG
                     AALPEDNAVISIPEAGDYKDPWGKHAIGYVIKYQGKEIIRRYSEFDTLRQALIRLLPT
                     IVVPPIPSKHPLIKYFLSPLSVENDSRIIEKRKRMLGSFLNNCHAICEIRDHIVFAKF
                     LNPEYSWKNVLNSPPIVILPMNNLLAPPLNPTKPSPLHLLLPAQTALSRLDPKAHNGS
                     SIELETKFAHLEGYLAKYKQALQPLHRILRQHRLHFRNLSALFSELGAYYNAFSLEGN
                     VITSKLSAAQIKPLSNGIEKIGHGFDVNYVSSEILVEKLLTVLEEPASEILQFLEESQ
                     RVLLFRKLKKLQYQIIENTLAKREARIKSLKETQHQLQRLEEALLQNARESPTIAKAV
                     KHRESGNLSENADQIESQNAESEQQNLGPTQSSHTQPPKPRKRDKARRSARSSDMEPH
                     LLTEEERQEEIQRLYKEVEKLNDCFALIKKDMDEVNQSSLRSLSALVEYIDRKWTVML
                     KDFAKAMVCWLRECLNAWQNARQIVSGIEP"
     gene            <1006710..>1007900
                     /locus_tag="HG536_0A05520"
                     /db_xref="GeneID:59323834"
     mRNA            <1006710..>1007900
                     /locus_tag="HG536_0A05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281517.1"
                     /db_xref="GeneID:59323834"
     CDS             1006710..1007900
                     /locus_tag="HG536_0A05520"
                     /inference="similar to AA sequence:RefSeq:NP_010715.3"
                     /note="ancestral locus Anc_5.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137412.1"
                     /db_xref="GeneID:59323834"
                     /translation="MPTSHEIDTVLTTLQMEADPELAPLFLEFEELYEQKLWHQLTER
                     LTVFFDDSRSIPLRLRVYCNFVSKFHDKINQLSVVEFLLQSLKTHEDHDESLKFLTEL
                     EQSFKDIDAKKQRNDGLKDHENGCLLIEIEIARIYLSKNELVKSRDLLDELEKLLDQR
                     DAMPLKVTNAFYLANAEYYRLKQDFNSFYYTSLLYLSTIPQQEKQPEEDADKYKELAY
                     NLSIAALLGDKIYNFGELLRHPIMKSIINDSAYKWLFDLLNALTVGDFDQFDSLIGVQ
                     IPKVPILSEHESFLRQKICLMTLVESVFAKNIRTLSFDDIAEATHLPKSNIEHLVMRA
                     ISLNLIKGSIDQVNELVSVTWVQPRIINAEQIARMKDKLVEWSEEVSALGEKIDANGR
                     AIWV"
     gene            complement(<1007920..>1008672)
                     /locus_tag="HG536_0A05530"
                     /db_xref="GeneID:59323835"
     mRNA            complement(<1007920..>1008672)
                     /locus_tag="HG536_0A05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281518.1"
                     /db_xref="GeneID:59323835"
     CDS             complement(1007920..1008672)
                     /locus_tag="HG536_0A05530"
                     /inference="similar to AA sequence:RefSeq:NP_010716.3"
                     /note="ancestral locus Anc_5.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137413.1"
                     /db_xref="GeneID:59323835"
                     /translation="MGTDESRYGRTETFYRPQPSSDAGKALVFIHGGAWIDEACTPTV
                     FKQLSALLAHRSEQELAYSLFSIDYRLSPNVRHPVHVQDVVENLYRLVEDHRLTSLQL
                     VGHSVGATLAWQTAVADESLFPSLDRLNTVRSRLQGVFMVDGIYSLAQLLDEYPNYDY
                     FVSQAFADYTRDFEEFEQSTDRLPETLRHIHLIHSYGDELLSLRQSNYMSSVLQKARI
                     SFSSYFDDMGLHDEVPRNAKLANYLLHNVKFA"
     gene            complement(<1008760..>1009584)
                     /locus_tag="HG536_0A05540"
                     /db_xref="GeneID:59323836"
     mRNA            complement(<1008760..>1009584)
                     /locus_tag="HG536_0A05540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281519.1"
                     /db_xref="GeneID:59323836"
     CDS             complement(1008760..1009584)
                     /locus_tag="HG536_0A05540"
                     /inference="similar to AA sequence:RefSeq:NP_010717.1"
                     /note="ancestral locus Anc_5.536"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137414.1"
                     /db_xref="GeneID:59323836"
                     /translation="MTETLLPEVVENPDGSKSVISYRIENGQKYRVTQKVREIKVTEK
                     VHKSVAARRQWAKYGEERNAPPGPNHSTTQLGEEVQLRLSRNWRQLEQEETKKAKISS
                     DNVISCRLCGNAHYTMNCPFKSILNDIAALEDPGSTAAQGVEAQEETPAAAAAAAVDG
                     GARYVPPSLRAGAKDPSSDAYRDARERDDMSTLKITQLNENADENTLREELLFPFAPI
                     PKVVVVRNRETGRSRGLAFVTFASEEIAEQALQFLDGRGFMNLILRVEWSKPKVKE"
     gene            <1009801..>1010013
                     /locus_tag="HG536_0A05550"
                     /db_xref="GeneID:59323837"
     mRNA            <1009801..>1010013
                     /locus_tag="HG536_0A05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281520.1"
                     /db_xref="GeneID:59323837"
     CDS             1009801..1010013
                     /locus_tag="HG536_0A05550"
                     /inference="similar to AA sequence:RefSeq:NP_013705.1"
                     /note="ancestral locus Anc_5.537"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137415.1"
                     /db_xref="GeneID:59323837"
                     /translation="MAKAKSKNTIVKLISSAATGYSRHVTVSRGAPLVKQVRYDPVAQ
                     RHVLFTEAKKRKIAERKPLDFLRTSK"
     gene            complement(<1010113..>1013172)
                     /locus_tag="HG536_0A05560"
                     /db_xref="GeneID:59323838"
     mRNA            complement(<1010113..>1013172)
                     /locus_tag="HG536_0A05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281521.1"
                     /db_xref="GeneID:59323838"
     CDS             complement(1010113..1013172)
                     /locus_tag="HG536_0A05560"
                     /inference="similar to AA sequence:RefSeq:NP_013703.1"
                     /note="ancestral locus Anc_5.538"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137416.1"
                     /db_xref="GeneID:59323838"
                     /translation="MSESQGDDKVADKEVKSDEVVPVVTTGEEQKTSNDTTGEDGKQV
                     AGSVEKATEGSSKESEAENAVASLNGEKDEAKVEATHKRPREERTVEEPKEEKERGNE
                     EEERDDSDGDDDEDEEEEEEEGGPSKKRRQERNRFLDIEAEVSDDEDEEEDEEESELI
                     REGFITRGDDDESAEAQREDRLHRQLDQDLNKSSEEDAQRLAKELRERYGRSSSKQYR
                     AAAQDGYVPQRFLLPSVDTATIWGVRCRPGKEKELVRKLLKKKFNLDRAMGSKKLKIL
                     SIFQRDNYTGRLYIEAPKQSVIEKFCNGVPDIYIAQKLLIPVQELPLLLKPSKSDDVA
                     LEEGSYVRIKRGIYKGDLAVVDQISENNLEVMLKIVPRLDYGKFDDIDPATNQRKARR
                     PTFAHRPPPQLFNPTMALRLDQANLYKRDDHHFTYKNDDYVDGYLYKSFRIQHVETKN
                     IQPTVEELARFGSKEGAVDLTSISQTIKKAQAARVTFQPGDRVEVLNGEQRGSKGIVV
                     KTATDVATVKVPEFPSKPLEFLMSSLRKVFEPGDHVTVVSGEHQGDAGLVLTVKQGQV
                     TFMSNQTREEVTITANNLTKSIDSTPTSSQYALHDIVELSAKNAACIIQAGHDIFKVI
                     DDSGKVSTITKGSILSKINTARARVAAVDANGNEIKIGDTVVEKVGARREGQVLYIQS
                     QQIFVMSKKILENAGVFLVNPMNVEAIASKDNLLNNKLDLNKINPDVISKMGPPSKLG
                     LQQPQQNQLRLGRDLALGKTVRIRSAGYKGQLGIVKDVNGENATVELHSKNKHITIDK
                     HRLTYYNREGGEGVTYDELVNRRGKLPQARIGPSYVSAPRHMATGGNVGAPHAPGQPL
                     AGGMTPGWSSFDGGKTPAVNSQAAAGSASNWGSTSTWGGASAWGGQPAGGASAWGGQG
                     TGATSTWGGNSAWGSKSSWGGASTWASNDDSNGASSAWGGRGDRSSYGGTSTWGGNKN
                     AGGASSWGNTAQAPGSTWGGHDSGSRSTWGDQGNRSEYGGGSSWGHR"
     gene            <1013418..>1013939
                     /locus_tag="HG536_0A05570"
                     /db_xref="GeneID:59323839"
     mRNA            <1013418..>1013939
                     /locus_tag="HG536_0A05570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281522.1"
                     /db_xref="GeneID:59323839"
     CDS             1013418..1013939
                     /locus_tag="HG536_0A05570"
                     /inference="similar to AA sequence:RefSeq:NP_013702.1"
                     /note="ancestral locus Anc_5.539"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137417.1"
                     /db_xref="GeneID:59323839"
                     /translation="MELSYEKVEAFMKVKVPQEIEDEILATYAAFSLEHDMTLDELEK
                     YFEQLELPRELTKIIPRNELVIEGTNVVDFAKLLTSTYHLLIFMNNEKTISEMWSLLV
                     EGCGRDRDFPQVQLKNHVLSLKDLQKIRNYIGVEQSSGIVEMISVATDGRRVYMTYLD
                     FAYVLGKLGYLRF"
     gene            complement(<1013956..>1014597)
                     /locus_tag="HG536_0A05580"
                     /db_xref="GeneID:59323840"
     mRNA            complement(<1013956..>1014597)
                     /locus_tag="HG536_0A05580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281523.1"
                     /db_xref="GeneID:59323840"
     CDS             complement(1013956..1014597)
                     /locus_tag="HG536_0A05580"
                     /inference="similar to AA sequence:RefSeq:NP_013701.1"
                     /note="ancestral locus Anc_5.540"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137418.1"
                     /db_xref="GeneID:59323840"
                     /translation="MQVPLWRFFLAFSALLASVVTALRFDIPASTKPEPFCVRDFVNE
                     GQLVVIDISTDGSAGDGQTLNLYVRDSIGNEYRRKRDLVGNARVAFTAPSTTSFDVCL
                     ENVATYSGRSMSRSVELDIESGSEARDWNKISASEKLKPIEVELRRIEELADEIVDEL
                     TYLKNREERLRDTNESTNRRVRNFSILVIIVLIALGLWQVNYLKNYFKAKHII"
     gene            complement(<1014788..>1017757)
                     /locus_tag="HG536_0A05590"
                     /db_xref="GeneID:59323841"
     mRNA            complement(<1014788..>1017757)
                     /locus_tag="HG536_0A05590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281524.1"
                     /db_xref="GeneID:59323841"
     CDS             complement(1014788..1017757)
                     /locus_tag="HG536_0A05590"
                     /inference="similar to AA sequence:RefSeq:NP_010718.1"
                     /note="ancestral locus Anc_5.541"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137419.1"
                     /db_xref="GeneID:59323841"
                     /translation="MLRFQRFASTYSQRQVLRRYPVGATIHGYEVQRVMPVPEFKLSA
                     VHLVHSQTGSEHLHIDREDSNNVFSIGFKTNPPDCTGVPHILEHTTLCGSYKYPVRDP
                     FFKMLNRSLANFMNAMTGPDYTFYPFSTTNKADFENLMSVYLDATLNPLLKPEDFYQE
                     GWRLEHSQVEDPESDIVFKGVVYNEMKGQVSNANYYFWIKFQDSIYPSLNNSGGDPKK
                     ITDLQYHELVDFHQRNYHPSNSKTFTYGNIPLDSTLKRLNEQFIGYGKRKSSKRPLLP
                     IELGKDVEANFHGQVDPMLPPDRQLKTSMTWICGSPRDTYETFLLKVLGSLLMDGHSS
                     VVYQRLIESGIGLDFSVNSGVESNTSVNFLTIGVQGASDVSKFRRTVDEIFTDVLKKP
                     FDRQKVEAILQQLELGKKDHKSNFGLQLLYSLLPGWTNEVDPFEGLQFDETLQRLRED
                     YETKGDRLFYDLINKYVIDKPCFKYSMQGSEDFSKNLEEEEKKRLQAKLSHLDENDKE
                     VIYRRGLLLQEKQNLKEDLTCLPSLKISDISRNGDSFPVDKLSPVITSRITDTNGITY
                     IRAKRKLNDSIPAELYPYLTLFADSLTSLGTSTEDYSEIEDAMKLHTGGISTHIDVTT
                     DPVTLRPHLYFKFDGWSLNSKTDHIFDIWKKLLVDTDFRKHSDKLKILVRSLASSNTS
                     AVAESGHSFARGYAGAHYSATKAIGESLNGIEQLQLITRLSNTLDDEQAFQTNLVDKL
                     IELKEHVIRSENLEFFVTTDSHPSAEQVQTQISKFVETLPRGATHGGLEAAQYPLLPM
                     RAGISNTLIDFPFQVHYAASVLPGASYTHVDGAHLQVLASLLTFKHLHREVREKGGAY
                     GGGATYSALDGLFSFYSYRDPHPLQSLETFSKSASYVLNNARWTKADLDEAKMTIFQQ
                     VDAPISRKSEGITNFYSNVTDAMRQARREQLLDTSLSDVQNVTEKYLLNKHPANAVVG
                     PIIDGKTTEAGWQVEQL"
     gene            <1018156..>1019298
                     /locus_tag="HG536_0A05600"
                     /db_xref="GeneID:59323842"
     mRNA            <1018156..>1019298
                     /locus_tag="HG536_0A05600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281525.1"
                     /db_xref="GeneID:59323842"
     CDS             1018156..1019298
                     /locus_tag="HG536_0A05600"
                     /inference="similar to AA sequence:RefSeq:NP_010720.3"
                     /note="ancestral locus Anc_5.542"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137420.1"
                     /db_xref="GeneID:59323842"
                     /translation="MSESHEQQPPMEEYTEEAAPPAEPPVVEQEPPAEELQEPPHPEE
                     HGEVPPQEREELPHERHPMDHGMMEEHHHYPGPQPYYPPPPQLEGELSTTRLFVRPFP
                     FDVQESELNEIFTPFGNMKEVKILNGFAFVEFEEAESAARAIEEVNGKTFANQPLEVM
                     FSKIPPKRYRIVLRNLPEGCSWQELKDLARENNLETTFSSVNTRDFDGTGALEFPTEE
                     VMNDALEKLNNIEFRGSVISVERDDNPPPIRRSNRGGFRGRGGFRGGFGGGFRGGYGG
                     PRGGYGGPRGGFGGPRGGFGAPRGGFNAPRGGYGAPRGDYGAPRGGYGAPRGGYGPPR
                     GGYGAPRGGYGAPRGGYGAPRGDYGAPRDSYRTRDAPPRERSPTRQ"
     gene            complement(<1020020..>1021825)
                     /locus_tag="HG536_0A05610"
                     /db_xref="GeneID:59323843"
     mRNA            complement(<1020020..>1021825)
                     /locus_tag="HG536_0A05610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281526.1"
                     /db_xref="GeneID:59323843"
     CDS             complement(1020020..1021825)
                     /locus_tag="HG536_0A05610"
                     /inference="similar to AA sequence:RefSeq:NP_013699.1"
                     /note="ancestral locus Anc_5.543"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137421.1"
                     /db_xref="GeneID:59323843"
                     /translation="MPIVRHNDEEYHLSHEEEEKLNEFRSITDFPEDDLPLIIRLLQN
                     YGWHLERALGLYFDGDWKRSVTTTDLPAIPVRPPTPAAIRAGTAPIGQREPFVASDAH
                     MIPSLHTVQPLPENFRDHFSVVGLGGKRGDVWNITSQESPFLIILMFIPRVLMKLGAR
                     ILFLLWSLITFGFQSHIDERTKVCKIPDAPKKRSGSLKEVLPQHMDEKSLARLNRLIS
                     DLSFNEALKVCQEEFKYLLLIVIGDVIDVGAPDFNSRRFLSKVLSNPAVISLLEKYKD
                     ELVIYLRSADELETWLVAQQLHVKYTPECLLIANVLNSNGSLNGITRLSVLSKVRISS
                     PKKFENSLKVSLERFHPELVVSRTEQAELRLAREIKEMQDAAYEASLEQDRFKEQERI
                     LKEQQERELKQSEQEREKEREMKETLKHLTWLQCCIEVANQELSPSDTKKKATLQIRT
                     SNGQRFVKKFASTTSLRALYVNIGCHLYLQTYTNDSKEWVSSMVKKIESLTQSSSVHC
                     FKGSSISFSNTNIGDLAEIIEDELNKLTIERSTNLEFDFELVSPFPREKISVDENLAL
                     KDVSQLWPNGSLLVEDIIEESDVDEDDDEAESIDE"
     gene            complement(<1021992..>1022807)
                     /locus_tag="HG536_0A05620"
                     /db_xref="GeneID:59323844"
     mRNA            complement(<1021992..>1022807)
                     /locus_tag="HG536_0A05620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281527.1"
                     /db_xref="GeneID:59323844"
     CDS             complement(1021992..1022807)
                     /locus_tag="HG536_0A05620"
                     /inference="similar to AA sequence:RefSeq:NP_013698.1"
                     /note="ancestral locus Anc_5.544"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137422.1"
                     /db_xref="GeneID:59323844"
                     /translation="MAELREEEYVHKVYNEIAGHFSETRYKPWPIVTQFLESRQVGSI
                     GIDVGCGNGKYLNVNPQIFLIGSDRSSGLIQCAREIDGRHNVLVADGMRLPHRDGTFD
                     FAISIAVVHHWTTRERRIAAIGHILSKLRAGGEALIYCWALEQRSSRRGYHEGMEQDV
                     LVPWVLQEKGNKSSLQTRQAAEKPDLTDVPAQERARYIANWRKEMEARRIAEQENARK
                     RQLEEEKKNTKYRFYHLYREGELEEDCTSAGGTVVSKGYEKDNWYVVVRKPAL"
     gene            <1023287..>1024849
                     /locus_tag="HG536_0A05630"
                     /db_xref="GeneID:59323845"
     mRNA            <1023287..>1024849
                     /locus_tag="HG536_0A05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281528.1"
                     /db_xref="GeneID:59323845"
     CDS             1023287..1024849
                     /locus_tag="HG536_0A05630"
                     /inference="similar to AA sequence:RefSeq:NP_010722.3"
                     /note="ancestral locus Anc_5.545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137423.1"
                     /db_xref="GeneID:59323845"
                     /translation="MVDSGLRKIVGLCFLACYVLLGVPLWYKLTTVYRAPLPVEYIRS
                     LHEGKFQDVHMVIPVFIKSEVYRFPDIHDAVQVQVNHLLNSKKQYVPWSLQILPYEEY
                     NATGSKYGHSDEYHVVSLVLDEFVGYSVAYDAKETTVFFDDAAVVSNDIPFFVAQSLV
                     EHTFALEWEQLSSDFSRHDDNMVVTYNPNMHLSISLLSGDGSPVRWEIEKTLQHYFTP
                     FRKFLAPLVNFTVDTSIIYYNDLNVHALKDGDSVTPQELSHTIDLSELSSMNYLSESS
                     ALNLAIVFPSNVSSPSGLNFIHGVSNNTGSEADWQSFIVPQWGNLIINKNPLPPNALL
                     KESYLVPIMYQFATDLFQLLGLTKGSQDLSSPYVTIDSFKRLTTLRNIDNAEETLWSL
                     VKLTQSFKQMAVPEDVLNNVNQALKLRLEIIDLLNNPEKGGDVVWNQALVLSNKLVKA
                     SETAFFHGEMVQQNFFPQEHKIAVYLPLLGPTSVVIFLGLVKLLKERDAEEGKQDSPE
                     AAEKDEKQGDRD"
     gene            <1025063..>1026103
                     /locus_tag="HG536_0A05640"
                     /db_xref="GeneID:59323846"
     mRNA            <1025063..>1026103
                     /locus_tag="HG536_0A05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281529.1"
                     /db_xref="GeneID:59323846"
     CDS             1025063..1026103
                     /locus_tag="HG536_0A05640"
                     /inference="similar to AA sequence:RefSeq:NP_013697.1"
                     /note="ancestral locus Anc_5.546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137424.1"
                     /db_xref="GeneID:59323846"
                     /translation="MADNDGPLDLIPSVNYPPLLTAANYLSTKQMIDQVVSEDQEYVS
                     WKLKNLRTGGTMNSYMQDRIKEMQGDRKDSRFLTNQASFYDTDLDGQIPKVSSKGEIN
                     EVPSNLRFPRDFYEEMLKGNPRPRELAQDEQFKLLVTNLDEQQTNRFEVFHRTSLNKT
                     QVKKIAGMVINQSVTENIRVFLQAIGKLYAGEIIELALDVRQKWLAGRMMIEFDRRRS
                     VAKSLKKFLKKLTILMENNHENVEDSVDETESDSYFDDDEQQMTQVKLGNKLLKSQNN
                     SQDIRAGLISRYNKLVKEFNAIDVSVEKFANSPILPEHIREAWRLYQLQSDTLPSAQW
                     RTQGEGNGCMFR"
     gene            complement(<1026124..>1027104)
                     /locus_tag="HG536_0A05650"
                     /db_xref="GeneID:59323847"
     mRNA            complement(<1026124..>1027104)
                     /locus_tag="HG536_0A05650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281530.1"
                     /db_xref="GeneID:59323847"
     CDS             complement(1026124..1027104)
                     /locus_tag="HG536_0A05650"
                     /inference="similar to AA sequence:RefSeq:NP_010723.1"
                     /note="ancestral locus Anc_5.547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137425.1"
                     /db_xref="GeneID:59323847"
                     /translation="MERIVQQTDYDALSCRISAISKGYLPSPSLQIERCHYNGYREMH
                     VEYLRALKNVSMKIHSKVYQVAKTSFPVMNYGTYLRTVSIDLALDEFLKLVGEDRKVQ
                     VVNLGCGSDLRMVPLLRNHSNLFYVDVDYESSISVKRKVLWESPMLREMLDLKREDAT
                     GEVSSERYKLLPCDLNRLDQTMRGLEALTGPDCPTVIISECLLCYMADRESQQLIDSV
                     KGFYKSGSWISYDPIGGSAPGDRFGVIMQNNLKESRNLDMPTLMVYNSTEKYASRFHG
                     ADTTASDMWEVLTSQISNEESARLRSLQFLDEIEELKVMQKHYLLLVARW"
     gene            <1027732..>1029780
                     /locus_tag="HG536_0A05660"
                     /db_xref="GeneID:59323848"
     mRNA            <1027732..>1029780
                     /locus_tag="HG536_0A05660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281531.1"
                     /db_xref="GeneID:59323848"
     CDS             1027732..1029780
                     /locus_tag="HG536_0A05660"
                     /inference="similar to AA sequence:RefSeq:NP_010724.1"
                     /note="ancestral locus Anc_5.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137426.1"
                     /db_xref="GeneID:59323848"
                     /translation="MGNTGSKSSKKSSSGKSRGSSPSSTTQPFTRTDTGQSVRSAKSS
                     RSLRSRRSETLGAEGGSSAAAVDEPAGTAHAGTPSNRKDNAQGYEGSEEALENENHNS
                     HLQPGTPHSERRLSSSKRSSFTTADLPPSMIQMEPKSPILKNSNYTSASILNYNENAL
                     TDDDDDRTAETIRNSVLGGRNQLDVLRHNNSPRPSSVRSGSSSKARRRSDGETGLSPG
                     QHPMSRSNSHASSIHSRKSSGSAGTTAYSTPMNSPGVFRKNVDGIDDQDEDYFGVTAS
                     NIDKDSNADSASNLGQPSSLDTTTSGARGHRTDIKNLSRRESTNEYPTSLPMDPDLPD
                     GFVDDKSSSNDNTRQSIGKKKRPVRPLDIDETIQKLLDAGYAGKRTKNVCLKNSEIAR
                     ICHMAREMFLSQPSLLELSPPVKIVGDVHGQYADLLRLFTKCGFPPSANFLFLGDYVD
                     RGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKIFV
                     DTFNTLPLAAIVAGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGLINDLLWSDPTD
                     SPNEWEDNERGVSYCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVTVFSA
                     PNYCGEFDNWGAVMSVSEGLLCSFELLDPLDGPALKQVMKKGRQERKLANQQQMQVQQ
                     "
     gene            <1030019..>1030459
                     /locus_tag="HG536_0A05670"
                     /db_xref="GeneID:59323849"
     mRNA            <1030019..>1030459
                     /locus_tag="HG536_0A05670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281532.1"
                     /db_xref="GeneID:59323849"
     CDS             1030019..1030459
                     /locus_tag="HG536_0A05670"
                     /inference="similar to AA sequence:RefSeq:NP_010725.3"
                     /note="ancestral locus Anc_5.549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137427.1"
                     /db_xref="GeneID:59323849"
                     /translation="MQEGDDGTDKEYEWFSYYISVTSVLVLIIIWSLLPEDDANGLWN
                     NSVFKAVLDVLPQRKWVIYSQCLVLMGMLYAYFAILMYNEDVLTPALDDLRTITDSRG
                     ETIICANDAELLKNYAFKETGGIIDLPIMDVCEILYAKDNATVS"
     gene            complement(<1030599..>1032035)
                     /locus_tag="HG536_0A05680"
                     /db_xref="GeneID:59323850"
     mRNA            complement(<1030599..>1032035)
                     /locus_tag="HG536_0A05680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281533.1"
                     /db_xref="GeneID:59323850"
     CDS             complement(1030599..1032035)
                     /locus_tag="HG536_0A05680"
                     /inference="similar to AA sequence:RefSeq:NP_013695.2"
                     /note="ancestral locus Anc_5.550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137428.1"
                     /db_xref="GeneID:59323850"
                     /translation="MSLEEFLGDDSLGESVWNEEDINLDAITNTTNIDLLKGKRGVGR
                     AEGESHHGGGYMAHGSGDRGEGGGFSSRGPPYIVKFSLLPPRFSDADIEDLFHEKYTK
                     FVKFKLFWELNRNPSIATLKEGGVFEQNFKRTSKVGFVELYSGRDMDKVLKYWTTPLM
                     KIHNIKLEPAQFEDFKEYRLKGELLKDPRDSASRPYLEPRRKSNPFGLAKPVDTQSKI
                     LEIEDKVAKLHIEDTATLRRLSGGGEQSSLLQPGKVTLLKKAPEEQEKKKPLSYLEVV
                     KKSAEESKKQGSSAHSTASPSPLPNRATLAAADMDNSVAATLAQDELDNNNSGDEESS
                     KFTFKNSERAGDAVEPQRGSYQRSPRGGRGGHSRGHGYRGGRGGSRGGGRGGSRYQAN
                     REYNENENYQSRKPNRSQSSNDSRNNQPQGQGSGGGHQDEKRYSMFKPASGFLHESTG
                     DSSSYKHNYRGGSNNRGRPSQRGRFTPA"
     gene            complement(<1032082..>1032567)
                     /locus_tag="HG536_0A05690"
                     /db_xref="GeneID:59323851"
     mRNA            complement(<1032082..>1032567)
                     /locus_tag="HG536_0A05690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281534.1"
                     /db_xref="GeneID:59323851"
     CDS             complement(1032082..1032567)
                     /locus_tag="HG536_0A05690"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137429.1"
                     /db_xref="GeneID:59323851"
                     /translation="MLSSSPAYSSTWPRSACAATVASRNFSPPNKRFGHVTHRDNFES
                     TVLWPRQRFEQAEGQVGRSRWPPEGCRRQLGGQSLPCVPLEALLPGDEGFGRKYGSLK
                     FGELQDYTGIDEHRTERIEDWCRVRDRNRCGTGWKVRIMSMWSFFGAETGFGSCLSKI
                     Y"
     gene            <1032635..>1033783
                     /locus_tag="HG536_0A05700"
                     /db_xref="GeneID:59323852"
     mRNA            <1032635..>1033783
                     /locus_tag="HG536_0A05700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281535.1"
                     /db_xref="GeneID:59323852"
     CDS             1032635..1033783
                     /locus_tag="HG536_0A05700"
                     /inference="similar to AA sequence:RefSeq:NP_010726.3"
                     /note="ancestral locus Anc_5.551"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137430.1"
                     /db_xref="GeneID:59323852"
                     /translation="MISKFSKRWSLGLMMLGLVIVLWVVSSFLISLIFEDNSYRKPFF
                     ITYVNTAAFTMYLLPTARAVVAKYWRTGQLKIREELRLEEEEAEVGSGLLRKDEDEGG
                     VERLSLRETVKLSAEFCVLWFSANFVTNASLAYTSVASQTILSSTSSFFTLFVGALCH
                     VERVSKVKVAGSVVSFVGILLVTRSDSTQSRAGQVKPLPGARVEQGASNEPLVTLIGN
                     VLALSGALLYGVYSTLLKRRVKDESRVNMKIFFGCVGLLTLLFLWPSMVVLDYLGWET
                     FEWPSSTRVVVVIVCNCLITFVSDFCWANAMLLTSPLTVTVGLSVTIPFAMFGDVIFK
                     RKPMTLLYLTGAMLILGAFFIINRSSEEENLETLIEDSDRHSNVVATA"
     gene            complement(<1033866..>1034840)
                     /locus_tag="HG536_0A05710"
                     /db_xref="GeneID:59323853"
     mRNA            complement(<1033866..>1034840)
                     /locus_tag="HG536_0A05710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281536.1"
                     /db_xref="GeneID:59323853"
     CDS             complement(1033866..1034840)
                     /locus_tag="HG536_0A05710"
                     /inference="similar to AA sequence:RefSeq:NP_013693.1"
                     /note="ancestral locus Anc_5.552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137431.1"
                     /db_xref="GeneID:59323853"
                     /translation="MNLGQIWFLWVTILLQEVSYAFLDASEVLSLEDSNGVIRVTEDN
                     YKELSQGLPDYYAVLFITTSKSNKQGLICDMCNGFDPIFQKVSAATHQQVPDSKVLFL
                     KVDVSENNKLVQDLGLTTIPHVLIFPPPEEGEPFSWQKSAFYQYEMSANSVKTPLHFA
                     DFLAKVLKVYIGINEDFEYREFALYFAVFVVAFSLFKRKVLPLIPNKAKFFCMLLSFG
                     ILMLSITGYKFTQMNSIPFIARDPKGQIMYFSGGMGWQFGIEIFTVSMMYIAMGALTV
                     FLIVSPKSTQESNGASLRTTVIACVICYTFCYFIGCFKIKNPEYPFAY"
     gene            <1034993..>1035763
                     /locus_tag="HG536_0A05720"
                     /db_xref="GeneID:59323854"
     mRNA            <1034993..>1035763
                     /locus_tag="HG536_0A05720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281537.1"
                     /db_xref="GeneID:59323854"
     CDS             1034993..1035763
                     /locus_tag="HG536_0A05720"
                     /inference="similar to AA sequence:RefSeq:NP_010727.1"
                     /note="ancestral locus Anc_5.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137432.1"
                     /db_xref="GeneID:59323854"
                     /translation="MSTLVQLLATYYKAVLESERIYYENVNIYASPSTGTNSSGSDSS
                     SRVVEEMFLLQRQVSQLTAEIQSLRRENDDLKSLQATHKALMESKLNNSKKIIEKLKR
                     EQRNDQAAASNESATTPPPAKLRKKQAPFHLLSPMNSRKLDGRTQNNANEATSQPTRL
                     RYVLKGGHQTLFDGDQTMENLSADRSEEAIFVNSLKHKDELANIVLPSDALSDNDGTQ
                     APGKLKKSQPALGGVDVSKRKRKLIRKRIQTANSDNDD"
     gene            complement(<1035850..>1037673)
                     /locus_tag="HG536_0A05730"
                     /db_xref="GeneID:59323855"
     mRNA            complement(<1035850..>1037673)
                     /locus_tag="HG536_0A05730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281538.1"
                     /db_xref="GeneID:59323855"
     CDS             complement(1035850..1037673)
                     /locus_tag="HG536_0A05730"
                     /inference="similar to AA sequence:RefSeq:NP_013692.1"
                     /note="ancestral locus Anc_5.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137433.1"
                     /db_xref="GeneID:59323855"
                     /translation="MGSGTPSSQGSSKSSGGNGKTEVTTLPKEGRPISRRSSHLVSSR
                     EDNGEETRMKGNAETQGASSDGGDVRTAVSPRDVKQDNAGSKEDAVKAENGSEAKGRV
                     RFFWGRQSHVTEQVTDTGETERVAAAASSVPSVTNEIIPHSDDAILYRSKKDTEITEE
                     RESQVLQKQNPNIVVPNFDVLPRKSAWTSLSSSLSTIAHSWHIASGERKRQACLYQRG
                     PEESLYKLSSGGKCPIKVLIVGVHGFFPTKMIRPFIGEPTGTSMKFVSEAEEVVLKYF
                     HKHGRSIEISKIALEREGEVLDRVNFFFDVMRNWLKEINEADFIYFVAHSQGCPVTIM
                     LLSQLIDAGIINLDSTKFFQGEEVPLSRNKKIISIVAMAGINNGPFYGADQTLFVRAY
                     QTIERESLRELFQFQKFDSMLSKMLMRSIRIIIGSGVKITFVGSINDQLVPLYSSICL
                     FANHPNMFRATFIDRGSRTPAFLTRLLNIAGTLLNLGYDDHGIIKEISSSLAGTLTGG
                     GHSTVYNEEQVYELGLRFALETTDVPADVPVEFRPFQLKNLGSNPYHLPWCMRGLLYE
                     TNAHLDPGEISHLFNEFEDWQPDTKQLKDVKYRLNGLRSRL"
     gene            <1037933..>1038988
                     /locus_tag="HG536_0A05740"
                     /db_xref="GeneID:59323856"
     mRNA            <1037933..>1038988
                     /locus_tag="HG536_0A05740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281539.1"
                     /db_xref="GeneID:59323856"
     CDS             1037933..1038988
                     /locus_tag="HG536_0A05740"
                     /inference="similar to AA sequence:RefSeq:NP_013691.1"
                     /note="ancestral locus Anc_5.555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137434.1"
                     /db_xref="GeneID:59323856"
                     /translation="MSVDAKRKQSTIEQFFGKSSKKVKLVEKKETVHAGVDASVEIET
                     EVQRAGQEQLASCSSSEGADAMSNKLTVSLSPFLRNLLTLEIESMESSWLKELQGEFR
                     KPYFVKLKQFVTKEQQGHTVFPPARDIYSWSRLTPFDKVKVVIIGQDPYHNHNQAHGL
                     AFSVRPPTPAPPSLKNIYKELKQNYPDFEIDNTKGDLTPWALQGVLLLNTALTVRAHN
                     ANSHAKQGWEVFTRKVVEALVKDREQDGKSLAFLLWGSNAIKMVESVLSKSSLSQKKN
                     LKVFKSVHPSPLSANRGFFGNNHFRQINDWLYNERKEKMIDWSIVPGCHLEEVQRANS
                     TLEASKTDNVPEVQIDI"
     gene            <1039159..>1040904
                     /locus_tag="HG536_0A05750"
                     /db_xref="GeneID:59323857"
     mRNA            <1039159..>1040904
                     /locus_tag="HG536_0A05750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281540.1"
                     /db_xref="GeneID:59323857"
     CDS             1039159..1040904
                     /locus_tag="HG536_0A05750"
                     /inference="similar to AA sequence:RefSeq:NP_010728.1"
                     /note="ancestral locus Anc_5.556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137435.1"
                     /db_xref="GeneID:59323857"
                     /translation="MSVLPNEHSGEETSSLFSSPKTASTNTSSLNASDSSLLEDISSK
                     NMAPKDGKANGKKRGRHSSALEALLNEANRYNSQYEYALPRGFLRDRNQDKKLHEESQ
                     LEPQGVRKTATKPKKVKTKSQASKTETGSSTAPSSKFKRDRSRSSSRSPIADNDAFPM
                     SQSDELDSRTTEDNVKRHVSHSKEVNFIDWNQVPTDLKYDIFDIANLKIDEDIKDIPV
                     PSISLTSKRYKDDSSVLKVALRSPLYPTYCEEYHVDFSKDSRIYNPMSEIGKLIEYSA
                     SIYLPVRYANELKRSVIPQLNAAFDSSDDILFAAKVNEYNKIIEKVPRSEVIEHLAQL
                     KTLPPSFIHDLLHIVYTRSIHPNYKKLKEYEAFSNYVYGELLPNFLSNVYSQCCLNSN
                     SVFMDLGSGVGNCVVQAALEYGCKLSFGCEIMSNASALTELQNEELIKRCKLAGLKLS
                     PLEFSLRKSFVNNDRVDELIPQSDVILINNFLFDSDMNREVEKIIQNVKVGCKIITLK
                     NLRPCGYTINFFNLDSILNRLRVERFELKEGSVSWTHNGGEYFISTVLPDVDDSLFDP
                     AMRKRNTKRPTHYTR"
     gene            complement(<1040967..>1041530)
                     /locus_tag="HG536_0A05760"
                     /db_xref="GeneID:59323858"
     mRNA            complement(<1040967..>1041530)
                     /locus_tag="HG536_0A05760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281541.1"
                     /db_xref="GeneID:59323858"
     CDS             complement(1040967..1041530)
                     /locus_tag="HG536_0A05760"
                     /inference="similar to AA sequence:RefSeq:NP_010729.3"
                     /note="ancestral locus Anc_5.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137436.1"
                     /db_xref="GeneID:59323858"
                     /translation="MSVEAYAQELKAALHQYPNFPEKGVLFEDFLPIFRCPILFQKLI
                     DAFKMHLEEKFPSGQIDYIVGLESRGFLFGPSLALALGVGFAPVRKAGKLPGELVQAV
                     YQKEYGTDVFEMQREAIPANSNVVIVDDIIATGGSALAAGELVKQVGANVLEYCFVME
                     LDFLKGREKLSSPIFTLLNAQQESLKK"
     gene            <1041702..>1043369
                     /locus_tag="HG536_0A05770"
                     /db_xref="GeneID:59323859"
     mRNA            <1041702..>1043369
                     /locus_tag="HG536_0A05770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281542.1"
                     /db_xref="GeneID:59323859"
     CDS             1041702..1043369
                     /locus_tag="HG536_0A05770"
                     /inference="similar to AA sequence:RefSeq:NP_013689.1"
                     /note="ancestral locus Anc_5.558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137437.1"
                     /db_xref="GeneID:59323859"
                     /translation="MAGTAVSRFCRGRNEDGVLPYLVELTSDHLFTFEMLNSMCLLDN
                     YDHLLFALECQISSSGSVVVPPFDVLLVLMTLATVSEHYKEPASRANDPYNVSRSKLS
                     HRSLKVLRFYTELLKQYDAESGGQYELELLRCQFFIIVDSLIGNTRWGRTGRVKRRRT
                     ENGVSYTSFVSESSDSESAGESSVDNPYRSYMSCLERKKRVLGNELLSTKLKAPGEFI
                     NMILWTLSNSLQENTALYISSHDIWLPLIEILVDLIVLRHDFYVNFELSKSADDRVVS
                     QELSESPLASFLHIIDSSHSGAFFCRCLLLACDYSYDDSYGDIEVHPVFHNENVLSKT
                     YVPRTTYCKSYKLKRSMSLRRGIIGSYFKLLSEVPAGRRLIKPRCTADQLLEDISNSL
                     AKFKNIDEFRAFFITGDLSSALYFMPLLAEGTLGRLLEDFRESGPRELDGRLPLALIE
                     NLDDVDKFLRECTSLFRDGFFVPQQKEIHENQLTNIMKGDICLLVMFQYAIYLNSASE
                     MKSNPRCNELTTAVYRNDKRRKKALMQSSLDLSLPLLRPPILKILKM"
     gene            complement(<1043384..>1047487)
                     /locus_tag="HG536_0A05780"
                     /db_xref="GeneID:59323860"
     mRNA            complement(<1043384..>1047487)
                     /locus_tag="HG536_0A05780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281543.1"
                     /db_xref="GeneID:59323860"
     CDS             complement(1043384..1047487)
                     /locus_tag="HG536_0A05780"
                     /inference="similar to AA sequence:RefSeq:NP_010731.3"
                     /note="ancestral locus Anc_5.559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137438.1"
                     /db_xref="GeneID:59323860"
                     /translation="MLSKPSPPPMANDCSIYRLEELLSSFYKIETIEKINYHQYVPKK
                     QDDQWSIQMELYLRKQNPRNLVALLSRELWCFSINDDPVPTPPKLSAAGNDVTTLDKS
                     GQFTAQYSKPNLPPHYALFLKALRRMIYINLAANSQNKIIPYGNACLFVEKANESQVL
                     QLEPHLFENGDLSLIISTRNLVLVPLTPGRIEEAFLRSHALYLSPSGIRIYLPSSNRQ
                     QCIVPPPRNADVLFKTLLVSHGIDLSARQNVQWVRVIPHLGHLNGYTPNVAAYMDAPT
                     ETRTIVWPLDLCFAQPASDFDEKSQDESSCHDLVKTFDIIDDFIQLKQTSAYRTPTSS
                     NGAAGNSLGTNPVSSGGAYTEQFQHFYKNTGGNPASASYLPANESLNPKASPEDSSPS
                     VSTFEKPLHSSNDKISIDACLTTPNVNENEFNYRRSFTNDSEISPTKSDLTLNSRRDE
                     HRRTSIIKPPASAELSPKADGHASEAITDDLFGDGEEEAGSDDFDLFGESKTSSSSGR
                     TQNFTPEKVESDEITEDMFGMSDDDDRSRSATSKVKDYYLGDDNDMFRSSPSKRPSMK
                     RKYLDIPIEEITLSTSPLYMDPGAPLPVETPRDRRKSVFAPLNFNPIIENNVDNKYKN
                     GGKFSFSPSQHDGSLKFDVSTADISSSDDESDSSADLDDLNIKSEVMSADNLPMNSQY
                     NIYSSVQIPLDSIPPTLNKIEIAPSSISSSVERDSSNAIWRLSHQELANGDSSLISSN
                     DTIPSEQATVKSELHTDQLTFSNKAMAIGGSNTSNLPDSNSGVPESTPATGSLAPESS
                     SSLPFLLRHMPLSSIPAAFWCSNPTVTIKKNDQYILNLLSEQIVFDHNMFSNISKPII
                     RHAGLQKCNEGLISKTIRGLFKSFTRLDGCHLISTMYPIKEPSIYVKKHNSVINISAD
                     SQVFSKFLNVRPAKGIKNFRLLMLTASYCDDCASFVSTLYQTYIGHEFGFCELLKLTN
                     DDSPGLRCLENFDKGRLFLLAAQIVTYCSTNKNAGKDVPVMILLPVDSYNFEELVLKV
                     AKFNIIRNEVTSKIPNAQIFLKVVIMDFIRNPLSSVDEYSNLCVGIYNLLTPKNMKFT
                     SIARKLPEKVTFKTLQQKIGTSAINYDAFIHLAYARSVDKEWVFAALSDSSGKESMIK
                     SWYVGTSKTKFDEACNEIWNLALRLSSKKFGRICLILTRLNGVLPDDELMNWRRLSGK
                     TIHLAVVCVDNDTKISFFDEDKIYPTFKPLLRNPEFSKKIDPKRLDSYEIRDISQDIH
                     AVIFEGCFPLTNSQHRCAIKSGALIKFKTSAGDSIVDKFEVNLLNCPHSDSTKLLKTI
                     LEEFRNLGALSSWFGVSNGEMAHIPWHVLAVKKMMQVMIHTRVKTVD"
     gene            complement(<1047872..>1048357)
                     /locus_tag="HG536_0A05790"
                     /db_xref="GeneID:59323861"
     mRNA            complement(<1047872..>1048357)
                     /locus_tag="HG536_0A05790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281544.1"
                     /db_xref="GeneID:59323861"
     CDS             complement(1047872..1048357)
                     /locus_tag="HG536_0A05790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137439.1"
                     /db_xref="GeneID:59323861"
                     /translation="MSEFYKLAPKDRKGEPFPFSQLEGKVVLIVNVASKCGFTPQYQE
                     LEDLYKKYKDQGLVIIGFPCNQFGRQEPGSDEEIGQFCQLNYGVTFPVLKKIDVNGSD
                     ADPVYEFLKSQKAGLLGFRGIKWNFEKFLVDKKGAVHQRYSSLTKPSSLDATIAELVK
                     A"
     gene            <1048768..>1050924
                     /locus_tag="HG536_0A05800"
                     /db_xref="GeneID:59323862"
     mRNA            <1048768..>1050924
                     /locus_tag="HG536_0A05800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281545.1"
                     /db_xref="GeneID:59323862"
     CDS             1048768..1050924
                     /locus_tag="HG536_0A05800"
                     /inference="similar to AA sequence:RefSeq:NP_010732.1"
                     /note="ancestral locus Anc_5.560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137440.1"
                     /db_xref="GeneID:59323862"
                     /translation="MIMISLERSRADGGLLLFDDRQSLGIGDLCRYRVTADKSQLEEK
                     GIDVDHLFVRVKNEESPLLRPIYLTGPYACYVDVRPHKYDEDRKFDSSETIQFTSDLR
                     PNEHFKAKLHLNENARMESGLYSWIVDVISQVSVSALPKVEYRLRIGTTKAAAKHVAE
                     TSTMKGFTVEKWDTQSLWNLPPKYPEKPVHLVILTHGIFSNIGCDMLYMKDKIEQKCF
                     AMEERINPNVVLRGCMENVGKSARGVRYLGTRVGQYVIAEIERLNETYKVDKISFIGH
                     SLGGPVQAMAIHYIAVKRPDLFDPNTGVKPINFIAFASPFLGVVGDFPRYVSLALDVG
                     ALGITGRDLTLRHTPIFSRNGLGGSRGPSRLHKLILEALPQKPALEVLQRLVHRTVYA
                     NVLHDGIVPLRTAALLYLDWNSLSKVHQIRKQKSLAMKKDSSEAGQAPESAVVYPSSS
                     LDDNHNTASSEIASTVFNEPSGVVENGEDGLAENEEEPLCESANRSGNSSRVEKSEEP
                     SATGDSHKEKTTMGEIPVESMDKRAALQWLIPQGISQGKKYSKYMRTQTVDVSSESSE
                     SDTGLVGTLHVNQEEKKFVPPPAASTVMAAISVITSPVPTQKYIKDPSLRTDAIIHDK
                     VYHPDELPPAHYMNRPFIKKVIYPNESNNRHQERIARAWQETMTWRKVLVDLKPDSHN
                     NICVRRRFTNLFGNVVVHNMVETHFGVQACEKYATL"
     gene            complement(1051021..1051093)
                     /locus_tag="HG536_0Atrna2K"
                     /db_xref="GeneID:59324263"
     tRNA            complement(1051021..1051093)
                     /locus_tag="HG536_0Atrna2K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59324263"
     gene            <1051531..>1053228
                     /locus_tag="HG536_0A05810"
                     /db_xref="GeneID:59323863"
     mRNA            <1051531..>1053228
                     /locus_tag="HG536_0A05810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281546.1"
                     /db_xref="GeneID:59323863"
     CDS             1051531..1053228
                     /locus_tag="HG536_0A05810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137441.1"
                     /db_xref="GeneID:59323863"
                     /translation="MSQTITPNNDLSLVPSLEKAVELSRISDASTPSNKAASDVYELE
                     KPEEIPLAEKPLKEYATVIIMCLMIAFGGFVFGWDTGTISGFVNHTDFILRFGQYNPN
                     TDSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRIGLMGVVMVYVVGIIIQIS
                     SVNKWYQYFIGRIVSGLGVGGIAVLSPTLISEIAPKHLRGTCVSFYQLMITLGIFLGY
                     CTNYGTKKYSNSVQWRVPLGLCFACAIFMVAGMLMVPESPRYLVEKGRFSDARRSLAR
                     SNKLSVDDLGVTCELSAITAGVEAEREAGNATWGELFSAKGKVLPRVIMGVMIQSLQQ
                     LTGNNYFFYYGTTIFKAVGLEDSFETAIILGAVNFASTFVSLWIVERFGRRKCLLWGS
                     ASMAVCFVVFASVGVTSLWPQGSQAPSSKSAGDVMIVFTCIFIFCFATTWAPIAYVIV
                     AESYPLRVKNRAMAIAVGSNWIWGFLIAFFTPFITSAINFYYGYVFMGCLIFSYFYVF
                     LFVCETKGLALEEVNQMYEEGVLPWKSVDWLPAERRSLSYDPEAAHTDDKPWHKRFS"
     gene            <1053397..>1054215
                     /locus_tag="HG536_0A05820"
                     /db_xref="GeneID:59323864"
     mRNA            <1053397..>1054215
                     /locus_tag="HG536_0A05820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281547.1"
                     /db_xref="GeneID:59323864"
     CDS             1053397..1054215
                     /locus_tag="HG536_0A05820"
                     /inference="similar to AA sequence:RefSeq:NP_010734.1"
                     /note="ancestral locus Anc_5.561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137442.1"
                     /db_xref="GeneID:59323864"
                     /translation="MTLIKSEPNTDSSISLLDGKIAGIQKSKDSADSRPALGSKKVNV
                     VSGKKEPTKDLTKYKFEEFLLNAGGGRQANLSSAEFKTGFSSDRALIKKEPDISKNAN
                     PSSYSTPVKRTAAAEESADKEKKKLDTAGKLKKVATQNEERESQTVQKPLKTPGPYRP
                     ITEMLYESSSKSLNESEAPLFQDLDQESERKFCREAGQWSLDEWISQGQMLLNAHTSL
                     VGQLVRERIELSGKFRAITSVINDRAEALNRQGQLLDEKLRKIENLGKEILDII"
     gene            complement(<1054339..>1054953)
                     /locus_tag="HG536_0A05830"
                     /db_xref="GeneID:59323865"
     mRNA            complement(join(<1054339..1054746,1054951..>1054953))
                     /locus_tag="HG536_0A05830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281548.1"
                     /db_xref="GeneID:59323865"
     CDS             complement(join(1054339..1054746,1054951..1054953))
                     /locus_tag="HG536_0A05830"
                     /inference="similar to AA sequence:RefSeq:NP_010735.3"
                     /note="ancestral locus Anc_5.562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137443.1"
                     /db_xref="GeneID:59323865"
                     /translation="MGRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSK
                     RLRNKIAGYTTHLMKRIQKGPVRGISFKLQEEERERKDQYVPDVSALDLSHSKGVLNV
                     DNQTADLVKSLGLKLPLSVTSVSAQRERRFRRRI"
     gene            <1055480..>1056793
                     /locus_tag="HG536_0A05840"
                     /db_xref="GeneID:59323866"
     mRNA            <1055480..>1056793
                     /locus_tag="HG536_0A05840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281549.1"
                     /db_xref="GeneID:59323866"
     CDS             1055480..1056793
                     /locus_tag="HG536_0A05840"
                     /inference="similar to AA sequence:RefSeq:NP_010736.3"
                     /note="ancestral locus Anc_5.563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137444.1"
                     /db_xref="GeneID:59323866"
                     /translation="MSNKFHCDVCSSDCTNRVRISCAECPEYDLCVPCFSQGSYNGNH
                     RPYHDYRIIETKSYPILCEDWGADEELALVKGSQSLGLGNWQDVADHVGSRDKEEVAE
                     HYLKYYVYSQFYPIPDITKDIKVDQEQFLEERRERIERFREKPLQPSRKPMASVPSCH
                     EVQGFMPGRLEFETEFENEAEGPVKDMVFEPDDQPLDIELKFVILDIYNSRLTTRAEK
                     KRLLFENNLMEYRRLQSIDKRRSKEAKELFNRIKPLAMLMTAQDFDEFSKDILEELRC
                     RSRIRQLQEWRSNGITTLEAGLKYERDKQLRISSIERLGTSAQLSANGNSINGRHRAT
                     SAHRSNADYSQNYNESFGGRKKIMTMSDIQHGADFNLLSPDEQQLCIQLKILPKPYFA
                     IKELMFRELLRTGGALKKKNCQDLLNIEPAKASRIYDFFESQNWI"
     gene            complement(<1056812..>1058134)
                     /locus_tag="HG536_0A05850"
                     /db_xref="GeneID:59323867"
     mRNA            complement(<1056812..>1058134)
                     /locus_tag="HG536_0A05850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281550.1"
                     /db_xref="GeneID:59323867"
     CDS             complement(1056812..1058134)
                     /locus_tag="HG536_0A05850"
                     /inference="similar to AA sequence:RefSeq:NP_010737.1"
                     /note="ancestral locus Anc_5.564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137445.1"
                     /db_xref="GeneID:59323867"
                     /translation="MSSKTRYYLEQCIPEVDDLVDKGLFTKREVSAIMSKRTDFEHRL
                     NSRGSSINDYMKYISYEKSVDKLRQKRVKRLLEASKTNSISDWSIQQRIAFIYQRGCK
                     KFPKDLKFWAMYLNYLKTRGNTTSYRKIHNVYNELLKLHPNNVEVWISCAKYEYEVHA
                     NFKSCRVVFQNGLAFNPDVPKLWYEYVKFELNFITKLINRRKVMGLINEREQQMDMLK
                     EQEKGRDVNDDGGITAPSTGDAMKDKLNELPEADMNMLGNEETNPALRGDIALTIFDV
                     CMDKLGECYMKKNRGYFAVTDARLSKDLSVETVKYLYDISKDFISLFDQFQDLQREYL
                     INHALAYWKQSHYSISLQDELPELYINMIMNDITLNIRYMSLESLEVDKLQLSVKKYF
                     AYKSKMDGGLAKDLQKTYSEFLRENYTDKVEKDSDPRYNTLMFIIKKL"
     gene            <1058359..>1059224
                     /locus_tag="HG536_0A05860"
                     /db_xref="GeneID:59323868"
     mRNA            join(<1058359..1058385,1058451..>1059224)
                     /locus_tag="HG536_0A05860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281551.1"
                     /db_xref="GeneID:59323868"
     CDS             join(1058359..1058385,1058451..1059224)
                     /locus_tag="HG536_0A05860"
                     /inference="similar to AA sequence:RefSeq:NP_013687.1"
                     /note="ancestral locus Anc_5.565"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137446.1"
                     /db_xref="GeneID:59323868"
                     /translation="MINHARVWRFAHAIRYLSTRAAETALPNAAAPPRYTLATVRAFP
                     SLEPLTFAPVPASVLAAPLRRDILWRAVVYENDNKRVGSSNPPGRSENGYSRRKLLPQ
                     KGSGRARAGDANSPTRHNGARALARTAPNDYSTILPSKIYSQAITNALSHQYRSGNLF
                     VIGGANTLSQTNELDLNELEIVPTSPDSPSGDIVFERFLEEYDLIKKKLLFIVSEPRE
                     TLMQHTERFKDTVDIVQQELVDVNDLLKAKKIFIELEALEYLTVTHSL"
     gene            <1059670..>1060290
                     /locus_tag="HG536_0A05870"
                     /db_xref="GeneID:59323869"
     mRNA            join(<1059670..1059716,1059897..>1060290)
                     /locus_tag="HG536_0A05870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281552.1"
                     /db_xref="GeneID:59323869"
     CDS             join(1059670..1059716,1059897..1060290)
                     /locus_tag="HG536_0A05870"
                     /inference="similar to AA sequence:RefSeq:NP_010738.1"
                     /note="ancestral locus Anc_5.566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137447.1"
                     /db_xref="GeneID:59323869"
                     /translation="MSLVVQEQGSFQHILRLLNTNVDGNIKVVYALTTIKGVGRRYAN
                     LVCKKADVDLHKRAGELTQEELERIVQIMQNPTQYKIPAWFLNRQRDVNDGKDYHTLA
                     NGVESKLRDDLERLKKIRAHRGIRHFWGLRVRGQHTKTTGRRRA"
     gene            complement(<1060460..>1061755)
                     /locus_tag="HG536_0A05880"
                     /db_xref="GeneID:59323870"
     mRNA            complement(<1060460..>1061755)
                     /locus_tag="HG536_0A05880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281553.1"
                     /db_xref="GeneID:59323870"
     CDS             complement(1060460..1061755)
                     /locus_tag="HG536_0A05880"
                     /inference="similar to AA sequence:RefSeq:NP_010739.3"
                     /note="ancestral locus Anc_5.567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137448.1"
                     /db_xref="GeneID:59323870"
                     /translation="MVLLERGQDGGCFPICIIQQLESLQNVVVKLQKRDFDHLNAQLG
                     YHMIGLWNGGLFTYINRHGSRYWGLLVVMIVQSCLQIRRSTSIMSSEKRLLPSLAVLL
                     NDSRPAIANLRPSFCSGEEGYIRLPPLGDSGISGTRAVESAVRYTVSLPMSSAGSSTP
                     ARATTVSSHTVSQTEPLSVATPSTPVVKRKSLVSSSRKNEMLTPLSAARAVITPSNSE
                     KKRAFAFITHSQETFPTKEPKIDNAPLARRKRRRTSTQELNILQAEFNQCPAPDKRKR
                     QELAERCNMSEKAIQIWFQNKRQATKRQKNSAQKALVAAQLDSTPLASKQLTQIDKHT
                     KSKQPVEETTPEISSGDTTPTKAVPSVSRKEQALTFHLTSDNEVLTPVRTSSNSRIKN
                     LRDSDDRPRSAANSPKTKPTESPTERIPLNELKINALVH"
     gene            <1062264..>1064264
                     /locus_tag="HG536_0A05890"
                     /db_xref="GeneID:59323871"
     mRNA            <1062264..>1064264
                     /locus_tag="HG536_0A05890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281554.1"
                     /db_xref="GeneID:59323871"
     CDS             1062264..1064264
                     /locus_tag="HG536_0A05890"
                     /inference="similar to AA sequence:RefSeq:NP_010740.3"
                     /note="ancestral locus Anc_5.568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137449.1"
                     /db_xref="GeneID:59323871"
                     /translation="MKVTDKLRDRSSGDRLRRMAVYAACSLAIVFYLSMRYRPSVCGV
                     RDGSKTTMEVVSVAEALSEERMESYRALKLTPTKPVVIRDAATGQERKIHGRFLHITD
                     MHPDAFYKEGSSIESVCHQGKPKSKKDRAPRFGYATGGCDSPPDLVDYTLEWIKENLR
                     DKIDFVIWTGDNIRHDNDRRIPRTEFQILDMNEILSGKVQKLFSNPNSENPRDFDVSV
                     VPSIGNNDVFPHNMFALGPTLQTREYHRIWNNLVPQEQQRTFDRSASFVTEVIPGKLA
                     VLSINTLYLFKANPLVDNCSSKKQPGYQMLLWLGAVLEELRQRGMKVWLSGHVPPIEK
                     NFAEGCFDKYTLWTHEYRDIIIGGLYGHMNMDHFIPVDGQASWEAIKASEEGNAYENQ
                     KEGDDDLDMTAHAVAGREAHLMGAKPVGKEAYMNRIREKIYEQVHQKIQKSKPLDAES
                     DDYEGKRKSLKSFEEVCEDYSIVSISGSVIPTFNPSLRIWEYNITDLDTQTQTWQSNS
                     WDRFYETLESIMERDSSNIENEHLDGLEEGFETQRRKKKRGKKPKEDKTVPRKKPKTL
                     PAGPAYTPQLFSPTRFVQFYADLKQINKKYYSFLEAGKTPEEAASQAFKYEVEYVSED
                     GPYPMKGLLVKDFVLLASELATEKKSWAKFMERAFMSTGYTD"
     gene            complement(<1064377..>1064967)
                     /locus_tag="HG536_0A05900"
                     /db_xref="GeneID:59323872"
     mRNA            complement(<1064377..>1064967)
                     /locus_tag="HG536_0A05900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281555.1"
                     /db_xref="GeneID:59323872"
     CDS             complement(1064377..1064967)
                     /locus_tag="HG536_0A05900"
                     /inference="similar to AA sequence:RefSeq:NP_010741.1"
                     /note="ancestral locus Anc_5.569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137450.1"
                     /db_xref="GeneID:59323872"
                     /translation="MVAQVQKQAPKFNKTAVIDGVFDEVSLEKYAGKYVVLAFIPLAF
                     TFVCPTEIIAFSEAAKRFTDIGAQVLFASTDSEYSLLAWTNVDRKDGGLGKVDIPLVA
                     DTNHSLSRDYGVLIEEAGIALRGLFIIDPKGVVRHITINDLPVGRNVEEALRLVEGFQ
                     WTDKNGTVLPCNWTPGAATIKPDVESSKEYFAAANK"
     gene            complement(<1065232..>1067715)
                     /locus_tag="HG536_0A05910"
                     /db_xref="GeneID:59323873"
     mRNA            complement(<1065232..>1067715)
                     /locus_tag="HG536_0A05910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281556.1"
                     /db_xref="GeneID:59323873"
     CDS             complement(1065232..1067715)
                     /locus_tag="HG536_0A05910"
                     /inference="similar to AA sequence:RefSeq:NP_013683.1"
                     /note="ancestral locus Anc_5.570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137451.1"
                     /db_xref="GeneID:59323873"
                     /translation="MECLALAPLKFTVWSSDFSLIRTNLFVNAHPKAKVARLLQYVHS
                     RLSAELNASGDDAMSRLAHVSEYYFHYKHQELSLDTYLQDVEPMHGQGFIRVRFERKK
                     SNSGSAQNLDYDLDYEFATTNLQLNVNVLSVDKIMSVYEPRVSMGMTMARLEKLAVQR
                     LHEYEVQDKKNLCGLKDRHSPSDLVGFIFKGKQTPIQLDAPNSLELYNDMTLSEVLGY
                     DFAPENGSHFTVMFKVRHNLDSVDGEDSLKLEFVSDATLSANEMRVTPDTTVEEVKEF
                     ICSVYTHSLSLSTNDIKLIYKGQLVHVADFAGNASKIMEYINEPGSAKIHVQINQDFN
                     EPGPGFWSELFNSPEAFDFIHRRNQTEEVTSQPMMHSTSARSQAASLPANEMPASIQR
                     TENRRYRYVTRSGLIVHSSHESYIRCTVDGKEVYVPAQELDPITFKLEAGEHSISASS
                     ADCIVENGLIKLSPNLIARLESRLGTSILKDIFIAQELNPSNGGNMGNFSTESGRGQR
                     AFRIVSSLRNGFPIVLLLVRTLYLIGNYSIIPLFFLMRLSELLPRKYIILIAVLYILR
                     AIWSTREIWDMWTSYMNSNVVNETNYREIKDYISSGSLSSEFYGDCRNHPAVIDILMA
                     SNLRELRSDLYDAYSIPNAVEQGNGALTSLFERVHARELNKQPMDAFLVNCLDLYETN
                     RDTTPSSYLDSFKELLLLAHRDQDRTRALHDLPWYKKFVRVTSSQLRRFRRRQLATKI
                     FERIVPDPATDNFFLAVVKNLLLFVCILFPQTKSHVDIVLQQRSNRRAHQETSLRDLE
                     PAVQPEPEPVPDQPAGASGLQLHPEQAQD"
     gene            complement(<1067986..>1068471)
                     /locus_tag="HG536_0A05920"
                     /db_xref="GeneID:59323874"
     mRNA            complement(<1067986..>1068471)
                     /locus_tag="HG536_0A05920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281557.1"
                     /db_xref="GeneID:59323874"
     CDS             complement(1067986..1068471)
                     /locus_tag="HG536_0A05920"
                     /inference="similar to AA sequence:RefSeq:NP_013682.1"
                     /note="ancestral locus Anc_5.571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137452.1"
                     /db_xref="GeneID:59323874"
                     /translation="MSRMPSSFDVREQELDEMPFLDKIVFHCKQQPLVPLGALLTTGA
                     VILAAKNVRSGNKVKAQVYFRWRVGLQAATLVALVAGSYIYGTSVKEQKAKEEQMREK
                     AKIREQLWIQELERRDQETKYRKKRAELARLRTQKDEEAIERLQKELKDLEFQIRGKT
                     D"
     gene            complement(<1068691..>1069251)
                     /locus_tag="HG536_0A05930"
                     /db_xref="GeneID:59323875"
     mRNA            complement(<1068691..>1069251)
                     /locus_tag="HG536_0A05930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281558.1"
                     /db_xref="GeneID:59323875"
     CDS             complement(1068691..1069251)
                     /locus_tag="HG536_0A05930"
                     /inference="similar to AA sequence:RefSeq:NP_010742.1"
                     /note="ancestral locus Anc_5.572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137453.1"
                     /db_xref="GeneID:59323875"
                     /translation="MPRPIVLSGPSGAGKSTLLKRLFAEFPNKFGFSVSSTTRSPRPG
                     EVNGRDYNFVSVETFKTMISEDKFVEWAQFSGNYYGTTVASVKKVIESGKTCILDIDM
                     QGVKSVKYKTDLDARFLFVAPPSLEDLEKRLTGRGTETAESISKRLAAAKAEMEYAET
                     GAHDRILVNDDLDRAYKELKEFIFEE"
     gene            <1069768..>1071642
                     /locus_tag="HG536_0A05940"
                     /db_xref="GeneID:59323876"
     mRNA            <1069768..>1071642
                     /locus_tag="HG536_0A05940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281559.1"
                     /db_xref="GeneID:59323876"
     CDS             1069768..1071642
                     /locus_tag="HG536_0A05940"
                     /inference="similar to AA sequence:RefSeq:NP_010744.3"
                     /note="ancestral locus Anc_5.573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137454.1"
                     /db_xref="GeneID:59323876"
                     /translation="MVFARSLLILAFRLAWCVARGTGGDDDELLPMPDSPGKSGGIAD
                     DPVSDVNPVTEEMFSSWALCILLFLLISALWSSYYLTQRRITAVHETVLSIFYGMIVG
                     LIIRLSPGHYIQDAVTFDSSYFFNVLLPPIILNSGYELNQVNFFNNMFSILTFAIPGT
                     FISAVVLGIIIFIWTALGLEGINISFVDALSVGATLSATDPVTILSIFNAYKVDPKLY
                     TIIFGESLLNDAISIVMFETCQKFHGSPAKISSLFEGIGLFLMTFMVSLLIGLFTGVL
                     VALILKHSHIRRYPQIESCIVLLIAYETYFFSNGCHMSGIVSLLFCGITLKHYAYYNM
                     SRRTQITIKFIFQLLARLSENFIFIYLGLELFTEVELVYKPVLIIVTAISICVARWCS
                     VFPLSRFINWLYRMKTVRSMRGSVGNSISIPDEIPYNYQAMTFWAGLRGAVGVALAMG
                     LQGEFKFTLLATVLVVVVLTVIIFGGTTAGMLEVLNIKTGCIDENDNSDDEFDIEAPR
                     PSAPVAGFDSMLQPYSDDDSRAHTSIALKAPVTSANILSDFQPPTPSPINPNASRVSL
                     DTQQLRETFGNIFFNADSQWFQNFDEQVLKPVFLDSNLRPLKEDGNQSQTTFDPSSGQ
                     "
     gene            complement(<1071782..>1073623)
                     /locus_tag="HG536_0A05950"
                     /db_xref="GeneID:59323877"
     mRNA            complement(<1071782..>1073623)
                     /locus_tag="HG536_0A05950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281560.1"
                     /db_xref="GeneID:59323877"
     CDS             complement(1071782..1073623)
                     /locus_tag="HG536_0A05950"
                     /inference="similar to AA sequence:RefSeq:NP_013681.1"
                     /note="ancestral locus Anc_5.574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137455.1"
                     /db_xref="GeneID:59323877"
                     /translation="MMLDAPIPLSSRYSYHTIFSDICKTRFNHLATRMCSTFTIFQAI
                     ALALVSGGSGSYLESALLVPLRFLLLYLSSLLVIVTRKNYLHVQYRGYSNLWKLVFGQ
                     LFCVRFVVYEVIHFACSFVVSLAYSGLLGSEGAGSSAVFKQCYMSYVWVLIPTIYTLQ
                     HCLFDLDRLSFSFDTHFQPPQRYISAGWRRIIVKCAIMTLSVTFVSPFFFALAVSRWW
                     IGLVSNLRLALLSFVVFINLEFINVAFNANMSIGCLHKGKPISSLSSTPIETLVTGLS
                     SHKPFTKLTAFQELSYRATSSDSSLRLPIYHTRYRNTHIWPVILRECLVTIQNTNESV
                     TGYLKSLENLKLQDRSNKRTKNFYENDKEKLFGNQVAEEPAAFSSSQLRFPGSPPVTS
                     HEAQNRRITLKDDDVLIRKKFQSNDRRQFPFGIKSPLGAEHAYDEPIITHETTLLKLA
                     GMLLRTVRNYINLFFFPSAISSQQDQPQVSIIEAWCISKRRQAEKLVPQPVCHAECII
                     SLMGLLINAIEEDPKGGVVSSVGEVLKCLERSVGALGRFADWSPESNRKTDDEDEDMP
                     DVVSILYDLSVSAFLEIVLKYNILLDELYLDEDVVKLSKWVLDMCRN"
     gene            <1073864..>1075159
                     /locus_tag="HG536_0A05960"
                     /db_xref="GeneID:59323878"
     mRNA            <1073864..>1075159
                     /locus_tag="HG536_0A05960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281561.1"
                     /db_xref="GeneID:59323878"
     CDS             1073864..1075159
                     /locus_tag="HG536_0A05960"
                     /inference="similar to AA sequence:RefSeq:NP_013680.2"
                     /note="ancestral locus Anc_5.575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137456.1"
                     /db_xref="GeneID:59323878"
                     /translation="MGEKNAFRAKTNDDIQAKLDKKLGPEYISKRVGFGSSRVAYIEG
                     WRAINLANQIFGYNGWSTEVKSVTVDFLDERQGKYSIGCTAIVRVTLQNGTYREDIGY
                     GTVENERRKAAAFERAKKSAVTDALKRSLRGFGNALGNCLYDKDFLARIDKVQFDPPD
                     FDEGNLFRPSDEISEISRSNTLDHQLDGSCKRRRVTRPGPAPGKGSDSNGMHNQQQSL
                     ARPVEQRRAQHPENPPDQAAEAPAEHDELLDDSLMFSDDFQDDDLINMGKQQAEIAVP
                     EQKVAELATEPITFVTAKAASSVQNKRPVTRDNVFDPKYQAQSIKHTVDQTTSMHIPA
                     SLLKEKGIDDSRESAYHKFAPKGKQIGVDTSVSQPSNDNRTSNSTSQPVAAASSRFAP
                     PNTVVHPNSSSAIPQPAKATRREVGRPKINPSMQRKLSP"
     gene            <1075489..>1085232
                     /locus_tag="HG536_0A05970"
                     /db_xref="GeneID:59323879"
     mRNA            <1075489..>1085232
                     /locus_tag="HG536_0A05970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281562.1"
                     /db_xref="GeneID:59323879"
     CDS             1075489..1085232
                     /locus_tag="HG536_0A05970"
                     /inference="similar to AA sequence:RefSeq:NP_010745.3"
                     /note="ancestral locus Anc_5.576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137457.1"
                     /db_xref="GeneID:59323879"
                     /translation="MVRLSRYEKLQKVQNAETYKPLLDDLTQCNEADFLEKLRNIQEW
                     DRSRDDLFVWTPVLNRMDDMMSEIVKKYSYKTSDFKKYPVKLVEMSKEDEATCVDLME
                     FTARLLCNTENRYIYSSMDNMDSLLNCPNFKVKLCAVKVLAIMGERYIIARERIQSDN
                     ILGDSYLKKKALKLALCLPSSTMDDDGDHFSLVDLYFGKKTYPSKWSKLKYTYYTPVT
                     SPGKAANSGTKDVAGLSSPMKKFSLSKDELRSHSLQQLFDKGMEILPAEDWFEYSLRV
                     TISKAFSDDTYESKELRNIILRTKFNAMALVNTIFIPPQVSSKMFELDPYAFNSLTDF
                     ISLSETKVPKELRLDCLFALECVSLKHVWCSDIVRNMGGNMSHGLLSQILRYIGKILR
                     ENSPEVDEEYNVRFFYLISNLADVKTLHESLVSAGLISSLLDIISVKRSNYRRTLASA
                     THLLEAVINDGDSTAEFINNNGFNILINSFTDEVNFALENPDYGSPPKYSLVYYSVSF
                     RQLAYIRSLSKLVLKLLKTDSGDRIRNLIDSPILVSLRKILENRPVFGYTLITYVLDI
                     IQRVINSEPTIYPILVEAGIVPYIINHFSEFMGPYSGLISILPDVISALCLNTDGLKQ
                     VKEKNMISFLFEAVTKPEYARILSWKEEATDLGASVDELARHYPELRSSILDCFVEIV
                     NKLPRQVEFNQPYLYTSANGGELFYQSKDEPVIEYEENAEELAFWDVQKSTPIVDCFA
                     DIFYGMTLENSTLEGFVEKIDFESLLSIIVMERPPFDYTTSQALLNFTDVLQLFDEQQ
                     SEFAFPAIMKVLDEDLQSVRSFLTSNNETSFLLQTKADRDNTDIEELLAKLHRLSTLL
                     YIVTDAYVSITSLSEKRILQIMHYLQKAGFGLIENLGLLFQKCALEEMYLTRQMPDQA
                     ITLTQPSPIGNVPPVQIHVTKPTTREYKDNYTSAKLKNSLEVRAVLNKAQSCTAMLFR
                     CLLRLSHAKNIELESSDRALEVHIFDETTKQIVSMMQAVQLENNIPYFLVLADFNNHI
                     FTFPRTTVAGMGMIQTVPAYLFYQNGGYKVYFEALKVLFDKVSKFTDMSAVEEVDYLK
                     NSEDILTLSCLLNMLNFFNKSMQFDSMENISSVESFYPHMLDDYNLTKALMVLVKILA
                     LGLIFELSESGLIFNRQRRSVPYAACKQVLTLLKNIFSDTNEEDEEFFELRWDLIPPS
                     RRKIQLLKACGMSEDAASVYLLDNDDELPSHEKPAAFNEDQWLKYQSILKNDTWQLHP
                     LPLEPQYEQKSSKDDFDTMRNDSFTGDLVQKVFDVLPNYPKLVNAFARTLLQMLENYD
                     KPCEKFAAKVLDKVLETDLHQCTSLSSLIHLFGIFLNEKYVYENSEDQIHRFLAYLQQ
                     SLNPEHINSPWFSKALYVYEIILAKSEVPAVDPIPPDVNIRYRLPPMTPVYRISPDAK
                     KSIFDALIRAGEISSFYSALATCRILIFYARDEIYAGEIARSGILSRLLKVIGVFQKS
                     EKINYLESSFLLLARRCFETSQVVELLIRYELNRSFTTRIIGDHKEKERDLTGIVEEK
                     PHVVLRNPDTFVDIICERARFQSFNDDGKLTEYNLLRSPNTEETEESESKNHHSPTAS
                     VSDRTGIVHLLLTQLIAASKKDWTSEPASTDGEKFERKNDKVYPARNPVCAYMMFLLK
                     VLVELVSSYKQSKFEFLTFDRRNSYNEFPKPRSTALNFFLYQLLDKSTGVEQNKHEAK
                     RREVISMLARSVIVGFVATVQDDKSKKSDLKSIDPDMTFIRKFTIESIVKALKNATTS
                     TKLLEANVSKLDTWFKIISSMVFVQAPYLRLILDTNKIDADQYQICKLMIEMNVPTAI
                     TDCMALLDLNYPFCKKLMSNAVDPLNSINSVRNSYAELFKVEGNDDEVEVEEDSDKEN
                     PSDMFRNSALGMYDVADIEEDEDDEDSLIGDDEDIAFVDADDDEFEVVFSDENGAEDI
                     NASHSEYETDSDESMDSENEGSSSERAEISHDEDGSDGSSSGADTSYDESDDIELISL
                     EGGDYGEELEIDLADYGIEESDWESGLSELSASDEDGEDIEGGTNDDYGHGVIRRRWM
                     TTDGFDVIEDASDEEEATGTFQGIEHVFHSEAQPLFRVQDGRSHGRHHQRSFRGHGHQ
                     SLGLPSLTLLNGDRRHQSNLVNPLGPSSLEEVENGLSDQLVNVGSGSRYRSQNTHFAG
                     VLFSGEFFDERAPDGIVLKPTVSRWKDIFDMFYDSKSYAAYVVPTIISRLYKPSLEAY
                     REARRREEEEKERTKMKSPAVKPKNQSTSSTEEHNALSVEMEEEHADHEPVYVIIDGA
                     EVDIGGTDIDAEFLNALPEDIRAEVFAQHVRERRAEAMQNEIHSREIDSDFLDAIPEN
                     LREEILGQEAAESRFSTIVRTMHEHENEEMDEEMISGDEGTNGPGTATTDRGNETEKK
                     KSGRVYFSPLVDRVGIAAIMRSIFISQPYVHREIYHELLYRLCSSKQNRSDIINILLI
                     ILTEGVVDQHSLEKVYNLICSRAHGANKAQAGGTTRLLPADCTPLVVANQAIEVLQSL
                     IDADNRLKYFFITEHDNLMVNKAPIKNKRDVFNKNLKWPVKYLFALLDLKIITDESVL
                     MDLLTRILQVCTKPIGAIAKNSDDGNSKRKFPIPFFDDGDFEKLVSIIKLESCNTRVF
                     QQTLNIMQNLSILNGAVGVFTKELISMALETVKTLIPDLEAFTLEGASAATGNEINSE
                     LVQKFTVPSSDQARLLKVLTAVDYIHSQKKTMSEGDVSKLMVVYEKMNLGEVWSSLSK
                     CLFEFERQENLSTSATVLLPLIESLMVVFKHGKAPQNKAVTLKYEDEKKLQIAQLPVD
                     QLFFHFTEAHKKLLNQMIRSNPKLMSGPFALLVKNPKVLDFDNKRYFFIAKLGTETHD
                     RPKLSITVRREQVFLDSYRALFFKSNDDIKKSKLEITFKGESGVDAGGLTREWYQVLS
                     RQMFNPDYALFLPVESDKTTFRPNRTSGINPEHLSFFKFIGMIIGKAIRDQCFLDCHF
                     SREVYKNILGRPVSLKDMESLDLDYYKSLVWILENDITDVIEETFSVETDDYGEHKII
                     ELVENGKNVPVTEANKQDYVKKIVEYKLHASVKEQMDNFLQGFYALIPIELISIFDEQ
                     ELELLVSGLPDIDVDDWKNNTTYVNYTANCKQINYFWRAVRSFDAEERAKLLQFVTGT
                     SKVPLNGFKELTGVTGVCKFSIHRDYGSTDRLPSSHTCFNQLNLPAYSSYETLRGSLL
                     LSINEGHEGFGIA"
     gene            complement(<1085717..>1088149)
                     /locus_tag="HG536_0A05980"
                     /db_xref="GeneID:59323880"
     mRNA            complement(<1085717..>1088149)
                     /locus_tag="HG536_0A05980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281563.1"
                     /db_xref="GeneID:59323880"
     CDS             complement(1085717..1088149)
                     /locus_tag="HG536_0A05980"
                     /inference="similar to AA sequence:RefSeq:NP_010746.1"
                     /note="ancestral locus Anc_5.577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137458.1"
                     /db_xref="GeneID: