GenomeNet

Database: RefSeq
Entry: NC_050728
LinkDB: NC_050728
Original site: NC_050728 
LOCUS       NC_050728            1315948 bp    DNA     linear   CON 09-NOV-2020
DEFINITION  Torulaspora globosa chromosome 2, complete sequence.
ACCESSION   NC_050728
VERSION     NC_050728.1
DBLINK      BioProject: PRJNA670758
            BioSample: SAMN14605265
            Assembly: GCF_014133895.1
KEYWORDS    RefSeq.
SOURCE      Torulaspora globosa
  ORGANISM  Torulaspora globosa
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1  (bases 1 to 1315948)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 1315948)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1315948)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP059247.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1315948
                     /organism="Torulaspora globosa"
                     /mol_type="genomic DNA"
                     /strain="CBS764"
                     /isolation_source="soil, St Thomas, West Indies (strain
                     received from Westerdijk Fungal Biodiversity Institute)"
                     /type_material="type material of Debaryomyces globosus"
                     /db_xref="taxon:48254"
                     /chromosome="2"
                     /country="USA: Saint Thomas, West Indies"
     gene            <982..>1512
                     /locus_tag="HG536_0B00100"
                     /db_xref="GeneID:59324271"
     mRNA            <982..>1512
                     /locus_tag="HG536_0B00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281932.1"
                     /db_xref="GeneID:59324271"
     CDS             982..1512
                     /locus_tag="HG536_0B00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137827.1"
                     /db_xref="GeneID:59324271"
                     /translation="MQVIATLPRTFLVTSYHAGHCHITPDIPHDVLSCTTMATYPEHS
                     SRRHIMQKFGMLPPDFPYHAGSCRTLPYRSLSAVIALGVFALRRYRNPPRISLPTEYC
                     PCYPRFGSYAKILTRFGHRPVLHDHNTKGLAQSAFCIQHCLGKVFNHTGMSTSSYHTL
                     ITPQKILSTVARRFLV"
     gene            complement(<5976..>6428)
                     /locus_tag="HG536_0B00110"
                     /db_xref="GeneID:59324272"
     mRNA            complement(<5976..>6428)
                     /locus_tag="HG536_0B00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281933.1"
                     /db_xref="GeneID:59324272"
     CDS             complement(5976..6428)
                     /locus_tag="HG536_0B00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137828.1"
                     /db_xref="GeneID:59324272"
                     /translation="MRRWMNVPDSFAEYPLLAIYVAKFRLRKYPFDVLRNDINWPEPY
                     VVLNTIMKRLRSHRFLKGNADAATIPEDIRKVIALGDVIPNGMEDEVLEMPYSASKVS
                     ANNNRVMKVLRGQNTRNDVAKFFDEILSSEHLELYQDPAIIQLVSAYP"
     gene            <9349..>10125
                     /locus_tag="HG536_0B00120"
                     /db_xref="GeneID:59324273"
     mRNA            <9349..>10125
                     /locus_tag="HG536_0B00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281934.1"
                     /db_xref="GeneID:59324273"
     CDS             9349..10125
                     /locus_tag="HG536_0B00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137829.1"
                     /db_xref="GeneID:59324273"
                     /translation="MKVLIVLAHPEKASLTSSLAMLAKETFESQGDEVKVSDLYGLGW
                     KSNVDKEDFPGNNSDRLFVCDASKKATRSNSLTEDVVEEQKKLLWCDTLFLVFPLWWF
                     SMPAILKGWVERVFSYGVGYGVGVHDSTHWGDRYGEGTFAGKKAMVITLAGGWESHYS
                     ARGINGPIEDLLFPINHGILYYSGFDVLPPLVAYRSDSVDDSSFKKLSLKLKERIISL
                     QETKPIAYKRQNYGDYTIPALELKGDIGCGCGGFSLHIKN"
     gene            complement(<11560..>12702)
                     /locus_tag="HG536_0B00130"
                     /db_xref="GeneID:59324274"
     mRNA            complement(<11560..>12702)
                     /locus_tag="HG536_0B00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281935.1"
                     /db_xref="GeneID:59324274"
     CDS             complement(11560..12702)
                     /locus_tag="HG536_0B00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137830.1"
                     /db_xref="GeneID:59324274"
                     /translation="MSDLFAPAPEPPTELGRLNLLSKTAGIKVSPLVLGAMSIGQAWS
                     EALGSMDKESSFKLLDAYYEAGGNFIDTANNYQNEESEAWLGEWMESRKVRDQLVIAT
                     KFTTDYKSYEVGKGRSANFCGNNRRSLHVSVRDSLKKLKTDWIDILYVHWWDHMTSIE
                     ELMDSLHVLVQQGKVLYLGASDTPAWVVSAANYYAVSHGKTPFSVYQGRWNVMLRDFE
                     REILPMARHFGMALVPWDVLGGGRFQTKESIEKRKDRGEKLRSFVQPPEQTEQEVKIS
                     SALENVAKEHGTHSITAIALAYVRSKGTNVFPLVGGRKVEHLKDNIAALSIKLTSEQV
                     SYLESVVPFDIGFPNNFVGEDPAISGKLPFASAASYKLNFDSLQFK"
     gene            complement(<13585..>14616)
                     /locus_tag="HG536_0B00140"
                     /db_xref="GeneID:59324275"
     mRNA            complement(<13585..>14616)
                     /locus_tag="HG536_0B00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281936.1"
                     /db_xref="GeneID:59324275"
     CDS             complement(13585..14616)
                     /locus_tag="HG536_0B00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137831.1"
                     /db_xref="GeneID:59324275"
                     /translation="MTVLVSGATGFIAQYIVNDLLKQNYKVIGTVRSQEKADKLKKHF
                     GNNPNLALELVADIAAPNAFDSVFKKYGADIKVVLHTASPVSINTKEYEKDLLIPAVN
                     GTKNILEAIKKYAAKSVERVVVTSSCAAVVDTSNQGDGSVVYTEESWNPATWESCQVN
                     GISAYCGSKKLAEAAAWDFVRENRNVVKFQLSTVNPIYVFGPQLFDEEVKDRLSSSCE
                     LINALVRGKPEAQYLQGMRGNYIDVRDVSRAHLAAFQKEQAIGKRLILSNGPFTYQDL
                     EDIVNEDFPQLKGKILVGNPGSGKDIHKTMPTIDNSKTREILGYPFKSLKETVDDTAA
                     QILKKDGKL"
     gene            complement(<21572..>22507)
                     /locus_tag="HG536_0B00160"
                     /db_xref="GeneID:59324276"
     mRNA            complement(<21572..>22507)
                     /locus_tag="HG536_0B00160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281937.1"
                     /db_xref="GeneID:59324276"
     CDS             complement(21572..22507)
                     /locus_tag="HG536_0B00160"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137832.1"
                     /db_xref="GeneID:59324276"
                     /translation="MKTLFDSGSPTSFIRSDMVKLLNLRTYETPPFRFRGFIPTDAST
                     TTEAVSLTVPVEDLQIPVVAYILENMDYQLLIANPILRRYPKLLSIILESTPNLKACE
                     NRVKVSYLEPESTGNCGNSRRPEMSLATTTLEAIDRKSIGHRGKAKCASPVTTTSETA
                     SALDNPGYPGDPELIVQELEQIRLPEEAAFLEEMGEKSLVASVRGLAPVVVREQRLKD
                     TVDVLPPWLQQKYGKIRNDLPPRFSSSDEAPVKHDIEIKKNARLPRLQPYQTTQKTEQ
                     EINKLVPSKSPCTSLLPSLSTKKMDHFDSVLITES"
     gene            23937..24008
                     /locus_tag="HG536_0Btrna2E"
                     /db_xref="GeneID:59324966"
     tRNA            23937..24008
                     /locus_tag="HG536_0Btrna2E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAG"
                     /db_xref="GeneID:59324966"
     gene            complement(<25104..>25700)
                     /locus_tag="HG536_0B00180"
                     /db_xref="GeneID:59324277"
     mRNA            complement(<25104..>25700)
                     /locus_tag="HG536_0B00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281938.1"
                     /db_xref="GeneID:59324277"
     CDS             complement(25104..25700)
                     /locus_tag="HG536_0B00180"
                     /inference="similar to AA sequence:RefSeq:NP_009869.3"
                     /note="HMLalpha1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137833.1"
                     /db_xref="GeneID:59324277"
                     /translation="MHEKSFRGFKANRPLFKVQIKRKPGQCRPAKARCMEGSCSHTSG
                     YTKEKSTKTFMAKLGPIKIPSPPNTLLRKIEEEKLKLQSESSAEKGSLWDSPISWDSE
                     EILFSIANDVLDNIYKKPARKGASTKPLNSFMAFRAYNSQFGYGLKQNILSPLLASAW
                     HSHPEQQEIWDTFAQQFNFVKPKCGFVEWVDQRYERES"
     gene            <27742..>28455
                     /locus_tag="HG536_0B00200"
                     /db_xref="GeneID:59324278"
     mRNA            <27742..>28455
                     /locus_tag="HG536_0B00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281939.1"
                     /db_xref="GeneID:59324278"
     CDS             27742..28455
                     /locus_tag="HG536_0B00200"
                     /note="DIC1 gene in HML X region"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137834.1"
                     /db_xref="GeneID:59324278"
                     /translation="MSGKVAMTDTPIKYPWWYGGAGGIFACIVTHPLDLAKVRLQTAS
                     PPKPTLLNMIRRILQQEGPRGLYAGLSASVLRQCTYTTARFGCYDIIKENLIPQSEIN
                     NSLYLLPCSMLSGAIGGFVGNPADVVNIRMQNDSAHDPHLRRGYRNAFDGLNSIVREE
                     GFYKLFTGLAPNLIRGVLMTASQVVSYDVFKHRWDLLCLERYVFNTTFCALCSTSFIT
                     RFLSILLYFSLFLAMFQLY"
     gene            <32909..>34168
                     /locus_tag="HG536_0B00210"
                     /db_xref="GeneID:59324279"
     mRNA            <32909..>34168
                     /locus_tag="HG536_0B00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281940.1"
                     /db_xref="GeneID:59324279"
     CDS             32909..34168
                     /locus_tag="HG536_0B00210"
                     /inference="similar to AA sequence:RefSeq:NP_009870.1"
                     /note="ancestral locus Anc_1.4"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137835.1"
                     /db_xref="GeneID:59324279"
                     /translation="MTQLEDISERLLTRSQEAILQLEIWIRRQQHLRELEDDSIDRLG
                     DQYNIYIAQLNSLCIRSEYVRDKLNKERERRLSLINDRKYIENLVLEFQDITIKLNEL
                     AHCRSSHSTPCSKSTRSSLDSFQPRPLKLTERHGSKIRETRESPLKRKPFMQNVEFAD
                     IPESSNSKCLSLPGSPVKGTTTEKSIRMAKSYDTGLRPKKKKASNGDGDNEIRSFFKE
                     NQRLSISFFGEYDDDVDSTSDQDTVISVSPACPPKGVPLRRYNSHESIFSTKIEPINF
                     EKGHSSFLLPASTRPSMTSARVSSAAVFSRTTGPGSSKDLLSTFIAGHSEARVISGKR
                     QETKSSSFFSRWNLFGSSSIPNQAKVNDNASAEVQRNFSSSSSLAAISSINISPPRSK
                     IPVFDSLISYDDLRDALDTELILAAEL"
     gene            complement(<34250..>37015)
                     /locus_tag="HG536_0B00220"
                     /db_xref="GeneID:59324280"
     mRNA            complement(<34250..>37015)
                     /locus_tag="HG536_0B00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281941.1"
                     /db_xref="GeneID:59324280"
     CDS             complement(34250..37015)
                     /locus_tag="HG536_0B00220"
                     /inference="similar to AA sequence:RefSeq:NP_009871.2"
                     /note="ancestral locus Anc_1.5"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137836.1"
                     /db_xref="GeneID:59324280"
                     /translation="MDQLLQDLDAAKTRRKTTYKKVLRHDDEPPEASLSAVLGDGFLF
                     QSDVLNRVKKRLDNESCETVHFSETSMLSNLYGDAEEVETETLTAKEWNQKVIQPKPK
                     TNEKPVLHAINDGLIGKQEGLKSPPTADEAFRRRRSMTISDAGSNADGMTQPILECSA
                     EARTQLISPMKEPKQASEGTAKIVSQTKSSEVPQILTPCDDDAVSCNDLQSTAADFDD
                     PTKLKIHEIQEQLKNENEPTYTKFEAQKATSQKNVVFSREAFMKDFDNSSDSDSEVPY
                     QQTVAIHNTQNSDELEQRSRTVHKSGSLNAYERELKQQLEQHHGIALSSESESSEDDR
                     VSPSFASKATVLEIRARISKRKVRTKARGGGASLTALISNLRKASKEQIIQCQKEMVE
                     RHGMKLQDIEKEKEMVENLLEQEIARNKRIRMREREKDNRSVRTSSPQKADKEGFTLM
                     HSNKSQEVESDRFSLSGSNSDDSNFESDQDETSLQAQKTPAENADPIYESDDENISRS
                     KVRAHKTLILSENDLSDENDDSIKEGIDLGSYGGNLSTKSVSEESHYSGDEDTQPVTE
                     ELEREHRNFIKEEMKRRALKESQEINEMRKSGVSNMFDMEAEESDDEWHGLGGAEGES
                     IDNYDSDLEKMIDDFSHTTSNANQIRQLLIAENKETDLKTVNKILNDLKNGGFRKRRN
                     NDLQLELSDYEDDELRNYRRKRLETMRKKRLQFGQSNSELLKNTKSKAFFDSMLEDLM
                     ENGPFENQAQKVEAQDDKHDTKETVAISREFVLERLSFLNGSRDSGEFDVTQPAGEDG
                     LGTDLLNLKRSSSVKSLDNPHSAKTEEEDYSYTLPAEGRYISVVKSFGDRSDLENKLK
                     NGKKTVTVSKSYRTVGGSKTSITYLAKMRKLVAPKANRPLKPKLDELASLGKRKIFGS
                     FDSSFET"
     gene            complement(<37213..>38247)
                     /locus_tag="HG536_0B00230"
                     /db_xref="GeneID:59324281"
     mRNA            complement(<37213..>38247)
                     /locus_tag="HG536_0B00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281942.1"
                     /db_xref="GeneID:59324281"
     CDS             complement(37213..38247)
                     /locus_tag="HG536_0B00230"
                     /inference="similar to AA sequence:RefSeq:NP_009872.1"
                     /note="ancestral locus Anc_1.6"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137837.1"
                     /db_xref="GeneID:59324281"
                     /translation="MVSTHNRDKPWDTEDIDKWQVDEFKPEDNASGLPFAEESSFMTL
                     FPKYREAYLKSIWKNVTKALDAHHIACVLDLMEGSMTVKTTRKTFDPAIILKARDLIK
                     LLARSVPFPQAVKILEEDVACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLT
                     KCYILVQGNTVSAMGPYKGLKEVRRVVEDTMRNIHPIYHIKELMIKRELSKRPELAEE
                     DWSRFLPTFKKRNVARKKPKVRKEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEI
                     NKLKERREKQTEKQQEKEEARSKDYIAPKEDIYASSLDNEKRKRKSAEREKSKGDRLE
                     AKNNKRVKKE"
     gene            <38477..>38809
                     /locus_tag="HG536_0B00240"
                     /db_xref="GeneID:59324282"
     mRNA            <38477..>38809
                     /locus_tag="HG536_0B00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281943.1"
                     /db_xref="GeneID:59324282"
     CDS             38477..38809
                     /locus_tag="HG536_0B00240"
                     /inference="similar to AA sequence:RefSeq:NP_001018031.2"
                     /note="ancestral locus Anc_1.7"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137838.1"
                     /db_xref="GeneID:59324282"
                     /translation="MTIKNKAKKVSKLPPKQKGRKIPLLRKDTKKTKLKVENLNKEGS
                     DIAEIVRLSAVGVIRRATCSLNTLENKSLQSDWKKDKRIQEKANAKKQEIADKLEKQI
                     ESISSFSL"
     gene            complement(<38966..>39220)
                     /locus_tag="HG536_0B00250"
                     /db_xref="GeneID:59324283"
     mRNA            complement(<38966..>39220)
                     /locus_tag="HG536_0B00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281944.1"
                     /db_xref="GeneID:59324283"
     CDS             complement(38966..39220)
                     /locus_tag="HG536_0B00250"
                     /inference="similar to AA sequence:RefSeq:NP_065435.1"
                     /note="ancestral locus Anc_1.8"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137839.1"
                     /db_xref="GeneID:59324283"
                     /translation="MSEKPELQVTTPNKSILNDKWDVVLSNMLVKTGLGFGVGVVGSV
                     LFFKRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVKA"
     gene            complement(<39780..>40349)
                     /locus_tag="HG536_0B00260"
                     /db_xref="GeneID:59324284"
     mRNA            complement(<39780..>40349)
                     /locus_tag="HG536_0B00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281945.1"
                     /db_xref="GeneID:59324284"
     CDS             complement(39780..40349)
                     /locus_tag="HG536_0B00260"
                     /inference="similar to AA sequence:RefSeq:NP_009875.1"
                     /note="ancestral locus Anc_1.10"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137840.1"
                     /db_xref="GeneID:59324284"
                     /translation="MTSKEYNSSSYKRDNISTGDSRLPWFEDSLITGLESVCSFFDNV
                     YFAKSLGIITEQNVLYRHLNKGDWGSKLWFVTLVLSIRRCLRQLFRILQDRVKLKKEL
                     KSMGKSETGLVKDVLKEKLSTMLQKSSLMIKAIMFEVLQNTLYLIIVAVDVFKIRLPR
                     RWRRVLEPISNFVTVLRLVAFGTSSSLDI"
     gene            <41019..>41945
                     /locus_tag="HG536_0B00270"
                     /db_xref="GeneID:59324285"
     mRNA            <41019..>41945
                     /locus_tag="HG536_0B00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281946.1"
                     /db_xref="GeneID:59324285"
     CDS             41019..41945
                     /locus_tag="HG536_0B00270"
                     /note="ancestral locus Anc_1.11"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137841.1"
                     /db_xref="GeneID:59324285"
                     /translation="MPVSSKRRYSEREATESGIALKRRSFILSNHAATPRNGSSFSCF
                     SSTSEDGEYEKADHLFSFPGAGGVLNPKLVEAVSKYSDSDTTMKSDKDYNYQTGDACL
                     RRKSLSRPGSFSCSSRKSQAPRSDLVARERCFDYIVQSIDEVWARYCDTTSSAEAVVY
                     NNFGAKAQAGVKIPLSRPHKSLNISETESDNCTFGGTEEADSEDEDESSGYKSEATNP
                     TEYETDHGENRTVSNLPDSVKLQSLKHRLTKAKNDLELVYDSKHLESSASFWRRWDMI
                     KYSAVEMMEDDDDDDVIENAIEELEQGRCYTC"
     gene            <42452..>43381
                     /locus_tag="HG536_0B00280"
                     /db_xref="GeneID:59324286"
     mRNA            <42452..>43381
                     /locus_tag="HG536_0B00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281947.1"
                     /db_xref="GeneID:59324286"
     CDS             42452..43381
                     /locus_tag="HG536_0B00280"
                     /inference="similar to AA sequence:RefSeq:NP_009876.1"
                     /note="ancestral locus Anc_1.12"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137842.1"
                     /db_xref="GeneID:59324286"
                     /translation="MSNKDRKEKHVSFKPAKESHKNDYSNHYIHVGSLPQSHVSNVAN
                     PIEGYPKLEKLFQMKSEQIAQYTTTPFGCKVDIDQMVPTINYWIQNEKLIFDVVMIGC
                     LTDNQFIYPLLTQLAIDKLVSKPGFLFIWASAQKINELNRLVNSEGWAKQFRRSEELV
                     FVPIDKNSPFFPGLEQDDHSLIEKMQWHCWMCITGTVRRSTDGHLIHCNIDTDLSIEE
                     KGARDGAVPSHLYRVAENFSTSTRRLHIIPARTGTENPVRLRPGWVIMSPDIMLDNFV
                     PARYKSEIDKLGYNIPLKNEIQQLRPKSPTQKV"
     gene            <45502..>47994
                     /locus_tag="HG536_0B00290"
                     /db_xref="GeneID:59324287"
     mRNA            <45502..>47994
                     /locus_tag="HG536_0B00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281948.1"
                     /db_xref="GeneID:59324287"
     CDS             45502..47994
                     /locus_tag="HG536_0B00290"
                     /inference="similar to AA sequence:RefSeq:NP_009877.1"
                     /note="ancestral locus Anc_1.13"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137843.1"
                     /db_xref="GeneID:59324287"
                     /translation="MGKTQKKNSKGRLDRYYYLAKEKGYRARSSFKVIQINEKYGHFL
                     EKSKVVIDLCAAPGSWCQVAAKLCPVNSLIIGVDIVPMKPIPNVITFQSDITTEDCRS
                     KLRGYMKTWKADTVLHDGAPNVGLGWVQDAFTQSQLTLQALKLAVENLVVNGTFVTKV
                     FRSKDYNKLIWVFQQLFDKVEATKPPASRNVSAEIFVVCRGFKAPKRLDPRLLDPKEV
                     FEELPGGPQNMEAKVYNPEKKERKRGGYEEGDYLLYHEAPIMDFVKTEDPITMLGTIN
                     KFTIDENDQEWKIISKLKQTTNELYECVKDLKVLGKKDFKMLLRWRKAAAEILGYGKE
                     EEKPSIEEVPLTEEEQIDKELQQLQEKQRLNQKREKRKKNEMKQKELLRMNMNMLTPQ
                     DIGIEAAEIGRDSVFNLKTAEKTGMLDKLAKGKKRIIFKDSDQARDNDIHIEDGARFT
                     DKDDGALADDLESQLDSMYESYKMSKAERDAKFRAKQARGGDQEDEWTGFENPEDEKE
                     EKEDSEIIEEESELSDSDDDEAINNLISKLKGKTGDSKLSTKARMLFNDPIFENVTPD
                     LPSSQRSTATADQEEAQETLASITQKRSHEEVESDSETDDDSDFEIVANSGPEDETLS
                     DYDSDEEAKQTKKQKHAKDVDIATVEAMTLAHQLALGQKTKHELTDEGFNRYSFRDSE
                     NLPAWFVDEEKEHSKINRPITKEAAIAIKQKMKALNARPIKKVAEAKARKKMRSLARL
                     EKIKKKAGLIVEDGDKSEKDKADEIAKLMRKVSKKQKTKPKVTLVYATGKNRALSGRP
                     KGIKGKYKMVDGVLKNEQRALRRIAKKHHKKK"
     gene            complement(<48066..>49313)
                     /locus_tag="HG536_0B00300"
                     /db_xref="GeneID:59324288"
     mRNA            complement(<48066..>49313)
                     /locus_tag="HG536_0B00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281949.1"
                     /db_xref="GeneID:59324288"
     CDS             complement(48066..49313)
                     /locus_tag="HG536_0B00300"
                     /inference="similar to AA sequence:RefSeq:NP_009878.1"
                     /note="ancestral locus Anc_1.14"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137844.1"
                     /db_xref="GeneID:59324288"
                     /translation="MGVKSRFTVVFQEAEDVGERLEISDDELTVKGGPDVVVQQRWII
                     DSAEQGIEGLRRVTWSNGAVERSSLSRVISAALSPGFNVYSTEASFLSQSLETPFYRS
                     YHSTIPKVREYVPVELGKILSQLDAEKCDIDIRLMGNRTEIAQWCLLRDNENITFRKE
                     ADIDACEAGLFYLDTRDSIDVNLSGLRCKWGPDGVMNKCQKTTLFYKTAHISPTTLER
                     PTIELETPVGLHPKILIDLSSTPKSQKCEYFLHLKLPTDLFVDRFQSSPLFLYGAQDL
                     ELPEYKLRGETWGSESLFELDAERLNEITLHSRYVEPMAGNQSKTVRFTPLLFRACDS
                     DEKILMENPFYSRGLGYESFFTPNTIFEAFPSSVLEVTIPRPDTVHYETTKLVTLTCL
                     LVSLVYILLKIAMKPRSGRYTAK"
     gene            <49780..>51306
                     /locus_tag="HG536_0B00310"
                     /db_xref="GeneID:59324289"
     mRNA            <49780..>51306
                     /locus_tag="HG536_0B00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281950.1"
                     /db_xref="GeneID:59324289"
     CDS             49780..51306
                     /locus_tag="HG536_0B00310"
                     /inference="similar to AA sequence:RefSeq:NP_009879.2"
                     /note="ancestral locus Anc_1.15"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137845.1"
                     /db_xref="GeneID:59324289"
                     /translation="MTDAQHMQVTGYLTADTTMTPLRGRHRHKRSFAISGDFDFVKQP
                     AALPSLPNNKLDPSDVQIDRTGGSREPPEIVVEQKIVPPEAAAASSPSPRLENPNATS
                     PRFFISEEPRFSSPFRGVPDAIINLDDALKTKPKCFKSHKRSESAPADLAVLLNAKTV
                     SHSSQMIEEEDDDGDETEEDHNSQINFGVPDVAEGGNKSTLLSPLRPMSPSPAAHLQE
                     LTLDGSPVRWNRDSRADNYNSLKINRQKQRYYQYTKKLPIANAGIQPQTLREKESSTS
                     LSSACLKTPLSSFQTPSRQASTPSTPLSAGFSNNNDQFENNSGLTSPFRSRQMHSSMR
                     NAANSSFGYEPKVYEMPHGRANSDSVSSRDDKTLYKNEMSLTDGCDVTDDDNNGSEND
                     GEKANMLSISKELLFGQPGDTVDLSSISSSVKETFTNYKSSSNEVLSPVRLDTNDDSE
                     PLSSANDTPESRSVSDTLLVVQKTRKEKRKVKSKLNVLFMNIFRYTNNYERGANEKKA
                     "
     gene            complement(<51594..>51977)
                     /locus_tag="HG536_0B00320"
                     /db_xref="GeneID:59324290"
     mRNA            complement(<51594..>51977)
                     /locus_tag="HG536_0B00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281951.1"
                     /db_xref="GeneID:59324290"
     CDS             complement(51594..51977)
                     /locus_tag="HG536_0B00320"
                     /inference="similar to AA sequence:RefSeq:NP_010818.1"
                     /note="ancestral locus Anc_1.16"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137846.1"
                     /db_xref="GeneID:59324290"
                     /translation="MPQSLTSVVKMGDFILKHAALSKIAVPVAKQFVNLAGYRQLGLR
                     FDDLIAEENAVAQTALRRLPEDESYARVFRIIRAHQTELTHHLLPENEWTKPSEDVPY
                     LTPYILEAEAAAKEKEELDNLEISK"
     gene            complement(<52282..>53238)
                     /locus_tag="HG536_0B00330"
                     /db_xref="GeneID:59324291"
     mRNA            complement(<52282..>53238)
                     /locus_tag="HG536_0B00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281952.1"
                     /db_xref="GeneID:59324291"
     CDS             complement(52282..53238)
                     /locus_tag="HG536_0B00330"
                     /inference="similar to AA sequence:RefSeq:NP_009880.2"
                     /note="ancestral locus Anc_1.17"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137847.1"
                     /db_xref="GeneID:59324291"
                     /translation="MLPENVADLISKKYEEAVNNGHLCFTESTTKKLKDANSGMNYVV
                     SYAPSLASKPERGDQPDKNPFAEPEPELTVVENVADGEYKLLLNKFPIVPEHTLLVTN
                     TFKDQKSPLSPLDLMTAYNLLLKLDDEDENKRHMMIYNSGPSSGSSQDHKHLQTLRLP
                     QNFVTLQDRICAGKSHFLPDFKTEPLQDDKVSFAHFVLPLPESEEDVNEDLLAMCYVS
                     LVQRAFTFFQDWAGEKPELANSRGYNVLMTKNWICVVPRSSTRAKSLQIGFNATGYAG
                     LILVKTQEAYDQILQLPHKIDEALLECGFPNSAGKKQTEYNY"
     gene            <53702..>54781
                     /locus_tag="HG536_0B00340"
                     /db_xref="GeneID:59324292"
     mRNA            <53702..>54781
                     /locus_tag="HG536_0B00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281953.1"
                     /db_xref="GeneID:59324292"
     CDS             53702..54781
                     /locus_tag="HG536_0B00340"
                     /inference="similar to AA sequence:RefSeq:NP_010820.3"
                     /note="ancestral locus Anc_1.18"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137848.1"
                     /db_xref="GeneID:59324292"
                     /translation="MRGSIAQEIQYPCQYDDGIFNIAIDIGGSLAKVVFSPIGTNRIL
                     FHTVETERIDKFVRLLHSIVESHHAGDYSTTQITATGGGAYKFYELLNKEFPNVIQIK
                     RLDEMECLIKGVDAFIHEIPDEVFTYNDQDGAQNVLLPNGSAHSPKTYPYLLVNIGSG
                     VSILKVENAETFSRVGGSSLGGGTLWGLLSLITGAQTYDQMLDWAHDGDNTNVDMLVG
                     DIYGTDYNKIGLKSSNIASSFGKVFQNRRGSLSKSSAAASNSASPTTSHADIASRNKK
                     FKNPDVCKSLLYAISNNIGQIAYLQAKIHNVQNIYFGGSYIRGHLMTMNTLSFAINFW
                     SQGRKQAFFLKHEGYLGAMGALLSA"
     gene            complement(<54808..>55941)
                     /locus_tag="HG536_0B00350"
                     /db_xref="GeneID:59324293"
     mRNA            complement(<54808..>55941)
                     /locus_tag="HG536_0B00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281954.1"
                     /db_xref="GeneID:59324293"
     CDS             complement(54808..55941)
                     /locus_tag="HG536_0B00350"
                     /inference="similar to AA sequence:RefSeq:NP_010821.3"
                     /note="ancestral locus Anc_1.19"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137849.1"
                     /db_xref="GeneID:59324293"
                     /translation="MSRCLESWRCVSSMSSDGLRDFRTEVEVLEDVTTRGSEQTLRDQ
                     EERLISAIREITQSITSMSHENNLVRLDGVDGNAGAITIDLSSLAERIAEFDKLIELL
                     KMTHLEQETLDFFLRYTISSAELLQLKSTHDQQYVEMESAVKALEREIEEAHHRWIDE
                     TKLQISNAAEQIVKDQDTVNELYLETADILDDCDQLLVEVEKMREEKERYKKQVERQK
                     PSVAKVFDEWDEVRRCQNDLKHLEAQIAQLELIKKDFEAKDTAKKLTQDPKLNELGCT
                     LDSLIRLWESNFLPNPGWHDLEIYPQIKKIQFDVLEIFTVLIALDGGYRISDVTIYRK
                     GEGGMSVDEDLQSELKQQNVGSRDVYKSMEAITGYLIGLAPVK"
     gene            complement(<56722..>57936)
                     /locus_tag="HG536_0B00360"
                     /db_xref="GeneID:59324294"
     mRNA            complement(<56722..>57936)
                     /locus_tag="HG536_0B00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281955.1"
                     /db_xref="GeneID:59324294"
     CDS             complement(56722..57936)
                     /locus_tag="HG536_0B00360"
                     /inference="similar to AA sequence:RefSeq:NP_010816.4"
                     /note="ancestral locus Anc_1.20"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137850.1"
                     /db_xref="GeneID:59324294"
                     /translation="MDLLGDVVERDTGSGSSDDECAEFAPRNSSGFPELYKPKEVSSW
                     KQRLKAKKACRPESKRSEAQSIHEENIKSLQNMSQEEIARERKELLESLDPKLVKRLL
                     SNINRRAAKSGGGPLFAEIEGASGTWVGETDRLTELPALDDEQVAKALGISPRDDESL
                     EQDIPDDEDVAPLDFQIAQSIDHMANEELLKDVHFVTRRNSEADQKIALNDPDFDQKL
                     HEKFFPDLPRDVDKLQWMQPVPDAQPCTVIDDVSQCRFDFDGNLVPPTREITSTTHSA
                     LHHHADDPHLAGYTIPELQRLSRSTYPAQRAIAVQTLGRILYKLGRQAYYQLVPEVDL
                     ETYQQDGGTQKVTEKIYGLFWDLCYEFRIIECLQDASDEKKTKHLSTRNYALDALWLW
                     KRGGGDFRKNEK"
     gene            complement(<58082..>58429)
                     /locus_tag="HG536_0B00370"
                     /db_xref="GeneID:59324295"
     mRNA            complement(<58082..>58429)
                     /locus_tag="HG536_0B00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281956.1"
                     /db_xref="GeneID:59324295"
     CDS             complement(58082..58429)
                     /locus_tag="HG536_0B00370"
                     /inference="similar to AA sequence:RefSeq:NP_010814.1"
                     /note="ancestral locus Anc_1.21"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137851.1"
                     /db_xref="GeneID:59324295"
                     /translation="MRSKPCSGGDMQERYKKQEKAAPQSWMLAVSNNRVFYKMHARDW
                     FLVLVAIFIPPVAVWLKRGFFTKDLLINVLLWVLGFIPGLIHALYIVSQHPFEGPDEE
                     TLTHSVNNYGSTV"
     gene            complement(<58468..>59196)
                     /locus_tag="HG536_0B00380"
                     /db_xref="GeneID:59324296"
     mRNA            complement(<58468..>59196)
                     /locus_tag="HG536_0B00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281957.1"
                     /db_xref="GeneID:59324296"
     CDS             complement(58468..59196)
                     /locus_tag="HG536_0B00380"
                     /inference="similar to AA sequence:RefSeq:NP_012296.1"
                     /note="similar to Saccharomyces cerevisiae DCG1 (YIR030C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137852.1"
                     /db_xref="GeneID:59324296"
                     /translation="MVLQLLVVNPNSSRSMTEAVARSVAACDAFRGFAFQVRYMTGPS
                     GAPPQIDGPEASSASCDACLAVLSDPRSEFHYARFEGLLVACFSDHPLVAALAALPQA
                     PVVLGLLDASVSFASLAARGPFSIITSNVEWVKILDDSVEQQFLAGHVRRLGLWRGTV
                     SSNLQVLELHDEANFGAIVDVIRAENVDRLGSRYVILGCAGFSGLERRLNKLFEDRGV
                     VFLDPIVIGFQALLGSASLLQAMR"
     gene            <59670..>59864
                     /locus_tag="HG536_0B00390"
                     /db_xref="GeneID:59324297"
     mRNA            <59670..>59864
                     /locus_tag="HG536_0B00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281958.1"
                     /db_xref="GeneID:59324297"
     CDS             59670..59864
                     /locus_tag="HG536_0B00390"
                     /inference="similar to AA sequence:RefSeq:NP_001032573.1"
                     /note="ancestral locus Anc_1.22"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137853.1"
                     /db_xref="GeneID:59324297"
                     /translation="MQFKTIVAAFATVAAVQAAKDNSSNGSNHSNKTSSSLTTGAANS
                     NVLNAGVFGAAVAAGVAFLF"
     gene            <60079..>62517
                     /locus_tag="HG536_0B00400"
                     /db_xref="GeneID:59324298"
     mRNA            <60079..>62517
                     /locus_tag="HG536_0B00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281959.1"
                     /db_xref="GeneID:59324298"
     CDS             60079..62517
                     /locus_tag="HG536_0B00400"
                     /inference="similar to AA sequence:RefSeq:NP_010812.3"
                     /note="ancestral locus Anc_1.23"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137854.1"
                     /db_xref="GeneID:59324298"
                     /translation="MHKRAVWAGQSRLGTRMGQLVSSSSVVVEVTVGECGDRPFFVEY
                     NGSYVPAVRPGVVYAVRLNRDGGEVVCMLQKDDSSVEIPLQRTGAPDRYGFRLDTPCA
                     SGFYRLKCLDVDAVVFVSGAEGSRAAEHISGSHRLRHGSAWLPDGAEFRKLIGGLEDS
                     VASLQKSARWRILLDNLVRLNDLLRAVSSVCDGLLSIRVSFAGDEDHPLKRLFNEDLH
                     AWIRAFNANHVLNVSQSLSKDVITPLQEFLEFEKQNQKILPKKQKNFHEAMRLMYSTQ
                     SSLPLSSKVQYELARLEYQNFLDQCFVVGPPLRRLYSGVSLFLRKRVPEKELNESYMK
                     KNHQLRLSIKNARSLSDLTKLYSSLNTPHVETYAWVEFQEGDSTSAPGSTGSSSGSQW
                     RQWIILDGNQLSVFHHSKKIPLHTVDLSFACIKKINRTTVEIQTSGLPFSVPASASSS
                     SSVEHTSSNSKNHRSKVYLLFKDHSEAEQWFDMLKQVNLETKQYSSSAVEASSKHKDH
                     TATTASLIDVVMSQHESNSRCCDCGDSQTVEWISINLLCVLCIKCSGVHRSMGSHVSK
                     VRSLTLDSFTSPEILHLLRNDVSNANVNSIYESSDPEEAKLTPQSSDSERSRYIINKY
                     QACKMVSDGNQDAKTSLKSLIKAIHLDSIYLLQKTIAQSKYSLRDIVTEQSRSDCDVV
                     LPTIFQYSLKHHEMVHGKPVFFITEFLLYNGLPVDRIPNNTSNWSPAVIEYWKSKFDM
                     YGVFSPNTHTSKPPEGRESTLAPLSIPADKQPGRRWSLNHMPSSPQIKSPTNILNMHK
                     SLKLSKRGNGTRKS"
     gene            <62945..>64342
                     /locus_tag="HG536_0B00410"
                     /db_xref="GeneID:59324299"
     mRNA            <62945..>64342
                     /locus_tag="HG536_0B00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281960.1"
                     /db_xref="GeneID:59324299"
     CDS             62945..64342
                     /locus_tag="HG536_0B00410"
                     /inference="similar to AA sequence:RefSeq:NP_010811.1"
                     /note="ancestral locus Anc_1.24"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137855.1"
                     /db_xref="GeneID:59324299"
                     /translation="MTINNLSCSEPSELYSIRQCVGRGNFGDVYKACDKKTGEIVAVK
                     VVNLEHTDEDINLLAQEIFFLAELKSPYITNYITTMTEDASMWIIMEYCGGGSCADLL
                     KNIYNNGLPEAKAAYITREVVKGLVYLHEQKKIHRDIKAANILLTDEGKVKLGDFGVS
                     GQIRATLKRGTFVGTPFWMAPEVVSKESDGYDEKADIWSLGITVYELLKGSPPLSKCD
                     PMKVMANLPKRKPPVLHGNYSSTAKHFIASCLVKTPKNRPSAVNLLDTDFISNTQCVD
                     LKSDVEMLNKRKSKDDYRRMPKFPLCEKLYDGSESSVRWDFSTTTTADRNPALSASEA
                     SKITTSTPRSPLSSNINSPYQSQDQAVTPVTNATSPSFRNYNKRYDVGSPMDIEYPKL
                     QDMKLKSFDYLKSVISYTFNRMYERAHDDETRMYVDEMLDHFASTESKIPGFSEVFVE
                     EISLRLDSIKKYLAK"
     gene            <64625..>66271
                     /locus_tag="HG536_0B00420"
                     /db_xref="GeneID:59324300"
     mRNA            <64625..>66271
                     /locus_tag="HG536_0B00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281961.1"
                     /db_xref="GeneID:59324300"
     CDS             64625..66271
                     /locus_tag="HG536_0B00420"
                     /inference="similar to AA sequence:RefSeq:NP_009882.1"
                     /note="ancestral locus Anc_1.25"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137856.1"
                     /db_xref="GeneID:59324300"
                     /translation="MKYSNLLLPVAATAATINLLAPNRLGIRDRVATDRFRTFASNES
                     FLPHSVKPYSIDSYRKRDNHKLLLADDGGNEDKVYDSKKEDSKKDENKKDEDKKDEDK
                     KDEDKKDEDKKDEDKKDEDKKDEDKKDDSKEIDFYDPEMFEKPGPMSELCKNDVHIIE
                     TSGDLYHLQAQCDTLLGSIHFANYADALIDFGNIQSVKGSIYVEKSSHLVKIEGSKLQ
                     AVGETFSLQSLTSLVSINLPYLKEARVIDWKVLPILNEALINENLGGLKSLTISDTSL
                     STIEGFKNVEDVEIFQVNNNRFLETVKANIQYVRQKLSVHANARETELEMPKLISAEN
                     ITVRDTSLAYFPKLETVGSSFELIQNQFSEMQVPNLKTIGGTLGIIDNVNLKLANFRN
                     VTDIEGGLMIANNTKLEKIDFFTSLKQIGGAIYFEGKFSDTDFPQLKLVKGSALIKTN
                     SGQMDCSKWTTPKNGRSIVRGGKITCTSGRRQKSQSVSQDGAVLSETVEDHESDGDSG
                     NDSKGGFFSNNSRSSDAKLEKPNLSWVLCVALLAIGHNFL"
     gene            <66955..>69210
                     /locus_tag="HG536_0B00430"
                     /db_xref="GeneID:59324301"
     mRNA            <66955..>69210
                     /locus_tag="HG536_0B00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281962.1"
                     /db_xref="GeneID:59324301"
     CDS             66955..69210
                     /locus_tag="HG536_0B00430"
                     /inference="similar to AA sequence:RefSeq:NP_010808.3"
                     /note="ancestral locus Anc_1.26"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137857.1"
                     /db_xref="GeneID:59324301"
                     /translation="MNEKEEDNQDRSDNALLKKTTEDSTQNQYEKFHSENASNKRGEA
                     LNIKKTRKKRRTFSCELCRKFKTRCDFEPLTGKCHRCNVLQLDCSLTEERECEIIAAV
                     RDKSGSIGLRDGSSDTNEALHASDHSQLVISSIRLTEQLERRLSKVESHFESLDNKLD
                     LVLGLLREPSDGSVKTMTKLDPHLPGFDDFSKGMSPLTASKYGSQFRRASHSLTDRVL
                     KDPPLKLIGNIDNRLFPREARSKQDQYAKQQRPFVVARVNFLHFYEKHEELCLKLSKE
                     FLIRSHFWIVPGGIKEIDDDYVRKHVFITSVFTIIAMSFDDNEKYASEQEMLYPLVER
                     FLTNTLTMFENLIAHDIEAILYCCMFHISRKAKRHRQLQFNSLVLSDFALNSFLSIFN
                     FNKLKKRVVVEEIYDPTDLYYLRILNSLTACKLEYAVSYGCYSTLDDSTKELNNLTAK
                     FPQSNFGDDIKISEINLGDIVNSIFVNFEEFYETARDRLHDTLEISDATQNSDLLAFS
                     ELTYWVTNWKELLSKDGAGVLLFTFDYYYIMICRSFISEFLSDIRTNPAFMARTLNTM
                     KEHAFSLIKGFLRLPPSLIKGAPILTSHQLVYACLALCDFLDWFPSSERQSVLNICTR
                     VYWHLNTIGEKKNEATDNVGKIIKSIIDTSRYRVSKGQQISSLPSTGPTRERTSSNKI
                     NFTTDPPKADPQVSVHSRNSPSETTSTAGNFMMPDVDQFNSFEEFFQDFFENLKPTTQ
                     QIFSSQKNLVP"
     gene            complement(<69231..>70124)
                     /locus_tag="HG536_0B00440"
                     /db_xref="GeneID:59324302"
     mRNA            complement(<69231..>70124)
                     /locus_tag="HG536_0B00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281963.1"
                     /db_xref="GeneID:59324302"
     CDS             complement(69231..70124)
                     /locus_tag="HG536_0B00440"
                     /inference="similar to AA sequence:RefSeq:NP_009883.1"
                     /note="ancestral locus Anc_1.27"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137858.1"
                     /db_xref="GeneID:59324302"
                     /translation="MAFDLYDQKVRCKIVHFVCYPDIMYKSGILDVAFRTLMQPLHNG
                     LADAYKAFCADDKLHFKIVYNTQVIPKPEVLLVLDSSFNPPHWGHHALIEKGLRLYDG
                     RSTQVLLLLAVNNADKAAAPASFDKRMEMMCLMADLLHKNGSAVSVGITDYAKYVDKD
                     IILRKHYKDARTISFLVGFDTIVRIFAPKYYYPRLPSEALESFMASTELCCLTREGNH
                     NLEEQMKYSSDISNGVYEPNIPKSWGAKIHMMENDKIFESISSSAIRKAIAEGQTSEK
                     LSKLLPLPIVDYILSSKDQMF"
     gene            complement(<70198..>70596)
                     /locus_tag="HG536_0B00450"
                     /db_xref="GeneID:59324303"
     mRNA            complement(<70198..>70596)
                     /locus_tag="HG536_0B00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281964.1"
                     /db_xref="GeneID:59324303"
     CDS             complement(70198..70596)
                     /locus_tag="HG536_0B00450"
                     /inference="similar to AA sequence:RefSeq:NP_010807.3"
                     /note="ancestral locus Anc_1.28"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137859.1"
                     /db_xref="GeneID:59324303"
                     /translation="MFLYYWFIAFLAGLTAAGSLKELQIGVTKRIPQDQCHIKAKAGH
                     TVEVHYTGYLRDSLEKFDSSYGRGVPISFKLGSGQVIKGWDQGLLGMCIGEERKIQIP
                     SDLAYGERGIPGVIPKNADMIFDVKLVSIS"
     gene            complement(<70866..>73076)
                     /locus_tag="HG536_0B00460"
                     /db_xref="GeneID:59324304"
     mRNA            complement(<70866..>73076)
                     /locus_tag="HG536_0B00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281965.1"
                     /db_xref="GeneID:59324304"
     CDS             complement(70866..73076)
                     /locus_tag="HG536_0B00460"
                     /inference="similar to AA sequence:RefSeq:NP_009884.1"
                     /note="ancestral locus Anc_1.29"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137860.1"
                     /db_xref="GeneID:59324304"
                     /translation="MRSLLIALLGFWLEIAAVRAIFIEDAFETDWQLQNIGIYNCVLK
                     NQEQGSFIVLSDFGSKTLLSYVNETDGQLLSRHVLDLQATDAMMTADRKHIVLKTVEN
                     EFMAFDSYSGLLKNDLDFPASEFRSGCKPDLSNIKLIDGTVQVLDSETGLLIFESDLP
                     PKFESIAFIETDYVSELQLLVHTTDDEYFFQLMKNNTMERSWIRDESNHDIVAHTFID
                     IGDSNLDVVSEEILKENSFPNAWQAYVFRVTTNWNRLRDSFRESGYSVGKFLTKLFKL
                     DSASLTAGQDANLIGVKYLVVATKYGVIQALDIQDGKKIWNFDSGLKNILLVEYISDS
                     HELLVFAEEGSYFIYRIEDGKVPVLREERSVGQKSVKSVSLLDSRELFIEFLDGEKKV
                     VTFKRGSDHPRTFICNHDSKGVYGHAIDANQSLEDTWIIKFPEFEDLAAFAGRKEAPI
                     VTLGQTLGNRTVLYKYLYPNMASYITVNKQTSTMYVNLIDTITGELLYSQMHEDKIDA
                     DQPINMVFGEYWFVYSYFSTEPVPEQKLVTVELYESLEANERISTDSEQINPLRSHHK
                     PAVISKAYFFPEIIQRMSLSQTIFGITSKTIILELKNGQITFLSKDILSARRVEESKM
                     TNDDKKEFMAMPYISMIPLNDHFVISHSRTLLLGDNAKLVSTATNLESTSVVCDIGHD
                     IFCSKIYPSGQFDIMSPSFEKGKLIATIAILVIVCYFLRPSVEAAKLKRSWLVR"
     gene            complement(<73264..>74523)
                     /locus_tag="HG536_0B00470"
                     /db_xref="GeneID:59324305"
     mRNA            complement(<73264..>74523)
                     /locus_tag="HG536_0B00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281966.1"
                     /db_xref="GeneID:59324305"
     CDS             complement(73264..74523)
                     /locus_tag="HG536_0B00470"
                     /inference="similar to AA sequence:RefSeq:NP_009886.1"
                     /note="ancestral locus Anc_1.30"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137861.1"
                     /db_xref="GeneID:59324305"
                     /translation="MALYTPPGKSPARPAAGERANDKREDTEDDLNKFYVRPSIGLRL
                     WGPLVPASDNKAGLWTLIGIQSAIGLLCMYRIKRLRASLKTVRKDIADFPSLNRFSTT
                     HGELLISPVAITPSKATSMSVKKGVQKASYSGAAFGASSFFKSSSQEGGSGGRFGRFS
                     TFRQVIYLLTGTLLLSQSLLEICRLKLLKYDPWCEEAKSVRDKKFFNDIIRFYHEGID
                     PTKVRVKDASSGNVMPTNIPEVKQSVALVRAQSEAENPIIKWYGPLEYKPMSFSEYLD
                     KLEYHLDMLVFLQEKRKLKKGSVEVMQKISHSSTEAEQLATKNRELRKKAYELVSDAP
                     KGSIPRRDRTLTYPARGILMDADCETPEDFDLQEIWKLYDPWMSLALETSLSIKFLPT
                     ITAPVEAGDHSSDELRESIDEPESSTK"
     gene            complement(<74779..>76329)
                     /locus_tag="HG536_0B00480"
                     /db_xref="GeneID:59324306"
     mRNA            complement(<74779..>76329)
                     /locus_tag="HG536_0B00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281967.1"
                     /db_xref="GeneID:59324306"
     CDS             complement(74779..76329)
                     /locus_tag="HG536_0B00480"
                     /inference="similar to AA sequence:RefSeq:NP_009887.1"
                     /note="ancestral locus Anc_1.31"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137862.1"
                     /db_xref="GeneID:59324306"
                     /translation="MLLDKKTVFHFATLLASALGVAAQEGAVAPEDSAVVKLTSETFE
                     DFIKENPLALVEFFAPWCGHCKTLGPQFVKAADALQDKGIPLAQVDCTEQQELCMAQG
                     IRGYPSLKTFRDHDVENPKDYEGARSAEAIINYMLKQTLPVVQVFDSEEPLKEFLANA
                     TLPVIISNGAAALNETFYQTANKYSDEYSFVTYPGSKSELSLQLPGVPEPIVYNGDVK
                     KIEDSPEVLENWLKVEALPYFGEVNGDTFASYMESGLPLAYFFYTNEDELKEFTPFFT
                     ELAKKHRGKLNFAGLDSRKFGRHAESLNMRQQFPLFAIHNITSNLKYGLPQLAEEEFE
                     KLTDAVKLETKHIKTLVSDLLSGKAEPIVKSEDIPEVQESNVYKIVGKTHDDLVKNNK
                     KDVLVKYYAPWCGHCKRLAPIYEELADILAAENDFIIGEVDATLNDIQDVVIEGYPTI
                     ILYPAGKNAEPVVFNSQRDLDSFLAFIEENAGNKIDTKSVREAYEKEQAKKEEVQAED
                     EGTEHDEL"
     gene            complement(<76697..>77827)
                     /locus_tag="HG536_0B00490"
                     /db_xref="GeneID:59324307"
     mRNA            complement(<76697..>77827)
                     /locus_tag="HG536_0B00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281968.1"
                     /db_xref="GeneID:59324307"
     CDS             complement(76697..77827)
                     /locus_tag="HG536_0B00490"
                     /inference="similar to AA sequence:RefSeq:NP_010805.1"
                     /note="ancestral locus Anc_1.32"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137863.1"
                     /db_xref="GeneID:59324307"
                     /translation="MFRIAKNLVKTLEQSVQETLSLSQSSSQLDAFFQSIPPNLLLPQ
                     THSHSQQDQEQPQHSVEQHHHPRRFNEVVSGLRVVYVSETQRQLQSYFDYIVGINDDA
                     IPLISNQHGYFYPDYNQITQIFNAHNNNTIKLNIWSAKGGIFRDEYISVVSKDGTNLE
                     DVSLSSNSMRESEHVFQPLGFKVQWTPLIASTFTYHVLNINLERGPAALAGLIPDEDY
                     IIGCQDGLLATGGETLLQDIVRSRANHDLSLYVYNVVHDCVRPITVHIGGDGRLGCNV
                     GYGFLHRIPTVIKPNHEHGPLEPSSPAADLEPVSSSTFVPSSLVAPASAKKTGTKGKK
                     KHSGAPPKDALMSDYFSEGKDESAVSTMQHNGDESAVPPPPS"
     gene            <78284..>79792
                     /locus_tag="HG536_0B00500"
                     /db_xref="GeneID:59324308"
     mRNA            <78284..>79792
                     /locus_tag="HG536_0B00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281969.1"
                     /db_xref="GeneID:59324308"
     CDS             78284..79792
                     /locus_tag="HG536_0B00500"
                     /inference="similar to AA sequence:RefSeq:NP_009890.1"
                     /note="ancestral locus Anc_1.33"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137864.1"
                     /db_xref="GeneID:59324308"
                     /translation="MSFDDFHKATARALSEKVDEICEEFTIDATKLKELTEYFIESME
                     KGLQPLEAGQSEETSKGLPMIPSFVTGKPNGTEKGVLLAADLGGTNFRVCSVDLSGDC
                     SFTLQQMKSKIPEELLEDETVSSRDLFSYLARRTVAFMKKYHPELLEEHAKDTAKPLK
                     MGFTFSYPVDQKSLGSGTLIRWTKGFKIKDTIGKDVVQLYQEQLNAVNLNMINVVALT
                     NDTVGTFLSHCYSSGSADSLSSGEISEPVIGCIFGTGTNGCYMEEIQNITKLPEEVKT
                     ALLREGKTHMVINTEWGSFDNELKHLPTTKYDVEIDQKLSANPGFHLFEKRVSGMFLG
                     ELLRNILVDLHSMGLILNQYRTYANLPHRLRTPFELSSEVLSHIEIDDSTGLRETELS
                     LLQSLRLPTTPSERVEIQKLVRAISRRSAYLAAVPIAAILIKTGALNKRYHGEVEIGC
                     DGSVVEYYPGFRSMLRHALSLSPIGSEGERKVHLRIAKDGSGVGAALCALVA"
     gene            <81118..>83394
                     /locus_tag="HG536_0B00510"
                     /db_xref="GeneID:59324309"
     mRNA            <81118..>83394
                     /locus_tag="HG536_0B00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281970.1"
                     /db_xref="GeneID:59324309"
     CDS             81118..83394
                     /locus_tag="HG536_0B00510"
                     /inference="similar to AA sequence:RefSeq:NP_009891.1"
                     /note="ancestral locus Anc_1.34"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137865.1"
                     /db_xref="GeneID:59324309"
                     /translation="MPLTFGSPLDSESSEVFMPLYTGKRKRTRTIPANGKPYLSGPSE
                     QDNLDMFDREQLVKLLIHALKELGYNFSAQALQEETGGIQVESTVVQKLFNIIRRGNF
                     ESITLQLLSQLPLKYGSLGLQDVIEDLQVGNDSSSDLTEQNSMKNGNVVSESTDWDKV
                     VHQMEQQLKAFENFVPLSGRNFSSQTLLQLTTLVEVMVLINKEIFLELLFDQRDSHMA
                     VAFLRNCLRKFIEIWDSLLALRNDMLDEDAPFTPEKLLKDMTTILTSPETSILQSSTW
                     QGSAAKSRDLLLEEISNYINPNDLVPRNRLLTLLKQAIKYQRSQDVLYISDDGENLIM
                     DDGEDGERSTGLFNHKFNLLQDNSSNFQQIKFTEEKTLVQNVDEIWFLQFSPNGRYLA
                     SATADSLTDRKIMIYDVKNDFQVYKVLAGIDLCVLYLSFSPDSRYIVSCPFNKKANIY
                     DIHSKGEPTFINPTVEGAIVAEIIQPIDSFQIPASTPSTSNNSSEPPRIWCCDWFHTP
                     EHEGRFIVGSPDREVVVYDLKSKTILMKLSSSTSTSPNGIASVNQGAAEQFPRVHDLK
                     ITADDKYLILMPHQGNIDVYDLSDFPNNEKIEKNEVAIDKVILPRVSRFNIPNRMTCI
                     SLPQVKDPNSPLASLMLVSLKSNELQLWDFREQILIQKYFGQKQEQFIIRSCFGYNDK
                     LIASGSEDGKIYIWDRINGNIIGVLTAHVAERPATSGNNKKSTKTCNTVVWSPTDKKL
                     FASGGDDGYIKIWRVEKE"
     gene            complement(<83451..>85010)
                     /locus_tag="HG536_0B00520"
                     /db_xref="GeneID:59324310"
     mRNA            complement(<83451..>85010)
                     /locus_tag="HG536_0B00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281971.1"
                     /db_xref="GeneID:59324310"
     CDS             complement(83451..85010)
                     /locus_tag="HG536_0B00520"
                     /inference="similar to AA sequence:RefSeq:NP_009892.1"
                     /note="ancestral locus Anc_1.35"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137866.1"
                     /db_xref="GeneID:59324310"
                     /translation="MSYGSLPDVMNTAANSLETMFLIQRARNNVKGWYFYSFSSEPFT
                     VSAVATYIPLLLEQFARINGVSVDDHSVKCSTSHDKCVLGLFNNSVYIDTSSFALYTF
                     SLSVLFQTLLVITVSGLVDVWKTVRFKRKILLFFGFIGSLSLVLLSQLRVDQYYLLPI
                     LCVVANSSYGVVNVVGNSLLPVFVSDLIKIDPVETATDPDALTSALSGCGASIGYCSA
                     LLVQIISVLLVRKSESHDNVQWAVLFVGLWWVTWQSPMAWLLQDVDPILADETLNHER
                     DANSGFRWHYMKYGWSSLFKALKHASLLRDVVIFLISWFIISDSVTTINSTAILFSKT
                     ELKMSTLSLIVISILTMLNAIVGAYLIPRHVSSKFNWSAQSTLKYIICWASVIPLYGM
                     LGFIFNNIGLKHPFEMYIMAVWYGISLGGLSAVSRSVFSLIIPKGNESTFFSLFSITD
                     KGSSIVGPVLVGFLTDRTHNIRYSFYLLFALLMFSLPIINMLDVARGKHEAEELSRIE
                     RLIEDDSNDIS"
     gene            complement(<85572..>86927)
                     /locus_tag="HG536_0B00530"
                     /db_xref="GeneID:59324311"
     mRNA            complement(<85572..>86927)
                     /locus_tag="HG536_0B00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281972.1"
                     /db_xref="GeneID:59324311"
     CDS             complement(85572..86927)
                     /locus_tag="HG536_0B00530"
                     /inference="similar to AA sequence:RefSeq:NP_009893.2"
                     /note="ancestral locus Anc_1.36"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137867.1"
                     /db_xref="GeneID:59324311"
                     /translation="MAVESDSAAASEARAPVVEVEAQAEVKKEPVLAPAPLPTKSPWK
                     AVSADIPVSSISMESLESGKKKKKNKAGTPTISSSTKWVPMKASIVVSSPKKAGNGAR
                     KGNNKTTSAAGSKKKKQQSQQPARRHSPRSSGGDEEAKDESSRHKEGEEQSIADSKAD
                     VQSEYSTVGELQPTAGQGGRPAYQRRKHNHSNQFQHSAHQQNGFQRRRYHSNYNNNDL
                     SRQQRYMHSKAMSPYQGRVPRPLGHDPHLINGHMQKAPYMVPMYQQFYSMQPILMAVN
                     SIARQIEYYFSPENLANDKYLRSKLSKEGYAPLSLVARFYRIVNMSFGGDPSLILAAL
                     REIVFNQNSTVDVCYGTIENADDAGSKQEDHAILANYFVRSKQWEALLPEEYSTVIKI
                     EKILENDALDEFMISAASMQEKAPIAEPQESLPVGAIPEKSEEESEPTSSAGDPQVEA
                     Q"
     gene            <87286..>88869
                     /locus_tag="HG536_0B00540"
                     /db_xref="GeneID:59324312"
     mRNA            <87286..>88869
                     /locus_tag="HG536_0B00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281973.1"
                     /db_xref="GeneID:59324312"
     CDS             87286..88869
                     /locus_tag="HG536_0B00540"
                     /inference="similar to AA sequence:RefSeq:NP_009894.1"
                     /note="ancestral locus Anc_1.37"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137868.1"
                     /db_xref="GeneID:59324312"
                     /translation="MKRATLVRMFTEGGMKIPNSEAGFSTVPVRTQSGAISSRVRGLP
                     YRMKTGIGMYKSACSSVPNKGGKKKTWVDEFDHFGQLRKLRWPGLADSHSCFRDVVEK
                     YLADVEVLYRELNAVSARSLNEKLDAVKERWVAEHGSLPEVSTGKERKREKVRKQERV
                     KARDGKQLGVASEVQLTVEANKQLLEQEDEKKMRKQYDQALRQVKENHCPTVYANPGT
                     SNFDYLTNSIRLMSTKKTICFSLDVEAYEFDNDVVTEIGIAVYDPRENINPLVPLTRN
                     YHLIISEALHLRNRKWVCDFKDCFLLGESFVLSLHECVEFVQALVDYYMTPQTAEDRS
                     WSRAFVGHNLQGDLRWLRKMGVKVPADGDLDYTLQKADLKADVEKEEPIFVLDTEKLY
                     RLCYGSKGSNLGRLLRLFRIPHAFLHNAGNDAHYTLKLLMHMCDVNFRKQYGMDNLED
                     MSRKINQWIDREKEEPKVLPMSYAVSVVDATRKRHAVSKNDNTARRKQAKDLVPQTEF
                     GGSRYFDSAREAFSSTLCK"
     gene            <89797..>91140
                     /locus_tag="HG536_0B00550"
                     /db_xref="GeneID:59324313"
     mRNA            <89797..>91140
                     /locus_tag="HG536_0B00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281974.1"
                     /db_xref="GeneID:59324313"
     CDS             89797..91140
                     /locus_tag="HG536_0B00550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137869.1"
                     /db_xref="GeneID:59324313"
                     /translation="MVLRSDGRCFNWQCEADDLSGYFYDDLTTYIDRDTCLGPCLEQC
                     FERKITAGQLEAMAWLLGFWIGDGCREGARFALHSEDHDVNTRLEKNADVWGMTLRIE
                     RQKEGLGEVGFLHTYNGAVRYWNVNNPLVKVLEGLKFYENGQRNGLKSVPLFMQTEQI
                     VVREAFLAGLIDSDGHCRIRYGCISVQIATVYRPIRDGITFIGRSLGLTVSTHFCGAH
                     FYERHGQNRSDTWYFHLYGRTNDETLWSILNRCSCERKRNPQIQHCRDRDFEEFDSDY
                     QAEENENDPEDNDDLSGIRESFEDDLEDDPEEQQDGTLNFGKFRFEIIPGRKDAVIGL
                     VLSGTSNRTFVTDDQIVCAAAELVTERLELSTERLESRPYFRRRCLSCRTETASKWYK
                     VPWLGDVLDRLCRACWVAYSRTHMRCSNDLCNWVFRRREVAPRRCKRCRSSPLQG"
     gene            <92078..>93706
                     /locus_tag="HG536_0B00560"
                     /db_xref="GeneID:59324314"
     mRNA            <92078..>93706
                     /locus_tag="HG536_0B00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281975.1"
                     /db_xref="GeneID:59324314"
     CDS             92078..93706
                     /locus_tag="HG536_0B00560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137870.1"
                     /db_xref="GeneID:59324314"
                     /translation="MVSKTIFGLLALATASVANAAYTFTVPIQYQSEIVVSSYFRNGN
                     DKVSVTASNDGLQITVDADTSQVCNILESGMVVYAVDGATANTLLSWNQYDVFHLVDG
                     NGNNVQWTSTNAQTCPVAGSSVAGGSSVTGSFSATASQGGFSVSGSSQGGFSVSGSSQ
                     GTVSTASSQAGSAIIKSSGASSAVSSSQLTGAASLTQLITSSSFPLAPSTTMSVTTKT
                     INGVVSEYTTYCPFTTAGKMESVVTYANVFTTTISGKESVYTTFFPVSTQLKASATAT
                     GIKATAAPALTTVTTTINGIETVYTTTCPLSKGSYVTSAEGSTSVITTTINGKETVFT
                     SVFPVATITGSKSSTTSVVTTTVNGQETIYTTVCPVGAASGSQLVPSTTSVVTTTVNG
                     QQSIYTTVCPIQTSAVGKTTVVVTTSENGSKTVYTSVYLVTSKGQAAQQTSAVAITSN
                     SQKAVYSSVVPANSVATGQVTTVITTTQNGSKTAYTTTAQATAGAGSSIAVQSSGHSS
                     SLTALISTYQGAAAAASSPMLTILALIAGSVFLA"
     gene            complement(<93763..>94191)
                     /locus_tag="HG536_0B00570"
                     /db_xref="GeneID:59324315"
     mRNA            complement(<93763..>94191)
                     /locus_tag="HG536_0B00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281976.1"
                     /db_xref="GeneID:59324315"
     CDS             complement(93763..94191)
                     /locus_tag="HG536_0B00570"
                     /inference="similar to AA sequence:RefSeq:NP_009895.1"
                     /note="ancestral locus Anc_1.38"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137871.1"
                     /db_xref="GeneID:59324315"
                     /translation="MQFDLASVVPLLIILLVTNLLTRRLFSKVSANKMVSQQTISRVK
                     DLIGQKKVFVASKTYCPYCQATLKTLFDELHVSKAQSLVLQLNTMEDGAEIQEALFQI
                     NGQKTVPNIYIDGKHIGGNSDLQELKNSGKLEELLRDALE"
     gene            <94498..>95511
                     /locus_tag="HG536_0B00580"
                     /db_xref="GeneID:59324316"
     mRNA            <94498..>95511
                     /locus_tag="HG536_0B00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281977.1"
                     /db_xref="GeneID:59324316"
     CDS             94498..95511
                     /locus_tag="HG536_0B00580"
                     /inference="similar to AA sequence:RefSeq:NP_009896.2"
                     /note="ancestral locus Anc_1.39"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137872.1"
                     /db_xref="GeneID:59324316"
                     /translation="MGLLSDHPHTAITDTIDRVVSTKEYALEVDLGTVVGLIRNGASD
                     YEYITNQREAARVLRKKLKYGNRLQQSRSLDLLDLFVSQGIRFGALYNDDKLVDRLSG
                     IALNRVPDSRGSRYNSKIVKKCANYVLSWCNYIEESGQQSNRSYASFVELGRSVKRRY
                     SNAQQRRGRSNFMDDQADESIHASQQSDPDQLYGIPRIDIKKSAPAMRVVISDALAAA
                     VALKNALMVLPQGKSSTDDEEATARFIQARALRRKILRYLQLVTEGEFLGSLIHANDE
                     LVSALAEYDEKSAESAESSSEELYSDEDGDGRSSEDDYDSRSLASTQPSTASNPFGDH
                     NKI"
     gene            complement(<95575..>96057)
                     /locus_tag="HG536_0B00590"
                     /db_xref="GeneID:59324317"
     mRNA            complement(<95575..>96057)
                     /locus_tag="HG536_0B00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281978.1"
                     /db_xref="GeneID:59324317"
     CDS             complement(95575..96057)
                     /locus_tag="HG536_0B00590"
                     /inference="similar to AA sequence:RefSeq:NP_009897.1"
                     /note="ancestral locus Anc_1.40"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137873.1"
                     /db_xref="GeneID:59324317"
                     /translation="MFRSVRSLSHGGSRALSCLRTRQFHVTKAIMTTKWNPDLTPEQL
                     SVLRDKGTERPYTGTYLNNKEEGTYHCANCDAPLYSSGAKFDSGCGWPAFYQEVSKDA
                     LTYHRDSSLGMERVEICCGRCGGHLGHVFEGEGWQKMFNHPTDARHCVNSASLKFAKN
                     "
     gene            <96192..>96449
                     /locus_tag="HG536_0B00600"
                     /db_xref="GeneID:59324318"
     mRNA            <96192..>96449
                     /locus_tag="HG536_0B00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281979.1"
                     /db_xref="GeneID:59324318"
     CDS             96192..96449
                     /locus_tag="HG536_0B00600"
                     /inference="similar to AA sequence:RefSeq:NP_010800.3"
                     /note="ancestral locus Anc_1.41"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137874.1"
                     /db_xref="GeneID:59324318"
                     /translation="MSTKYPSTMKCMEAFDQLTVCYSVGGQFRSYYRYGEFDACQKPL
                     AKLKFCLMHGRDPVKVQEWHKQQIEYNKSHRGTSDDIWKER"
     gene            <96789..>97736
                     /locus_tag="HG536_0B00610"
                     /db_xref="GeneID:59324319"
     mRNA            <96789..>97736
                     /locus_tag="HG536_0B00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281980.1"
                     /db_xref="GeneID:59324319"
     CDS             96789..97736
                     /locus_tag="HG536_0B00610"
                     /inference="similar to AA sequence:RefSeq:NP_009898.1"
                     /note="ancestral locus Anc_1.42"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137875.1"
                     /db_xref="GeneID:59324319"
                     /translation="MSSNQEHPVESLEAADAPLITDDFTKWTVDEVTSWCVSSLEIAT
                     DDPVIERMRENGVSGELLPELTFDDCKELCGEDLNKAVRLKVLLNRLQNDADRESKLE
                     EQQQHMVVTLRNLYSTVSQKLQEYQTQYAKLRLDVLELVKTSNVSPKIPAHETPSHAV
                     QPSEDYFGGPHQPADYISTNFATPVPLSSMPRKSSSLSTRPPPNRSASSHLNDTPAGA
                     ISNEPLKQLRASKEDSCEKILKNAMKRHNLADHDWRQYVLVICYGDQERILELEEKPV
                     VIFKNLKQQGLHPAIMLRRRGDFEELNMGGESATPGGRL"
     gene            complement(<97751..>98638)
                     /locus_tag="HG536_0B00620"
                     /db_xref="GeneID:59324320"
     mRNA            complement(<97751..>98638)
                     /locus_tag="HG536_0B00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281981.1"
                     /db_xref="GeneID:59324320"
     CDS             complement(97751..98638)
                     /locus_tag="HG536_0B00620"
                     /inference="similar to AA sequence:RefSeq:NP_009899.1"
                     /note="ancestral locus Anc_1.43"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137876.1"
                     /db_xref="GeneID:59324320"
                     /translation="MVVQPSGVESMKNGFLVVPFMLPESKLLKDDMAGYHYMFVRKHQ
                     TKLNKEQNSLFIVNLPLLTNLESMRSAFKKICSQANTVSHIEDLLYNDEFGLQEVDLS
                     ALTSDLMKTEDSSEVRYTPRNTALLKFVDEASVENCWNALRKYCSSKRAQIIEWQYQS
                     PSIETFLNFYKPIDIEHLKEDIYTHMKLFEQREQEAQEAVQSSIVDEDGFTLVVGKNT
                     KSLNSIKKKILKKNPLSKHETKIRTPTAVDKKAKKDFYRFQIRERKKQEINELLRKFK
                     DDQEKIKIMKAKKKFNPYT"
     gene            complement(<98881..>99291)
                     /locus_tag="HG536_0B00630"
                     /db_xref="GeneID:59324321"
     mRNA            complement(<98881..>99291)
                     /locus_tag="HG536_0B00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281982.1"
                     /db_xref="GeneID:59324321"
     CDS             complement(98881..99291)
                     /locus_tag="HG536_0B00630"
                     /inference="similar to AA sequence:RefSeq:NP_010799.3"
                     /note="ancestral locus Anc_1.44"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137877.1"
                     /db_xref="GeneID:59324321"
                     /translation="MRANCTQLQRASSVLQAARRGRRATESQPLLPPLHLYRRILREH
                     KNLPVLQRELGDNYVKNEFKLHKGIDNPLHIVGFLASWQDYLHLISKGDWLEGTLTSE
                     VLEKLSPEQVVQLYELMKETQQVRDGKVADDDNN"
     gene            complement(<99481..>101910)
                     /locus_tag="HG536_0B00640"
                     /db_xref="GeneID:59324322"
     mRNA            complement(<99481..>101910)
                     /locus_tag="HG536_0B00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281983.1"
                     /db_xref="GeneID:59324322"
     CDS             complement(99481..101910)
                     /locus_tag="HG536_0B00640"
                     /inference="similar to AA sequence:RefSeq:NP_009900.2"
                     /note="ancestral locus Anc_1.45"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137878.1"
                     /db_xref="GeneID:59324322"
                     /translation="MVFPVLPLYGKDFSSAIAAKPFLTLADQALIDSSVLNAEQIKKF
                     VDEFGSEIKFISVLLKDSSAFDDEKIVDLLNNGVSTLFVDQQSYVDHLCQNVGIPEER
                     LSVLKDSAYKNRFSIKTDFRLNDIVPVDQITVDSFSEAVISSIKTDREDKLYTTLVVD
                     ANERCLGLVYSSAASVKVAIEKKAGVYYSRSRNEIWEKGLTSGNTQKLISIQLDCDGD
                     ALKFVVEPCGKTSDFCHLDTVSCFGEFNHGLVELEKLLKERLDNAPEGSYTRRLFSDP
                     ELLTAKIKEEAEELTEAESKSELAWEAADLFYFAMTKLVANGVSLADVEQNLQKKHLK
                     VTRRKGDAKPKFITQKKEAEVAKAPEDQSNVKISLNVLSSENTVGVEKALARPIQKTS
                     EIMNLVNPIVENVKNKGDKALIEYTAKFDGVNLRSPVLNAPFPEEYFEGLTDEMKESL
                     DLSIENVRKFHAAQLQTEVLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALML
                     GVPAQVANCKEIIFASPPRKSDGKVSPEVVYVADKVGASKIVLAGGAQAVAAMAYGTE
                     SVPKVDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVICDEQADVDFVASD
                     LLSQAEHGVDSQVILLGVNISEEKIKQVQDAVHEQALKLPRVEIVRKCIAHSAIINCK
                     DHKEAFHISNKYAPEHLILQIANAQDYVKLVDNAGSIFVGAYTPESCGDYSSGTNHTL
                     PTYGYARQYSGVNTTTFQKFITSQIVTPEGLENIGKAVMCVAKVEGLDGHRNAVKIRM
                     NKLGLLPEGFH"
     gene            complement(<102254..>103687)
                     /locus_tag="HG536_0B00650"
                     /db_xref="GeneID:59324323"
     mRNA            complement(<102254..>103687)
                     /locus_tag="HG536_0B00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281984.1"
                     /db_xref="GeneID:59324323"
     CDS             complement(102254..103687)
                     /locus_tag="HG536_0B00650"
                     /inference="similar to AA sequence:RefSeq:NP_009901.1"
                     /note="ancestral locus Anc_1.46"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137879.1"
                     /db_xref="GeneID:59324323"
                     /translation="MNRYQDKIGCFVHIPNVGRGQLKYIGPVDTKPGIYVGVDLLANI
                     GKNDGSFRSKRYFNTEYPQSGLFIQLQKIASLLDSAQPGQPTASRRSTMAPDLTFDSA
                     TRVWNRVSSSESTESTVVRRQISSDPLSPTPVRGMSGNSVLENGSQSGLPKQRTATRN
                     GNIPDLEENVDHERDLDMVPPSSVPGRRTGSGDPSSHLLKEYQHKIERQDREILQFKR
                     LLDDQRMVLEDIQPTIDHYESSLREMEKEMDTLRRRLKIEQEQQQKQKQFFETEHEQL
                     LAVVEELHEEIKANEERVIMAQTSQNNGSESVPQLRKTISELMERVNFLEAAQTKWLK
                     EKEQLKLQNESLSKEYSSLSGEYLRAQGNSHANVDADTQMLQQKLYNANVKIAQLEDL
                     LQQQRHMRSPTYRDDTNIHNYRSDTVDSLALSRSKTKIEAAAGKEAWCALCERDGHQS
                     IECPNELPLASERQEDLRSPSNDQLLF"
     gene            <103952..>105253
                     /locus_tag="HG536_0B00660"
                     /db_xref="GeneID:59324324"
     mRNA            <103952..>105253
                     /locus_tag="HG536_0B00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281985.1"
                     /db_xref="GeneID:59324324"
     CDS             103952..105253
                     /locus_tag="HG536_0B00660"
                     /inference="similar to AA sequence:RefSeq:NP_009902.2"
                     /note="ancestral locus Anc_1.47"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137880.1"
                     /db_xref="GeneID:59324324"
                     /translation="MDVDRLITEAERCFNDSNHDDAVAKLTTAARSDPTEEQQSYIES
                     LIHRISEHVVQNGNEGEGERGIGSSLMNTMMSNNNGSSQSQLGKLALLSTILGSSKNS
                     NGFNLQSVVSLLGSGKNNQQPNQGSMGSSGLASLAAQFFGSSSRPQQQQQSHQSGSFS
                     TLASMASSYMGNSGSQGRPQQQYQSDYNPSGTQGGQGYGGYSEGHGRPQSQGYQNNQS
                     QGGSGTFSTLASMAGSYLSGSQKPQGQHQGNQGYQHNQSGSQGYQNNQGYQNNQGYQG
                     GQGYQGGQGYQGGQGYQGGQGYQGGQDYQGGQGYQGGQGYQGGQGYQGGQGYQGGQGY
                     QNNQGYPGGQNSQGGQGYHGGQGYQGGQGYQSDNQSQNDGQSKMSGFMSMAGSLLGQD
                     KPQSNSNYQGGPSPQGRPSHGGEQQGGGNFQFSGNFVPNRY"
     gene            complement(<105379..>106530)
                     /locus_tag="HG536_0B00670"
                     /db_xref="GeneID:59324325"
     mRNA            complement(<105379..>106530)
                     /locus_tag="HG536_0B00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281986.1"
                     /db_xref="GeneID:59324325"
     CDS             complement(105379..106530)
                     /locus_tag="HG536_0B00670"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137881.1"
                     /db_xref="GeneID:59324325"
                     /translation="MPAMKSIAVSLSLLAAVSSAAAQTTVWEDFTATVTAQTFFKSGI
                     STSAEISSTPISSPSLKSSSSPSSSGRPEITGPVVTSSVPGISSTSSGRSSIGSPTGS
                     SSFRYSNSTSVDVRSPYSSSSYVEIVSTDSSQAASSSADSMSEASTSDSSATDQASST
                     GSLSSSSWDSSQQATPSSSWDSSQQATSSSQVTSAAAPSEISSETPSSSSSTAQPTTL
                     DSATANLVLAEHNAKRALHINTPPLTWSDDLSAWAYNYANSLKGTNYDPCSGNLLHSS
                     TRNNQGENIAFGTYSSATALVDFWYNEIRYYDFNNVTGIVHDGYDVGHFTQLVWASTT
                     EVGCAAIECPANNGLYLLCEYTPAGNVYVGNSVDTFQLFRTNVLPLIPE"
     gene            <107472..>108926
                     /locus_tag="HG536_0B00680"
                     /db_xref="GeneID:59324326"
     mRNA            <107472..>108926
                     /locus_tag="HG536_0B00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281987.1"
                     /db_xref="GeneID:59324326"
     CDS             107472..108926
                     /locus_tag="HG536_0B00680"
                     /inference="similar to AA sequence:RefSeq:NP_009903.2"
                     /note="ancestral locus Anc_1.48"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137882.1"
                     /db_xref="GeneID:59324326"
                     /translation="MTTLIATTVTLYPSPASSSLNSSLASPSRAPTTVTHLVTRTLAS
                     DEPTGVPLGTFDSNATSASGLTIGLAIGLPVGLFCLGLLVFLFYFYWRGSVLESSAVA
                     SGSREAENHMNEKSWLPNLIYGGRDADDNSSYLNVKRLPSVSSKIQYRISRAAPQHIL
                     TPKAPLCRESHGDPLAVNDEVDTFLYSRPPNIYHIDSKMPSTNNLANGSKVSVNGPHS
                     ISSSTGEVNPLRRASRKWSYQSPLSRWFLRSSTYLQDGLTLPMSIKTPTVQLKQLKIL
                     SRINKEYANSWQFVDDEKSPILDRMDDCSDEQGSLPSAMDGDGCAIQKPSSGIYGTID
                     PQTFEVRDEAMGGDRSLKLGPAPSNIEKGGKNRRQRRQSRLRQHLQQISNVKPLPVIP
                     KSTSGSHGRFQIGRVYKVVQEYKARLTDEICIEAGEFVKMLATHTDGWCLVEKCTKDG
                     VTESICEDRKDINDKSYLNDDRGIIPGDCLQQAK"
     gene            complement(<108961..>109539)
                     /locus_tag="HG536_0B00690"
                     /db_xref="GeneID:59324327"
     mRNA            complement(<108961..>109539)
                     /locus_tag="HG536_0B00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281988.1"
                     /db_xref="GeneID:59324327"
     CDS             complement(108961..109539)
                     /locus_tag="HG536_0B00690"
                     /inference="similar to AA sequence:RefSeq:NP_009904.2"
                     /note="ancestral locus Anc_1.49"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137883.1"
                     /db_xref="GeneID:59324327"
                     /translation="MTAANYLKAVASRRTVYALKPELPSGVNINDVQAVVQAIIRDTP
                     TSFNSQVNRAIILTGKAHKEVWDRVVESIPGESGKKRPQSARDEAYGSVIFFTDDVVT
                     EQLQAKFAAFAAAFPQFADHSSGAAQIHTWTALRELGLGAHLQHYNGYVKAALPKEIP
                     ATWNVHAQLVFGVPAAEPGEKTFEENPVKIYS"
     gene            complement(<110058..>111992)
                     /locus_tag="HG536_0B00700"
                     /db_xref="GeneID:59324328"
     mRNA            complement(<110058..>111992)
                     /locus_tag="HG536_0B00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281989.1"
                     /db_xref="GeneID:59324328"
     CDS             complement(110058..111992)
                     /locus_tag="HG536_0B00700"
                     /inference="similar to AA sequence:RefSeq:NP_009905.3"
                     /note="ancestral locus Anc_1.50"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137884.1"
                     /db_xref="GeneID:59324328"
                     /translation="MPSSSSFNSNIIPPYEMEDMKKAGEQAVTNKELDNEVEYFDSGM
                     DAQNGSNDADEIANAHMSRGSGEARGALRHFVDSFRRQQHSSSAEEDLENELTTCISP
                     ATLNGYTKSGSKSASELAPAKKESLKKSIKPRHVVMISLGTGVGTGLLVGNGRALVNA
                     GPAGLLVGYAIMGTCIYCIIQSAGEMAVVYSNLIGGFNAYPSMLVSPAFGFSVAWVYC
                     LQWLTVCPLELVTASMTIQYWTTKVNSDVFVVIFYFLIIVINVFGARGYAEAEFFFNC
                     CKVLMMIGFFILGIIIASGGAGNDGYIGAKYWHDPGAFRGDKAIDRFKGVVATFVTAA
                     FAFGGSEFIALTASEQSNPRRSIPSAAKKVIYRIMCIFLGSIAMVGFLVPYNSPQLMG
                     SGSSKVKASPYVIAVASHGIKVVPHFINAVILLSVLSVANSAFYSSSRILLSLSQQGL
                     APKFFNYIDRSGRPARAMIVSALFGVIAFCAASPKEEDVFTWLLAISGLSQIFTWASI
                     CLSHIRFRRAMAVQGRSVGEIGFRSQTGVWGSWYSFMMLMLALIAQFWVAIAPIGTNK
                     LDVQNFFQNYLAMPILIAFYIGYAIWKKDWKLFIRAKDIDVDSHRQIFDEDLLRQEDE
                     ETKEKLRNGPFWKRAVAFWC"
     gene            <112709..>113002
                     /locus_tag="HG536_0B00710"
                     /db_xref="GeneID:59324329"
     mRNA            <112709..>113002
                     /locus_tag="HG536_0B00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281990.1"
                     /db_xref="GeneID:59324329"
     CDS             112709..113002
                     /locus_tag="HG536_0B00710"
                     /inference="similar to AA sequence:RefSeq:NP_010798.1"
                     /note="ancestral locus Anc_1.51"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137885.1"
                     /db_xref="GeneID:59324329"
                     /translation="MSESPPEAKPEAKSEVKPETHINLKVTDGSSEIFFKIKRTTPLR
                     RLMDAFAKRQGREMDSLRFLYDGVRIQPDQTPDDLDMEDNDIIEAHREQIGGC"
     gene            <113246..>116674
                     /locus_tag="HG536_0B00720"
                     /db_xref="GeneID:59324330"
     mRNA            <113246..>116674
                     /locus_tag="HG536_0B00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281991.1"
                     /db_xref="GeneID:59324330"
     CDS             113246..116674
                     /locus_tag="HG536_0B00720"
                     /inference="similar to AA sequence:RefSeq:NP_009907.2"
                     /note="ancestral locus Anc_1.52"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137886.1"
                     /db_xref="GeneID:59324330"
                     /translation="MRMSNRSVATIKGNKIGPWKLGETLGLGSTGKVQLAHNEATNQQ
                     AAIKVISKAIFNTKVSSKESALAAATPDSLPYGIEREIIIMKLLNHPNVLRLYDVWET
                     NSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFFRQIVIGISYCHALGIVHRDLKPE
                     NLLLDHKFNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCG
                     VILFALLTGRLPFDDEDGNIRNLLLQVQSGKFQMPDDDEISKDAQDLIARILTVDPEK
                     RIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHPLAEGDSAPIDETILQNLVVLW
                     HGRSEADITTKLREPGANAEKTLYALLDRFRSDSERDSLKQTQVRKRQSQTSAATQAT
                     NRKAAPKLQANNSPKKRNRNSVISVSSSHKRPVSFNRLSNVASSNSVPSSNSNTPSKR
                     LSMNLSSNKRLSAVYTNNSSPTPASRHKRVSVIDLEKSGDTPPVPIEMLKDYSTNTKN
                     KRLSRNSMRLSFKPTNKRGSITTKLISTYAKLSEDDDWEYIEQETKRTSSDFATLCDQ
                     IFEHEKFEQIRREKEELERKVREAKEREERERKEREEEEKRKIKEKQEMEMRQLEIQQ
                     QMEKEVEALKKELQNETFKDEHLESNNDDGIANGRSVSAPVDKKIEDAFADIQTNIDD
                     LLRQRTLSLQTRPVSRLDPGVFYSDSAKGSYGNTSADEQRLNSDRIILETIRRSKFLG
                     SSFDIKEELELAKKEEGKTHKHLADASERVISMTNEKYETQVLPKNTTATVILDDLDY
                     ESQPRKISDIKVPQFTRKSRHFSDSNKRLSVLSLYSTKQSYNNLANILNDDKSNSKGT
                     HDSPADNSGQEPEFLFETAQEEGEYTGDSSNDGRLYEVPEESVVTKDRLKLNFADRFK
                     SSEPESKRAKDGNIKLPSLPPLNSTEASGLGIYKSSSESIEEPAKSAPSNQQEVLEPK
                     KELKPVASNKEKKDSLNNIMPKLRPEEAKTADQSQRKPLTEVPEKKRNTSFFRKFSKS
                     SNNEKKDTGYDAELYASVSSKQLFNGLRNLMQGWTKYGLKDVKAVPEKLTLTGKLSSD
                     NILSLRSTLFEMVVWSRGNASVVGFKKKSGSTKTLKRLVNEIEKVLVKEGVLTK"
     gene            118299..118426
                     /locus_tag="HG536_0Btrna2L"
                     /db_xref="GeneID:59324968"
     tRNA            join(118299..118337,118382..118426)
                     /locus_tag="HG536_0Btrna2L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUG"
                     /db_xref="GeneID:59324968"
     gene            <118535..>120322
                     /locus_tag="HG536_0B00730"
                     /db_xref="GeneID:59324331"
     mRNA            <118535..>120322
                     /locus_tag="HG536_0B00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281992.1"
                     /db_xref="GeneID:59324331"
     CDS             118535..120322
                     /locus_tag="HG536_0B00730"
                     /inference="similar to AA sequence:RefSeq:NP_010794.3"
                     /note="ancestral locus Anc_1.54"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137887.1"
                     /db_xref="GeneID:59324331"
                     /translation="MIFQVVFAIVLFLQDTVAGPATEDEKSTHLLDFDITSSFNEAGR
                     RIISINDHANTYGPTIRVKAGEEINLKVQNHICTAEEALLGDQDLLWREFCDTALHFH
                     GLVPIGNENDGVPGLVQAAIKTGDTYWYNFTIPANACGTFWYHSHSSVQYGDGLRGVV
                     VVECPEYDSLARSIASSAGIDEAETPGPFEIDETETSRSGLAIEEQIITLSDWYTEFD
                     LDVMRDEVMAYDGTTDPHIDGSLINGSGEQDMEITLREDTEVIVLRIINSGMSGTQVF
                     HLEDHKMIIMETDGILVKPYVVETVSMAVGQRLTVMVHLSQDVINGNKALKIVNGCNK
                     MMGYITKTAWFVKQKGANAKNNAEVNIKYLPGLNKHELYRELEPHDSEEITGLWGDDD
                     IQRVELEYSYHSDKETKHRFQTGMYKVNGKVFDEYYADPVILKSGQVAELIINARDHM
                     RHPWHLHGQPFQVVSLGAGREGPLSLRSPDTAAGRRYQEDLQFWRDNKRTPMTRDSIN
                     IPGNSYAALRIKSEFEGKWLLHCHVDWHMAKGLGVVLEILPGNATNSAQTPTGKPEAP
                     THPTHRFKVLLIYFLVMVAINAALYRLLM"
     gene            <120632..>122959
                     /locus_tag="HG536_0B00740"
                     /db_xref="GeneID:59324332"
     mRNA            <120632..>122959
                     /locus_tag="HG536_0B00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281993.1"
                     /db_xref="GeneID:59324332"
     CDS             120632..122959
                     /locus_tag="HG536_0B00740"
                     /inference="similar to AA sequence:RefSeq:NP_010793.2"
                     /note="ancestral locus Anc_1.55"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137888.1"
                     /db_xref="GeneID:59324332"
                     /translation="MTAELPSINSTTSISDNVDLRNYYDNLLFKNGSGKSLTDLPRKA
                     AAAASGVPPSGKSAHALSNEVMAGSEAGNNEKGEKKIDFITGFENAHGMRSVAAHGPP
                     FTSLQMTPSNSEPIPLSATPPLMSSHGLLRPSQQSFFNVSNQTPVVYQSSEPANVLPF
                     SFNFDRNNEQQAYYSNNLAQGFTSNSMMPPMGSSQTQFVEQQQANLQGDLLLPQGQFH
                     SQQPHSGTRRSSYISDTLIHGHLGSLPNPETVSAMNGQVMKPAGFSASASEMAPPTTA
                     PAAPYKNMIPQHYPPRRNTQPVSSIGSSTMPFSPPHLANSNVRNRYLSHSKQQQQPHH
                     AKPLAREDSKGEVLLENGLLLVNAHQIVSSPDLQALYADCGGNYFSSRQVYEFADRIK
                     SMMRPTNGSYESKKSQAIAKFLTFLKSCNLNYNPQSDAFMSEKRFSKSPIERKAGLPE
                     DSNHGGKQSPPEKRSGSTSSYLHYKPLVLVALKNGKLELLSTPQNTNILMKRDDLVII
                     DGDRGKDLALVVEPSVDLDLALFINFLKKKIHFDSLITTKSQHHANGTFIEALIDSTK
                     GQNEILNSKLYDVIELTQLIVPSKQVLRFATPWEVTTNLHNKFQDELKALHIAQLKLK
                     SLNSGFSHHHHSVMSNGAAPAGQPANRPQLNIKILNAEFQFDRKKLTFYYVCEERNDF
                     RELIKELFKFYKTRIWLCAIPNNLGIDAKYYDAQRKELKMYQDMMQHYATDDLADANA
                     QQGGGFIIAPPLNKIELDNFQIGVYNELVDELFSS"
     gene            complement(<122971..>123609)
                     /locus_tag="HG536_0B00750"
                     /db_xref="GeneID:59324333"
     mRNA            complement(<122971..>123609)
                     /locus_tag="HG536_0B00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281994.1"
                     /db_xref="GeneID:59324333"
     CDS             complement(122971..123609)
                     /locus_tag="HG536_0B00750"
                     /inference="similar to AA sequence:RefSeq:NP_013279.1"
                     /note="ancestral locus Anc_1.56"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137889.1"
                     /db_xref="GeneID:59324333"
                     /translation="MASAFSFTGATSEALAKHEILKDVLKDGEFKPWGVLAVQYSSDA
                     PVAMGNTLAVDKAQSKPSVQFNLNPERGAPRITDSDLFTLVVTDPDAPSRTDKKWSEY
                     CHYVEADIRILDRSQTAGTGHVEPQFVCAAVGNGTVLQPYMGPAPPRGTGKHRYVFLL
                     LKQPQGATSSQFTRIADRPNWGYGTPATGVHRWASENGLQPIAANFFFAEHK"
     gene            <125661..>126809
                     /locus_tag="HG536_0B00760"
                     /db_xref="GeneID:59324334"
     mRNA            <125661..>126809
                     /locus_tag="HG536_0B00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281995.1"
                     /db_xref="GeneID:59324334"
     CDS             125661..126809
                     /locus_tag="HG536_0B00760"
                     /inference="similar to AA sequence:RefSeq:NP_010790.3"
                     /note="ancestral locus Anc_1.58"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137890.1"
                     /db_xref="GeneID:59324334"
                     /translation="MAGTFLFTSESVGEGHPDKICDQVSDAILDACLAEDPLSKVACE
                     TAAKTGMIMVFGEITTRAKLDYQKIVRETIKKIGYDSSDKGFDYKTCNVLVAVEQQSP
                     DIAQGLHYEKAIEELGAGDQGIMFGYATDETPEHLPLTILLAHKLNMAMADARRDGSL
                     PWLRPDTKTQVTVEYEDDHGRWIPRRIDTVVVSAQHAEEISTADLRQAIRTEIIEKVI
                     PAELLDENTKYYIQPSGRFVIGGPQGDAGLTGRKIIVDAYGGASAVGGGAFSGKDYSK
                     VDRSAAYAARWVAKSLVEAGLVKRVQVQFSYAIGIAEPLSLHVDTYGTATKSDEEIIE
                     IIKKNFDLRPGVLVRELDLARPIYLPTASYGHFTNQDYPWEKPKKLVL"
     gene            complement(<126996..>127976)
                     /locus_tag="HG536_0B00770"
                     /db_xref="GeneID:59324335"
     mRNA            complement(<126996..>127976)
                     /locus_tag="HG536_0B00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281996.1"
                     /db_xref="GeneID:59324335"
     CDS             complement(126996..127976)
                     /locus_tag="HG536_0B00770"
                     /inference="similar to AA sequence:RefSeq:NP_013282.1"
                     /note="ancestral locus Anc_1.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137891.1"
                     /db_xref="GeneID:59324335"
                     /translation="MVSKAAINRLIATSADFDLTGLQIIGYYLRLYAIKVILGDEVST
                     AEFMDQLSELMRTVEDYKSSVESAEGSQAESSVYTLIRDQEKAKTYILNFAMSLYNGK
                     LKQIQSGPWDYTLQRGLWCCIDLFSCILNLWEDGDGSLQRRIKYCKVYLTKLAKGEMG
                     DTANQDAPAGGLAPVADSPVQEPEDGSSDDEISAMLRRLRTAEKDGSDNGEGTSTADI
                     SLPEAPGTRPGRGDRNDEPAIGEEPKFIDSEAEEEKVPDVVPEKQRKEAASENRRFTQ
                     DQLRSMMEKSTQIEKAQKMAKYAISALNYDDIPTARDELLNALEILNALQ"
     gene            <128155..>130437
                     /locus_tag="HG536_0B00780"
                     /db_xref="GeneID:59324336"
     mRNA            <128155..>130437
                     /locus_tag="HG536_0B00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281997.1"
                     /db_xref="GeneID:59324336"
     CDS             128155..130437
                     /locus_tag="HG536_0B00780"
                     /inference="similar to AA sequence:RefSeq:NP_013283.1"
                     /note="ancestral locus Anc_1.60"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137892.1"
                     /db_xref="GeneID:59324336"
                     /translation="MSVVEATKLIGEKASLTLKKSTETGYFLLRPFLPLLQHCSQLNG
                     DLQFDNVDLGADQLSMEQEDALLSQYGILVDTNDAGEKWITGDKAHELLEMLNLGHLF
                     QDAFSRNKSVDGVAHAENAGLGDQATDPESREDQSNGQGPATESQQYRDTAGNKSIKR
                     VSKDIELAGNSQKGLGSPLKKLRLDSEKNENLEENPDEKALATRPICTFRHDTDHLSE
                     SPVIQRAQAAVFVSDNSQRIKLETFLQRLLFPTAQDMASPSSSNASHSVPFEDLLHEV
                     DLAHSHVPLNLNIPVDERGNTPLHWLASIANLELVKKLVEHGSNRLIGDNIGESALVK
                     AVKSVNNYDSGTFEELLDYLYPCLILEDSMNRTILHHIVITSGMAGCSAAAKYYLDIL
                     MGWIVKKQSRPLTGAGSDKILEALDLKWVINNMLNAVDSNGDTSLNIASRLGNVAIVD
                     ALLDYGADPYVANKSGLRPVDFGAGTTKLHYNGASNLNLENPIADSLSHDQNGTNLPD
                     TMSLIKSMQSLLSTVSQDYNAEVKEYQEKLNKLHKELNAQRELLAASRDRLAHAKQLK
                     DEYILLRDQLNNLKQGIIEEGEKFQKECKNLGLNSEDAAGADWDSSEFDADEPFRVDF
                     IYEILEKKLAAQYNGDIDKLLTAESTDSVLEEVRSQYSAQHDNDKLDSLLPPSVLLKA
                     RINAYKRNDKQLDNAIAEIQQKQQDLEGKFRRVLCLCLKIDEDKVDDMLDGLLQAISS
                     EDPQDVDTDEMHDFLKKHNV"
     gene            complement(<130512..>131993)
                     /locus_tag="HG536_0B00790"
                     /db_xref="GeneID:59324337"
     mRNA            complement(<130512..>131993)
                     /locus_tag="HG536_0B00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281998.1"
                     /db_xref="GeneID:59324337"
     CDS             complement(130512..131993)
                     /locus_tag="HG536_0B00790"
                     /inference="similar to AA sequence:RefSeq:NP_010789.1"
                     /note="ancestral locus Anc_1.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137893.1"
                     /db_xref="GeneID:59324337"
                     /translation="MINTFPPSSPVLGSAAQTDNPFYQPSSDDFQLIEAEQVAGKRRV
                     DQLYHEHQHYPTPVASSSTGRSSSPIRTVEVAPKSGRRSSNKSFPIELDPRGCTRLAI
                     GRKRSVCDIVLPSKKHISRQHAFITYIPQRNEVKLECNGVNGIVVVVPQQLKCRLRKA
                     DTGNSYQLLTDQFDSPDWISDKDIEKLNDITSFVLLKGESVFMPYIDGTIIDFRQAEA
                     HLTLMNLYDETDINSTETEDEALMLLPQDADLCETTTTTTPRKFIKVPQSPPTVQAKA
                     ALHEQEPLDEPIYPPASTTYTTPSTSLLTNTPSTPKKPKKDVKIEDRERQLTPLPILR
                     DAIPILASQPALDKIEEQHKRKQHKPNSNGNRTVAEILLSLEERGIRCKELQHVLANH
                     LAFANVQQTPLCQLQQVNSKTSVLSRCELRALLKDERCIGIIHREGKDAAGKPLDEEY
                     YYDLENDPDAERRNLVTALKGGRSGLRACRRTHKQYFWKKPAK"
     gene            <132477..>132980
                     /locus_tag="HG536_0B00800"
                     /db_xref="GeneID:59324338"
     mRNA            join(<132477..132483,132721..>132980)
                     /locus_tag="HG536_0B00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037281999.1"
                     /db_xref="GeneID:59324338"
     CDS             join(132477..132483,132721..132980)
                     /locus_tag="HG536_0B00800"
                     /inference="similar to AA sequence:RefSeq:NP_010788.1"
                     /note="ancestral locus Anc_1.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137894.1"
                     /db_xref="GeneID:59324338"
                     /translation="MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCASCGYPAAKT
                     RSYNWGAKAKRRKTTGTGRMRYLKTVSRKFKNGFQTGVPKSESA"
     gene            complement(<133037..>135211)
                     /locus_tag="HG536_0B00810"
                     /db_xref="GeneID:59324339"
     mRNA            complement(<133037..>135211)
                     /locus_tag="HG536_0B00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282000.1"
                     /db_xref="GeneID:59324339"
     CDS             complement(133037..135211)
                     /locus_tag="HG536_0B00810"
                     /inference="similar to AA sequence:RefSeq:NP_010787.3"
                     /note="ancestral locus Anc_1.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137895.1"
                     /db_xref="GeneID:59324339"
                     /translation="MSYDDNGILSDDDDDMLLELSTRPPKLTQNQLATQVPNKESYQT
                     SGNISNDVARAQGEVSILRDKLRLLEEERKRDKERQLREEEKLKASHREELARLKVEL
                     QNLEDAKKFLVMEVRKTSASYKPKTAGQSPSAGLSSLTDDTTATENIQVSNKDSADHS
                     SKRRKIVEVADDKKQVKAINRPFNDDSGELFDILMLHRICGVKLRTIQILNCLRLVST
                     KRFSLDGLEISQGESIGEQLTQYLLQCKKAMTLDTFIENLIRVLSALIQEIMVSDGSN
                     LAIPFLLVMVYQIIIFRPSAIRLAVLKHILNFICELIKAFQKSLKRPLHESNTTNDVE
                     PQIFQYEMIELLVTVYSYDILEASIGVLQSNPSSVHGEVLTVPLLNSIGFVYKLALPI
                     SYKPIMSVVFNTVEIINMLAGMVDSSSAKPIQTDPQWWKDCITRLYHMLGKSIDTSDP
                     FNEESPGNFCFSRFHDVYGMVRNIGSNSIGSLISRLIYEDKLQDLPRVILKDDIEDST
                     TFLDNHDVAVNMERWFLLLKTNILNILENIINFYPQETAVANGEMLIQLTRFMSTQQE
                     LMLHRLLGQSSPNLLIRCQLIEYAMALIYRLWMDHPRQITSQHVKEVESELVTSLWRF
                     LAASDSNSDSRDALENQELIDEFGTLTLENRSKYYDDALENAPEYVEEDIRNEMNDQT
                     SKIMQVKYDQVCRQMAQTILETKLDSIISIEGMDSLYVAMGK"
     gene            <135911..>136669
                     /locus_tag="HG536_0B00820"
                     /db_xref="GeneID:59324340"
     mRNA            <135911..>136669
                     /locus_tag="HG536_0B00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282001.1"
                     /db_xref="GeneID:59324340"
     CDS             135911..136669
                     /locus_tag="HG536_0B00820"
                     /inference="similar to AA sequence:RefSeq:NP_013287.1"
                     /note="ancestral locus Anc_1.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137896.1"
                     /db_xref="GeneID:59324340"
                     /translation="MVEDSRVRDANKAGDQKALPASLVPEAPPVLTSKDKTTQRLIVV
                     LSMASLETHKISSSGPGGDKYALLNCDDHQGLLKKMGRDISEARPDITHQCLLTLLDS
                     PINKAGKLQVYIQTSRGVLIEVNPTVRIPRTFKRFSGLMVQLLHKLSIRSVNSEEKLL
                     KVIKNPITDHLPTKCRKITLSFDAPVIRVQDYVEKLDKDESVCVFVGAMARGKDNFAD
                     EYVDEKVGLSNYPLSASVACSKFCHGAEDAWGIL"
     gene            <136958..>138904
                     /locus_tag="HG536_0B00830"
                     /db_xref="GeneID:59324341"
     mRNA            <136958..>138904
                     /locus_tag="HG536_0B00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282002.1"
                     /db_xref="GeneID:59324341"
     CDS             136958..138904
                     /locus_tag="HG536_0B00830"
                     /inference="similar to AA sequence:RefSeq:NP_014120.1"
                     /note="ancestral locus Anc_1.65"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137897.1"
                     /db_xref="GeneID:59324341"
                     /translation="MLKSYLSLRDRLSQAWLNAYTLALLLAVFKLVFFSSSLRNAINQ
                     SETYIVSRCESIDAIYNNGLKNTPHYLGLFGNYLVKEALEQSVKATLKTLSFLVHASE
                     VLLTFSVDLYLGTYACLIVSAIDGSVDVATNATEKIIDLVNSTVSTFANELDDGLDSV
                     SNVIDKIISAASKVESLFKGGNADTVSQNLAKVNLTISSLRDFHIPSSIDDKLQQLSD
                     KTPDFATVKNMTKNLISKPFEEVRSDIDALNTSAIVQNPQMLYVPPLNDVNGTAGICS
                     KNIPSIEKLYGSLDHALMVTTIVCIVLLTLGAVLMLLPAAWSEIRYWNRLKYMEDQFE
                     LIAVQEKDHPPDPFRNTEENPSWDLIAAVNACLQYWSFRISRWIISACGAIRSKGEMT
                     NLQKVRIHWVVSYVTSSRALCVLCVGAIGLLVCVLQLVTIAVLRRTLQHEGGSSMEQM
                     LNSTALSFESDINTWCEETNAYINSTEGNMNDQLFGWLQKTTVSVNDTVTKMMSGIDG
                     TLADVFNGTILYSPMNTVVDCVIGNKLTAVEQAMTWIHDNVQFKLPRLNGSDITTVFQ
                     QQQKNSANSTTSPTPFSAEDIVSELRSALIKILDSFYNTAIWELTVALVILGIWLSQI
                     PIAIAIVLYRSRRLPTNEEQTKPK"
     gene            <139211..>142144
                     /locus_tag="HG536_0B00840"
                     /db_xref="GeneID:59324342"
     mRNA            <139211..>142144
                     /locus_tag="HG536_0B00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282003.1"
                     /db_xref="GeneID:59324342"
     CDS             139211..142144
                     /locus_tag="HG536_0B00840"
                     /inference="similar to AA sequence:RefSeq:NP_013288.1"
                     /note="ancestral locus Anc_1.66"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137898.1"
                     /db_xref="GeneID:59324342"
                     /translation="MKRIFSGAMSPDFPAPPKFFQRDASASDPTSPKSLRSRSSSISK
                     ILGGDSSPKVPPVLPQEMSVTGSVSPELIPIVTLLSAHAHRRYHEGVFLILQDLKGDG
                     TAAARKWQEVYGVLIGTQLALWDAKELAECESGNNNPRLKDVARKPQYINFTDATLRP
                     LDGSDVIVTESKKSLQNALVVSTTLKNRYFLQFSDKESFNRWHAAIRLSLFEETALQE
                     AYTGAFLSSRGAKLGDIKIILSDSKFDYEDWVSVRFGAGMPWKRCFAVISQSTSKKHP
                     FGKISFYESDKKTKKTNVMATVTSSVALYAVYPSSPLLIDTSTIIKLEGSIVFNKKEE
                     PQDSSIFIMPEKHHAVPGYDTIIRFLVPAMNAFKLYGRPKKLIANKDDQNSLLFALPT
                     LPHVHYLKADELLPLTNSVSSLQWTAHEWRDHIRDILQKKLSHGYTGCGSSSGLTGAL
                     ASPVIASAELFDGTGGAASSSFLSLQKPLQGSSISSRSESVSTFTSKSASPRKSKHLP
                     TPSNLNKGSSDSVSATSSSSVKATDKSLTSQSSELNISQDNNVIPQLKVDIPDSNFSR
                     LGGDHAMKNRTNPVEKFSHASDLSAIYDKYSVSPFGESLTESPVAQTINIEDRSPYEQ
                     YVGSTGGRTLEISNIRDSNSTAGTDARNSSGNYHLGKREGLEETKDSEELSNFARRVS
                     EMKIENDMPLRKPAAEATISPIDIDLNFNVPHHHSPGNEGSEDDNVFDPDFMEQNQML
                     ESESIYTSADGKAGEFEAYRNDRNEPYEPKPNQAAQPTQAPAIDLQQTDHRLPHSGPV
                     RNFQQYRGPSASPDPSNGYKNNHRQAPPQQTDINRQNLYQRQAYPDSPHRALVQRGNS
                     PQYSNFPNPGLKNSSSRPLPPQISNKASPQMQSHPRPYVPMHPQSSQQYPTHGGQYSK
                     SQNGPPPQNMNRMGASAPMNPNGGRVGPYLQQAGPVSHHKPRPAPNGGFSQFMPSTST
                     NPYAR"
     gene            <142400..>144472
                     /locus_tag="HG536_0B00850"
                     /db_xref="GeneID:59324343"
     mRNA            <142400..>144472
                     /locus_tag="HG536_0B00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282004.1"
                     /db_xref="GeneID:59324343"
     CDS             142400..144472
                     /locus_tag="HG536_0B00850"
                     /inference="similar to AA sequence:RefSeq:NP_013289.1"
                     /note="ancestral locus Anc_1.67"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137899.1"
                     /db_xref="GeneID:59324343"
                     /translation="MWRRSLVLRSQLSFGLRRNNNICAGNLILKRQWIRPTPLDSSLG
                     AGHQIRVQSTKSNAIEIPSVKNVQKARLSASEANGSGFRDVKRLFRLAKPETLQIILA
                     LVLILISSSVSMTIPTIVGKLLDIAKDKHDEDGTDEEKESPKIFGMSTKQFCIATMGI
                     FVVGAAANAGRVVILKITGERLVARLRTRTMKAALDQDATFLDANRVGDLISRLSADA
                     SIVAKSVTQNVSDGTRAIIQGFVGFGMMGYISWQLTSVMVLMIPPLGIMAVIYGKKIR
                     NLSRQLQTAVGGLTKVAEEQLGATKTIQSYVGEKNEIHRYASEVRNVFNIGLKEALTS
                     GAFFGSTGLVGNTALLALLMVGSNMIQSGSMTVGDLSSFMMYAVYTGSSMFGLSSFYS
                     ELMKGAGAAARVFELKDRRPLIPPTIGVDPVTLRNKPITFDHVSFTYPTRQNHTIFDG
                     LNLTIQPGEHVCFVGPSGSGKSTVASLLLRYYDPDRGAVLIGDQNIQSFNLRKYRRLL
                     GVVQQEPVLFNGTILDNILYSVPPERAHNQDLVSHAIGQANCTKFLANFPDGLQTLVG
                     PRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEVVARALHARVQRGQTT
                     ISIAHRLSTIKHCTRVVVLGRHGSVVESGSFQELARNPQSELNILLSQQHEHSHGPAP
                     LQEPPANN"
     gene            <144751..>146196
                     /locus_tag="HG536_0B00860"
                     /db_xref="GeneID:59324344"
     mRNA            <144751..>146196
                     /locus_tag="HG536_0B00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282005.1"
                     /db_xref="GeneID:59324344"
     CDS             144751..146196
                     /locus_tag="HG536_0B00860"
                     /inference="similar to AA sequence:RefSeq:NP_014122.1"
                     /note="ancestral locus Anc_1.68"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137900.1"
                     /db_xref="GeneID:59324344"
                     /translation="MSGTLQSRRLKEIDVGEIAEINPFVKLVNDQRIVEIPEMVLESE
                     IRITNFPIAYKSWGSLNEKADNCLVVCHALTGSADVADWWGPLLGDGLAFDPSRFFVI
                     CLNSMGSPYGSFSPLCQNEETGRAYGPEFPLCTVRDDVRAHKMVLDSLGVTSIACVVG
                     GSMGGMLALEWATMYGKDYVRNMVALATSARHSAWCISWSEAQRQSIYSDPKYQDGYY
                     SLQDPPTAGLSAARMSALLTYRSRNSFETKFARRTPSAEQENKAGKQSLPPPSTVSEH
                     SMQIHNDGNRSRYEPTRMSVSSSTSSSCSFHSASSITSNCSAVGEVKEVKPAQTYFSA
                     QSYLRYQGSKFVNRFDSNCYISITRKLDTHDLARDRPEYNEDLTQVLHSIMQPSLIIG
                     IKSDGLFTYSEQEFLAENIPNSTLEKIESPEGHDAFLLQFKLINSLIVNFLRKNAEEI
                     MNSPPRLWKEQNQLQTVNESLFGEAEEVTNW"
     gene            complement(<146367..>150071)
                     /locus_tag="HG536_0B00870"
                     /db_xref="GeneID:59324345"
     mRNA            complement(<146367..>150071)
                     /locus_tag="HG536_0B00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282006.1"
                     /db_xref="GeneID:59324345"
     CDS             complement(146367..150071)
                     /locus_tag="HG536_0B00870"
                     /inference="similar to AA sequence:RefSeq:NP_013290.1"
                     /note="ancestral locus Anc_1.69"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137901.1"
                     /db_xref="GeneID:59324345"
                     /translation="MAPTTRGRGPSDSSSRSLSPIGNPGKLRSALSPSRHLPNPISKL
                     GRYAKSRANSISSPTNETSVKKIQDIEDDDLAKSKYMMKSIVGLLTTASMYAGMDDAQ
                     EADELAQHIVPDDEEEEEIGKNKPKGSGGQSDEVAVYKEPGKDQKTKPEKVPLPLSPA
                     VRKPTLFSFSVVPTDDLDSDSTADSSKLTGRRKIITQLLSHFKLDPSETLLKEYFAWL
                     LKDVLVQGKLLITSKHILFFAYLPKSPGTVKLSGNLNIRSTLRASSRYWCVLKDHTLT
                     LYTSPTEVYFPVLTIDLRSVTSVRIDKLSSTDGSQKTFKVSSNERTYVFTADTDYSAR
                     TWCNALKKQQFAEQNSDNDSVSLKIPLANVIDIDDQTIVKQALTVRIRALESTSSYAI
                     DDFHFVFLDGTGFTLMKVVKDQISALSDAGMRILFDNVVIDDQRSRSPTVKSADGSDA
                     DNGARGASPVTKGERFSSHELFIDRALQRPAGSDAKDTGEISWRRRIREISGNWLLAK
                     PPAIDSAEDTVVEYYSKSSSLGANGSPQANLGDQISDDDISEETSRESRRAKLAGWTT
                     KPFKNVAEMWSGHPMHYANDFIPFSEDDPYLVKDKHKLAAIHRFQRHFKLTNDECLIS
                     SSFTYLTRNIPLYGKLYIANSVMCFRTLLPTVNTKMILPLSDIETCYKEKGFRFGYLG
                     LVVVIRGHEELFFEFSTALARDDAEYILLKQLDEFKPKSKLPLVATTNILETDIDNAK
                     LKFFEDKINAEGFEVPLLFDESPFFKTKIKPTRSYKIGILTIGSRGDVQPYIALGKGL
                     IKEGHQVTIITHGEFHSFVTSHGINFEEIAGDPAELMALMVEHESMNVSLLRDASSRF
                     RGWITSLLDTSWVACKSLQLDILIESPSAMAGIHIAEALEIPYFRAFTMPWTRTRAYP
                     HAFIVPDQKRGGNYNYLTHVLFENLFWKGISGQVNKWRLESLGLNRTNLDMLQQGKVP
                     FFYNVSPTVFSPSVDFSEWIKVTGYWFLDEKHTYEPPQELADFINKAKKLNKKLVYIG
                     FGSIVVSNAKEMTKAICKAVTDADVYCILNKGWSERLNDKTCTQVEVPLPECVFNAGN
                     VPHDWLFPQMDAAVHHGGSGTTGATLRAGLPTVVKPFFGDQFFYALRVEDIGAGVALK
                     KLNSSSLAHALKEVTTNKRMLDKAQLIKRQIAVEDGVQTAINCLYGELEYARSLVVSK
                     RRRSKVETTNMGKAQSKADVEKGREGWTLV"
     gene            complement(<150398..>151786)
                     /locus_tag="HG536_0B00880"
                     /db_xref="GeneID:59324346"
     mRNA            complement(<150398..>151786)
                     /locus_tag="HG536_0B00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282007.1"
                     /db_xref="GeneID:59324346"
     CDS             complement(150398..151786)
                     /locus_tag="HG536_0B00880"
                     /inference="similar to AA sequence:RefSeq:NP_010935.1"
                     /note="ancestral locus Anc_1.70"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137902.1"
                     /db_xref="GeneID:59324346"
                     /translation="MTQDSTSSGRNELKKPEASIRFLTFNTWGLKWASKHRKQRLRAI
                     ADELAGISCSVPLTGSDFLYGSSSGEERANDYDVVALQEIWCKEDWDYIAAKCSEAFP
                     YQRIFYSGIIAGPGLAILSKIPIQSTFLYRFPINGRPSAVHRGDWYVGKSVAITLLQP
                     VDHKTHPVAILNSHMHAPYALTGDAAYACHRSCQAWDFSKLANLYKKAGYAVIISGDL
                     NSRPGSLPHKFLTMETGLVDSWEQLNGKQDLQLIARQRPLEQLKYGCTTCDSLLNTWR
                     ASRKPDEACRLDYALIDPERLQTLDAGVRFTGRIPNIGSFSDHFAYTCTLKLLPKRDP
                     VTVDSMSDGRGSRELLFRKFANYEEMIQCIASYRVVAMRQKLFRCLHFYFSILLLIGA
                     LVVTTFTANKAGWSSIFWVLFAIVVSVTGTIDGFISFLFGRKELRALKEVEEEVLCAQ
                     RYLKALLKEKTK"
     gene            <151967..>152665
                     /locus_tag="HG536_0B00890"
                     /db_xref="GeneID:59324347"
     mRNA            <151967..>152665
                     /locus_tag="HG536_0B00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282008.1"
                     /db_xref="GeneID:59324347"
     CDS             151967..152665
                     /locus_tag="HG536_0B00890"
                     /inference="similar to AA sequence:RefSeq:NP_010934.3"
                     /note="ancestral locus Anc_1.71"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137903.1"
                     /db_xref="GeneID:59324347"
                     /translation="MQGKIAQFAELRTRLDDFEKRINDALTQRISSVLEYVQKYRDEV
                     SELQIKHHAISERFTKLQNEEESLEIERYTFRKDAEDTRNKLETYHIRKRQLESQRAE
                     LLQESSELDAMLEHKEQEIREQKEKMIKQRQRDNPELQLYERLLGMHIDASQPGTLHF
                     RFQQFDDKDVARSCDLTLDVSSEDFTILRSNPELDDDDAKKKLLESLNKHGDIATFLV
                     NSRHLLISRALRQQ"
     gene            <152752..>153813
                     /locus_tag="HG536_0B00900"
                     /db_xref="GeneID:59324348"
     mRNA            <152752..>153813
                     /locus_tag="HG536_0B00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282009.1"
                     /db_xref="GeneID:59324348"
     CDS             152752..153813
                     /locus_tag="HG536_0B00900"
                     /inference="similar to AA sequence:RefSeq:NP_009973.1"
                     /note="ancestral locus Anc_1.72"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137904.1"
                     /db_xref="GeneID:59324348"
                     /translation="MRFSVTLLALLATVGSASPGDNLPEFGDCKYACEYQKSCPGSQI
                     NYIDASTNEFSDWRFDQCPLALSTFLFWDCISDCDYQCQQIITKSRIQDGEEILQFHG
                     KWPFLRLFGTQELFSTLFSIGNFVPHYYGFQKLSDKIRRLENRGDTRRLTLLQNYTYV
                     AIAGMLAWSASTIFHLRDLLITEKLDYFFAGGTVLTGFHAIFARMTRLDQHPKVARLF
                     SLSVAFIFALHLLRLYVDWSYTYNMRFNVFFGLLQYLLLLLLAYQNYSSLKAQTYGTQ
                     RRAYDRRASNMFNLCVVPVLLVGSTAMAMSLELFDFFVYSWQIDAHALWHMCTIWPSW
                     VLYSFFLHDFDFAAKANIH"
     gene            <154326..>156011
                     /locus_tag="HG536_0B00910"
                     /db_xref="GeneID:59324349"
     mRNA            <154326..>156011
                     /locus_tag="HG536_0B00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282010.1"
                     /db_xref="GeneID:59324349"
     CDS             154326..156011
                     /locus_tag="HG536_0B00910"
                     /inference="similar to AA sequence:RefSeq:NP_014124.1"
                     /note="ancestral locus Anc_1.73"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137905.1"
                     /db_xref="GeneID:59324349"
                     /translation="MALESLDHDKSSDESLQDLGKTDISPTPLGIDPGGSHQDARKRR
                     RIPIPGAGIWLDLQDKLPVYWQDWKDSWDYRVIPSVLNTYFSNLLPALAFAQDMFDRT
                     NRSYGVNEVLLSSGMAGLVFGILGGQPLCIVGVTGPISIFNYTVYEIIKPLNTNYFGF
                     MFWIYIWAMIFHLIMAFSNSVALLQYVTAFPCDIFGLFINVVYIQKGIQILSRQFNSE
                     EGGEDIPAGFANIVVSLCMVIFGLTFKNIRRTPLLNHTLRTFISDYSMPLSVLFWSAF
                     THFGGYLNDIHFQKLPVTKSFRPTDKTQRDASTWLAYEPIPVKDVFIALPFGIIVTIL
                     FYFDHNVSSLMAQRTFYKLKKTASFHFDFALLGLTTGASGVLGIPAPNGLIPQAPLHT
                     ESLLVYDEEGNVVRCVEQRFTNTVQGLMAIGTMTRPLLVCLGEIPQAVLSGLFFMMGI
                     DGLMNNVIVARVLWLFTENKRKDPDPLGRVPLKKLLIFLAFSLAGFVGEFSITNTVAA
                     IGFPLILLLTVAVRFAFFKIFTKEELANLDHEAAEEFTMKNLLLENLRLVGSN"
     gene            <156726..>157160
                     /locus_tag="HG536_0B00920"
                     /db_xref="GeneID:59324350"
     mRNA            <156726..>157160
                     /locus_tag="HG536_0B00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282011.1"
                     /db_xref="GeneID:59324350"
     CDS             156726..157160
                     /locus_tag="HG536_0B00920"
                     /inference="similar to AA sequence:RefSeq:NP_009972.1"
                     /note="ancestral locus Anc_1.74"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137906.1"
                     /db_xref="GeneID:59324350"
                     /translation="MLSYAAQNPGNRQASSMIPPPVDAVLLHEHAYQDTGDLSYVLSL
                     DTFTDDGGYKPILKYGLGFFNYDLALKNEIYDRSWTEMLRFHIYEHFVPYLIIFLFLF
                     LVWSFVVIVQLNYAGHLMFSEDKKLYKKFEKDNELEYRHIQV"
     gene            complement(<157283..>158335)
                     /locus_tag="HG536_0B00930"
                     /db_xref="GeneID:59324351"
     mRNA            complement(<157283..>158335)
                     /locus_tag="HG536_0B00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282012.1"
                     /db_xref="GeneID:59324351"
     CDS             complement(157283..158335)
                     /locus_tag="HG536_0B00930"
                     /inference="similar to AA sequence:RefSeq:NP_014125.1"
                     /note="ancestral locus Anc_1.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137907.1"
                     /db_xref="GeneID:59324351"
                     /translation="MSVKPVVLRLGKVAYANEAWKNLAKIANVVTIPESTTREQFLEA
                     LKDPQNEVSKTQIITRTFASVKQTGRFDEEIAKSLPSSVVAVCHLGAGYDQIDTKFFS
                     ERKIQVTNVPELVNNATADTHVYLLLGALRNFEYGNRTLLAGKWPSAGAAGGAPVGND
                     PEGKVVGVLGLGGIGRTVVERLKPFGFAKFIYHNRRRLSPELENGCEYVSFDELLAQS
                     DIISVNIPLNGNTRHILNRTAFEKMKDGVVIVNTARGAVIDESALIEALKSGKVRSAG
                     LDVFEDEPHVPQELLDMPQVLGLPHMGTNTFETIKHMEEFIVENVEALIKSGKGLTIV
                     PELQGEPWIEQAKPLV"
     gene            <158923..>163176
                     /locus_tag="HG536_0B00940"
                     /db_xref="GeneID:59324352"
     mRNA            <158923..>163176
                     /locus_tag="HG536_0B00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282013.1"
                     /db_xref="GeneID:59324352"
     CDS             158923..163176
                     /locus_tag="HG536_0B00940"
                     /inference="similar to AA sequence:RefSeq:NP_009971.1"
                     /note="ancestral locus Anc_1.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137908.1"
                     /db_xref="GeneID:59324352"
                     /translation="MSYSRGNTPRATQSLSSHADLGVGLRTFKVAHQRISLDVDLSKH
                     SIKGIADIILIPLVQNLSYVTLDCKEMKIKNVWVENRRCDNYIHDDPLSDFRRSSRSD
                     SDTLYKFNGVEQSHFLREKFADLNEFPEERTRSQLIVKIPSSIKITLQDANSLTNYTP
                     ITPTVRGTPGSQEAVFTPISIRIEYELSEPTTGVRFDTALESQPHLWNAFTTNSEICC
                     TASYWMPCVNTLDEKCTWEVEISVPRRVKDIDGSKVVGNQFQDSRALRSRGSPITGGD
                     LNKERLNVSSEEYNAAKRETELNGKKKNQSKDDEEEEEGYDILEDEEPEEDDTLNKEI
                     FVCCSEYATAKETEHATSTSKRTFAFQIFNPVAPHHVGWAVGAFDIWTLPSIKSQDDI
                     FEDERDESEENKNPNQKDTSAGIDDIENNDVIPIQVYTLPQGDIDEKTVLNSTIICQK
                     IMDFYAKEFGSYPFTSYSLVFLPTLVTSTMDFASMTLCNTRLLYPPEMIDTMLSTTNE
                     LAWSLAAQWSGVNITPLEINHIWCCIGMAGYMVFQLMRKLLGNNEFKFRLKMNCEAIV
                     DQDWEKPPIGNTFTNASRPISWTSNDLSFIKLKAPMVLYILDRRMVKTERSFGMSRVL
                     PKIFLQAMSGDLPNNSLSSAHFQYVCERVNRSKLESFFQQWIYGSGVPIFRVTQRFNK
                     KRMMVEMGIRQCQDQELAQEKVVGKDGFCSSSLDYIQHPNKSMTTCFTGSMTIKIHES
                     DGTPYEHIVEVKDVFTKIDIQYNTKYRKIRNKRLQANKSTNKTMTPDSIEESLEERPD
                     SGSVQKLGTVLSSTEDCLEWNLTGLSTKSDGNEAQIQNEVFEWIRIDSDFEWICKLYV
                     NQPDYMFASQLQQDSDVEAQFESVRYFEDTIIHSPVSSQVYSSILVRTAMDKRYFYGI
                     RAEACKALARYVVRDSEPNNFTGGARHLIRIFRELFCYENSSIPLNNDFSNFQEYFLQ
                     KQIPQNLTLVKNERNETPYFVKQFLLDLLTYNENSENLYDDSHYRCMLIQSVVDCVLS
                     NRNDNEYLNKVLEQLRRYQNLEEWMPTYQLLVKNTILSAKLRLGVAGLYRMEDLNEIL
                     LNPFEDESKTPHVNVARLREGSQDLTLTTFKTLLVEGGLKNKEALKYLFEALCFSTDV
                     YIKEKLVDVFVSAIDFVAVNKLQDLLDDDIDYMVEQINSESLALEDGRRESGGIIEED
                     YMHELRERREQKMRSTVRGLVHLLRRQFRTYEPLKKILWEALHTSTLSLYQRKRLFDT
                     SRILYCLLDSFDVVLTMPRDKKLVAKYMGMNKVVIKREGLLKVHLPTKLSTKLKSSSN
                     ERDSDQPSSRTNKVKISLGRQPVKQKKSGSGTAKGKQAKGIVNRVGILPLRFIKITTS
                     DEKRVDISSVPFSENVHIIKANSRSFTVKIMVPKKEPEA"
     gene            <163343..>165139
                     /locus_tag="HG536_0B00950"
                     /db_xref="GeneID:59324353"
     mRNA            <163343..>165139
                     /locus_tag="HG536_0B00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282014.1"
                     /db_xref="GeneID:59324353"
     CDS             163343..165139
                     /locus_tag="HG536_0B00950"
                     /inference="similar to AA sequence:RefSeq:NP_014797.1"
                     /note="ancestral locus Anc_1.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137909.1"
                     /db_xref="GeneID:59324353"
                     /translation="MVWGWLLLPLLFNFIGKASAAGQRVCPVPDERACFTDELTPFLQ
                     DDMFSTEMLLPRTESTEFIELSSSIPTPIKLNLPTTIHSVAVRMKNSSRPAAIDTNDR
                     NETNGTFISFDQWREAKLKEENIEVRASSSWEAAEGDAIGDGMEVELGFLSSAEDNDS
                     AQIGTQAGKHRFNFASLDCAATIVKTNIEASGASSILIDNKDKYLLNPCFVPNKFVVI
                     ELCQDILVEEVAIANFEFFSSTFKRVRFSVSDRFPVAKNGWIVLSEVEAENTRNLQTF
                     PIPNPQIWARFLLIEILSHHDNEYYCPISLVQVHGKTMMDEFKMDNSRPSGQKPIKEE
                     AIQIQGNPESEAAEECSLWPSIDFDHIMVPSKSSDALKNCTCRLAPLKFEEFLRDLND
                     TYCPAPIKDAIHAPASSTPSATTEESIFKNIVKRLTSLESNATLSILYMEEQGKLLSS
                     SFNNLEKAQIAKFDGLVSMFNDTMMDNLRALRNFANQLKDQSIKILEEQKLNNDEFTT
                     HTSQRLEVLEQKLKGQRNLAYAANCAVVFALFYLFLSREFKYDTKFDNAVERQISESF
                     ERPLPNETPNLESASSLPVSPVSLSGSSITSK"
     gene            complement(<165187..>166716)
                     /locus_tag="HG536_0B00960"
                     /db_xref="GeneID:59324354"
     mRNA            complement(<165187..>166716)
                     /locus_tag="HG536_0B00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282015.1"
                     /db_xref="GeneID:59324354"
     CDS             complement(165187..166716)
                     /locus_tag="HG536_0B00960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137910.1"
                     /db_xref="GeneID:59324354"
                     /translation="MKRRVALDPKLIESERIACNIAIEPFKNEILQYLQDLEQTPTSL
                     LNPVMIDNQPEIRWEMRPYLIDFLIELHLIFRLSQETLFLACFIADKYCSRKIVYKRH
                     YQLLVTASLWIAAKYHEKKTRVPTLKELCHLCNQSYDPAMILQMQRHILITLEWSVGS
                     SVSTFDMVQCLMSSSSDRTIPEDSNFTGLSYFLADLTLYQRDFMLYSSSTKAITAILL
                     ASRILNVGRFPEILGQLMINSSHDNDGCFHIMTDPTANDISLSPSKQSIDDIRACLQL
                     YLNDIFGYKMLNAKESISNTLLRKYKHLPIQNWLSDYRSKTLQLYTQISSFTGSLKFT
                     NLIPYTASGSSLLKEYVRSCLDEIAGFKNISKTDSDQHDSPPSESQVNVSPATPSSSF
                     SSIDLSMSTRWGLPTPTSSRSSFTQFSEHIPNMSFTPGHVKPCTVCPITPASASSLFS
                     TAPRLSITSRSSSFSSLPGVATSSHNIPKDSCPKGPPVNFKRSVSTQDAVPSIYEFTI
                     T"
     gene            <167600..>168763
                     /locus_tag="HG536_0B00970"
                     /db_xref="GeneID:59324355"
     mRNA            <167600..>168763
                     /locus_tag="HG536_0B00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282016.1"
                     /db_xref="GeneID:59324355"
     CDS             167600..168763
                     /locus_tag="HG536_0B00970"
                     /note="ancestral locus Anc_1.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137911.1"
                     /db_xref="GeneID:59324355"
                     /translation="MLRRYLELDSITVMLYVGLGLFVQLSAVMAHSFIVQLAGNTSMS
                     TVISDYSLQVKSGDVEAIALGGRFRALMGEFSADVLRKLHRDPRVAAISIDRWLELQE
                     YVIQGQSPMHLCRLASSSTSVHRPFMFDSHSGGGVDMYLFDTGIDFKHPGLSNVDVRR
                     LDDFSDSSVPEGCDPHGHGTALAGLIASETFGVLKRCDLLDVRVADEQGRVKISNLLR
                     GLGLATAHASKSMKPSVFVIPMVAGVKNYVLRTALEAIPSDIAVVLPAGNQQSEACDF
                     CLLDKRKVANVLVVGSADDKNRIASFSNYGDCVDVYTSGVGVRTLQSTDLNPRSLLTS
                     INGTSASCAIGAGVVGYYMSMGLRSNEAVEKIHQVSEEVSKYPHYCKLLQLKP"
     gene            <169001..>172615
                     /locus_tag="HG536_0B00980"
                     /db_xref="GeneID:59324356"
     mRNA            <169001..>172615
                     /locus_tag="HG536_0B00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282017.1"
                     /db_xref="GeneID:59324356"
     CDS             169001..172615
                     /locus_tag="HG536_0B00980"
                     /inference="similar to AA sequence:RefSeq:NP_014126.1"
                     /note="ancestral locus Anc_1.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137912.1"
                     /db_xref="GeneID:59324356"
                     /translation="MSESEAPHATNEDSSLTVLKARIALLATAIGGPDYTSKLDPPPY
                     KLGDDCLACLRDLKRWFKLVDDQQNRWDVAMACANYRILIDDLLPILIDWENKCYLAA
                     KLSKEDNSNATSVFRNKEYHDSIALNCLQLMVLMTWPLILTEQSPSHQVALYTDLKKH
                     QLSYKKQILLADDGKVLKAANRLAVNVLKINKVDRTPRENMVLRLVLHFFRNILAIEP
                     GELSICAKQKSSSRGISSADMLPPDVSMDDISLNAVISAFHRNKVFGLLLTLSSSPAG
                     EFDQEFINLPVMEVLFFLIKDLDHRVLITARKCKLQGSAEDEYSTAGLQLTQLLEKER
                     RLKKIVVQNTSSRHSRFGALLSIQTHDNVRLTVSGGQNLLDDGSALKKLDNRKKWKKR
                     VSTRQDDVVDKGLPNSLLNSQLKSVHLHSTTLKGFITFLENFIASAFNNVLHRITNHF
                     TTELDQMTILQQVQYLLYYSWFLGYNREQRKLDGSVDATSVSGAVAETTFILVSSLLR
                     KGYDEKNWIVTHAAMIAFNELLLLIGDESFKLSDDADFILPRLFNSERIQLLASLPKS
                     SLRYSLQYMKSCVQLTHTALRTFEAYDNDSKLTISGNGKHERKASFSESDIASLMQSE
                     NLDRDEALELLSSSPKKYTINFEKVQRCYMNEPTIDSYISFLQRFKELDEEDLKRGLS
                     FLHRVLTQSTEESLLFRIDLIVLLRDILSPQGISNASRLRKHFEDLSNYFLHSLKKKL
                     KKSPAWFTGLLFPLLHDSEVGFYQKYCETKVIKKSAFYAVLPSRFKPIESEEELPSSH
                     LLDMHFGILVSSLIDDGKQELVDGVIKHLSTIISDASINLNQNISNNTKSVKELVLDP
                     DTNHDSLYFDKDFRALLARAGYCLPSTIKERCYISDGMEIAELDRNLQIITKYMTTPF
                     ETPNGLPSSSYLIRPKVNRDTGLEEQKEGDGDEPYDYTNPMIVSDSEANMVDDNGYFN
                     DLQGSMMAEFDGREISKGLAKTKKSKNKRRTARSKKTSDADNNKHIRREKVLLSSKEF
                     INDSDDEDFVNPVFFENEMYMRFLIDKHGGQLPDTKYTEFGKFAAERMANNGRTKNDF
                     RNLFDGAIPQISDLRNGDFASTGPDKTLFSLSGLVSAQIEANTTNDGQIVSVESSNTK
                     INENPEKPNSQVSTETRFANDDGSVSETPMTPTEQEDEHEMGHLARKRRRIFVEDDED
                     "
     gene            complement(<172658..>174100)
                     /locus_tag="HG536_0B00990"
                     /db_xref="GeneID:59324357"
     mRNA            complement(<172658..>174100)
                     /locus_tag="HG536_0B00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282018.1"
                     /db_xref="GeneID:59324357"
     CDS             complement(172658..174100)
                     /locus_tag="HG536_0B00990"
                     /inference="similar to AA sequence:RefSeq:NP_010850.1"
                     /note="ancestral locus Anc_1.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137913.1"
                     /db_xref="GeneID:59324357"
                     /translation="MVTSEMPSVKGYSKLNDNEGSLPTELEFELTDFDVEPMRKENTV
                     EPRYNEVEANSNEHSIVTKLIRENEKKSTMRWAFMNMANSILGAGVIGQPFAIRNCGI
                     IGGLMAFIALSFLVDWTLRLIVINLTVASKKTYQDTVEHVMGRKGRYLVLFSNGLFAF
                     GGCVGFCIIIGDTIPQVLRAFLGSSHFLLRRNVIITLVTLFISYPLSLQKNIEALSRA
                     SFLALLSMAMIVFSVIIRGPMVERTLKGSKLTLENIFFTPRIFRGISVISFALVCHHN
                     TSFIFFSMKNRSLQKFSRLTHISVCVSMIFCMVLGYSGYSVFRDATKGNILNNFPEND
                     IMINIARLCFGFNMLTTFPLEIFVLRDVIGALFISQNSTDNVESDSMSAVRHFVITTT
                     CVFSTMSIALTTCNLGALFELIGATTASTMAYILPPYTNLILTKEAKTMRQKTPHYMS
                     IAFGFLIMIVSSTQTITESLRDGEQKHCNF"
     gene            complement(<174171..>176297)
                     /locus_tag="HG536_0B01000"
                     /db_xref="GeneID:59324358"
     mRNA            complement(<174171..>176297)
                     /locus_tag="HG536_0B01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282019.1"
                     /db_xref="GeneID:59324358"
     CDS             complement(174171..176297)
                     /locus_tag="HG536_0B01000"
                     /inference="similar to AA sequence:RefSeq:NP_014127.1"
                     /note="ancestral locus Anc_1.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137914.1"
                     /db_xref="GeneID:59324358"
                     /translation="MEGLSEESERVSVQISSLSTQLIESIEKQSQLEERLNKANRTIQ
                     IQKSIVDQYEEFKLVFDGLERKYNGQTEEIEKLKEELAAEKELRSAAQKTVEELNTEI
                     EDLTASLFNEANKMVATARKEGHALEVENTKLTEQLREKDSILEILNLQVKNLKKILQ
                     NVEEESMAKTAPHVKPSTTDNDKSGSTLLLNRASTSSSSKLHEQLSGPIYSPNIRSIR
                     YDLDLYKEFMKFIAVLPRCETLKEASSSSKLLRRLINDEIQPILRLDNASGLGWIVRR
                     TLMSLMMEGLVVVEPLSGINENFQYGSPTLKSSEFRHANLSNTKDNHLFNFPLDSPPI
                     AVHDKCSFCSEARDDVLEHARMYVLKTQNKLEDGSLVITNSFPLCRYCLLKVRQTCEI
                     FAFLRSLKLGTWNLEKVTLTSVAKDEGRATNGGSRDEGSPRKEGKSSHRLSVIGGTTK
                     TEPQVDTKVELAGSPTSNIQRAWLQLCKLRSALHWTHIGIWSIDDSIGQKIGPLVTPI
                     NEEGDAGDISPIVVGGSNFSLGKADSEDFTIKKGDDGEPTESETFDFEGKNASPATSV
                     HDVELSINKGEADICRPASTNASEERDTTVRRVNDKESSQGLNVRDSNIERSPSTSKL
                     IESTDAENDRSNTSSGDEIGLQQNNFSSFGPQETGHKEPPNDCNGQPETNDEISNDEE
                     AYGDALDNHGLDEVKHVTSAQGQALS"
     gene            complement(<176561..>182275)
                     /locus_tag="HG536_0B01010"
                     /db_xref="GeneID:59324359"
     mRNA            complement(<176561..>182275)
                     /locus_tag="HG536_0B01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282020.1"
                     /db_xref="GeneID:59324359"
     CDS             complement(176561..182275)
                     /locus_tag="HG536_0B01010"
                     /inference="similar to AA sequence:RefSeq:NP_014128.2"
                     /note="ancestral locus Anc_1.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137915.1"
                     /db_xref="GeneID:59324359"
                     /translation="MPRNSQSKNGGGGGSANSTSSSGLLNNLKRLTNSSGGHNGSQHR
                     IETSDITSPKKVSVPSRVSNATDLRPLNKKSTLNMQNLSQYVNGKSSGESIVSGHSRA
                     PSIHSGTKYTYSRRSSAQLSTLAGGSVLTREPTNQSFTSSSLHSQGSQSNLAKFMTSD
                     GKIKLDMPKDHREIETLFEDMMYKRNILQNLSPEKQQDLMDYDVEKKWLIVKQDLQNE
                     LKKVHNNAGGATHASLAFGSIAANSTTHSQSMNHTSPRSSVTYDSSLHASKPSKKNST
                     SSHGSKPGSKSKLNQLSEKASNGSGSTTAKLNLPPIHYVKKIIADKLTNDDMNDLWVT
                     LRTEQLDWVDAFLEHQGHIAMANVLITSIYKTDPNQPLTAEILEKENSFFKCFRVLSV
                     LSQGLYELSRHSIMTDTIANGLFSVRLATRKMATEIMVCMLERRDKARFEAVLNALDK
                     KFKIGENLHMVHYIKSLPQHFIHFTPDSHFKVIQSWLFAVEHTLEGRGKMGSLVGASE
                     DYKASGGENAILEYSQWIMVFMNHFCNGTDVVNQRILLRSRLENAGGLRIMNKFRLLD
                     YDKLTEQIEDYENRKLDDLNSILETNAQDSNINMEDSVALLRQLTDHCKGTENEKLLN
                     SLIKHLFLSSKRLLEEKEDPTKLSKQLKLMDSLMTNVSVSAVDESSSMNMAIQRLYDS
                     MQTDEVARRAILESRTLTKRLEEIEAERDYLNEKLSKAGNGLIGQLEEELKQRDRILD
                     KNQRVTLQLQSELEELKKKHLLEKHEHEVELRKMLTILNSRPNEEINLSGALGTRMSP
                     GTLDPDKKNSIQKALQDGLRKTEKDFSIDSKRFGITVQPNKRLKMLRLRMEDIEQEAR
                     QLEMTNFADHEKKILQAPVQMIKKGDPKIEENITANKLSQLRKALAEIQNESNSISKF
                     NVDERVKELFNNKRLVALQRLRDLEAMYGDYRADSNSEMLFSDPLEANSLDPVENLGL
                     STLDPKAVEAKLAEIDRVTSELTALKTELQTTDLQAKAKLARSLEKLQSISNVASEVP
                     SEKSLTFEGGSFLEALSQKYATGADRRDSSLQSHHEIDIDKKKNNQRRSFVERMKRQN
                     KINPSIAQLSGGLEKQSELETDSAPESLMKEEKVLECPERENDSNLVGAVKETTSEEE
                     MPAILPPVAPPLPEMMSKSKESELSNSPPAPPPPPAFFNSANKISHILSPPPPPPPPP
                     PPNFIFKSEIQVPPPPPLPSSFTPGSSKSSTPPPPPPPPPIGRAAKIDRSTSSSPLVP
                     ESPSPFNSYPRARKKLKQLHWEKLDSTDDSIWSSGKAEKFAGDLYEKGVLADLEKAFA
                     AREIKSLRAKKTDDLDKITFLSRDISQQFGINLHMYSQLPVDEVVRRILKCDKDFLGT
                     PSVIEFLSKPEIIEVTNNQARNFAPYSTDWDGVTSLEDAKPPEKDPAELQRADQIYLQ
                     LIYNLQTYWGSRMRALKVVTSYEREYSELMSKLRKVDKAVAAIQQSANLSNVFNVILA
                     VGNYMNDASKQAHGFKLSTLQRLTFIKDSDNNMTFLNYVEKIVRDNYPSFNDFLLDLQ
                     PVLDVVKISIEQLVHDCDSFSQSVINVQRSVEIGNLSDSSKFHPLDKVLAKVLPVLSE
                     ASKKVELLDEEVKLSLMEFESLMQRYGEDSADKFAKNSFFKKFADFINEYKKAQAQNL
                     KAEEEERLYQKHKKMVEEQQRKAEAKDKSNNDAGEHTSNNAEAEDRREIMDKLLEQLK
                     NAAPAKTDPSSARKRAMIRKKLLSDKDATSNALQFIDNEEDSIIYTPEKNDGKDRRPE
                     EDRPTLTGSPLAKEADESQGDEPIVDRAKALLLGLRGDESPSKRNTTLSGHKEKLRAR
                     RRKTNTEISPNESFSFSEGIRETVSSADTDYSNDTNNLNLTPLKEPNHPEKDRDTATS
                     ETLL"
     gene            complement(<182614..>184410)
                     /locus_tag="HG536_0B01020"
                     /db_xref="GeneID:59324360"
     mRNA            complement(<182614..>184410)
                     /locus_tag="HG536_0B01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282021.1"
                     /db_xref="GeneID:59324360"
     CDS             complement(182614..184410)
                     /locus_tag="HG536_0B01020"
                     /inference="similar to AA sequence:RefSeq:NP_014129.1"
                     /note="ancestral locus Anc_1.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137916.1"
                     /db_xref="GeneID:59324360"
                     /translation="MWKVKRNFHMGEYELEDLAGSKDEYSTSVSSATRLKNSSGSKKY
                     ELNRKSSVKTEVIDQGDEEGQFIGEETNGSAGFDDDYIHEGQVHEAEVKRALKPRHIG
                     MIALGGTIGTGLFIGIATPLANAGPVGALIAYLFMGSLAYAVVQSLGEMATFIPVTSS
                     FTVFSDRFLSPAFGAANGYMYWFSWSVTFALELSVVGQIIEFWTFAVPMAAWISIFWV
                     LLTVMNLFPVKYYGEFEFWIAFMKVLAIVGFIIYCLCMVCGAGITGPVGFRYWRNPGP
                     WGPGIISENKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVIY
                     RILFFYILSLFFIGLLVPYNDPKLSSQESYVASSPFIIAIQNSGTKVLPDIFNAVVLS
                     TIISAGNSDVYVGSRVLFGLSKNKLAPGFLSRTTRHGVPYMAVLFTAAMGALGYMELS
                     TGGASAFNWLLNITGVAGFFAWVLISACHIRFMQVLKHRGISRDDLPYKAKFMPYLAY
                     YALFFMVLIILVQGFTAFAPTFNGVDFVAAYISVFLFVGIWFVYQLWFRCRIIRKLDD
                     IDIDTDRRGIEAVVWEDEGPKTYWDKFWDIVA"
     gene            <185016..>186740
                     /locus_tag="HG536_0B01030"
                     /db_xref="GeneID:59324361"
     mRNA            <185016..>186740
                     /locus_tag="HG536_0B01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282022.1"
                     /db_xref="GeneID:59324361"
     CDS             185016..186740
                     /locus_tag="HG536_0B01030"
                     /inference="similar to AA sequence:RefSeq:NP_014131.1"
                     /note="ancestral locus Anc_1.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137917.1"
                     /db_xref="GeneID:59324361"
                     /translation="MSKLRHLLSSRNWSKDDVSSVVAVEKSKTKDLGSLDPVTNAATL
                     SLLNTEEGDNADDAEEAHYHDTQVKRALKQRHIGMIALGGTIGTGLFVGIATPLTNAG
                     PVGALIAYLFMGSIIYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFN
                     WAITYAVEISVVGQVIQFWTTAVPLAAWISIFWVLVSLMNFFPVRFYGEVEFWVASVK
                     VIAIVGYLIYALVIVCGGSSQGPIGFRYWRHPGPWGAGIIAKSKSEARFLGWVSSLIN
                     AAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIAMFYIMSLFFVGLLVPYNDPRL
                     ASTSAVIASSPFVISIENAGTKVLPHIFNAVVMITILSAANSNVYVGSRVLYALALSG
                     NAPKQFGYVTKHGVPYLGVIATSLLGLLAFLVVNNNANVAFNWLINISTLAGLCAWLF
                     ISLSHIRFMQALKFRGISRNDLPFKAKLMPWGAYYAAFFVTIIIFIQGFQSFAPKFNV
                     SGFFTAYISLIVLAVIFVGCQLYYRCRFLTKIEEVDIDSDRREIECIIWEEEEPKTWW
                     DKFWAAVA"
     gene            <187027..>190143
                     /locus_tag="HG536_0B01040"
                     /db_xref="GeneID:59324362"
     mRNA            <187027..>190143
                     /locus_tag="HG536_0B01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282023.1"
                     /db_xref="GeneID:59324362"
     CDS             187027..190143
                     /locus_tag="HG536_0B01040"
                     /inference="similar to AA sequence:RefSeq:NP_014132.1"
                     /note="ancestral locus Anc_1.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137918.1"
                     /db_xref="GeneID:59324362"
                     /translation="MSKETSPKGNDLKDSITNGKNEVLLKYINSSHLSVYNCIELLCK
                     HADNIGIHYYLCQKLLTFPHAELQFYIPQLVQVLLTVETESMALEELILELKNENPHF
                     ALLTFWQLQALLVDLSTDPESYGFQVARRVLNNLQSTLFNTGKPSDEMKDVKMHENVA
                     PGLVLCSMVISSIGLPQLGQMAKPLVQSQGRRQKAFVFKLAKNAIRDLRKNITLKNTL
                     LNTRRMSKNSKNSDAPVSPVDIVDPVKTKEDALFRKPRKAETNLDFDIVDDVGEQLFQ
                     DRISNSIKMPKRRTKFLDDSYVHRTYDANSLSSSPTKSMNSMGLGPSISSTNLEDGIG
                     LPDKFTSSMPDLHFNQPDKSRTSLSSVDSASNFAPSSSQLVPPNQDYRNFAEIGLEPK
                     GQEIDPSQLSTTAKIKMLKANYFRCETQFAVALETISRRLTQVPTEARFSALRAELSL
                     LNRDLPAEVDIPTLLPPNKKGKLHKLVLITANEAQVLNSAEKVPYLLLIEYLRDEFDF
                     DPSSEENEEILRRKPNAGSLMFDLNDISRPNNRQGDSHQSWNAELQMASELIQGTERV
                     VSGVSLAGSTRSTHSDRSTVVGKEMDLGDLSMIRVKNQTDAEAYRETLVLQNATKVPI
                     IPTDSDHRAPELSFVSNLEDAVIAGKSGTRNFRDRTVELADEMRISALMLAQLDKSPQ
                     GQSETSNQIRAKIIASMKEVQDKFGYRDLEAIHGSAGERKLENDLKTGGIDTSYLGED
                     WASKKERIRKTSEYGHLENWDLCSVIAKSGDDLRQEAFACQLIQAMAQIWIKEKVDVW
                     IKKMKILITSANTGLVETITNAISVHSIKKSLTKKMIEDGDLDEKGGIASLKDHFVRA
                     FGDPQGFKYRRAQDNFACSLAAYSIIGYILQIKDRHNGNIMIDNEGHVVHIDFGFMLS
                     NSPGSVGFEAAPFKLTYEYIELLGGIEGEPFKKFVRLLKDAFMALRRHSEQLISMCEV
                     MQKDNLQPCFNAGENTSVQLKQRFHLELSDAECDDFVENYLVNKSLGSIYTRLYDQFQ
                     LITQGIYS"
     gene            <190415..>191584
                     /locus_tag="HG536_0B01050"
                     /db_xref="GeneID:59324363"
     mRNA            <190415..>191584
                     /locus_tag="HG536_0B01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282024.1"
                     /db_xref="GeneID:59324363"
     CDS             190415..191584
                     /locus_tag="HG536_0B01050"
                     /inference="similar to AA sequence:RefSeq:NP_011560.3"
                     /note="ancestral locus Anc_1.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137919.1"
                     /db_xref="GeneID:59324363"
                     /translation="MLQVRNSNARLIAARGLRLATGPRLSARHQSSLTKKDHEAYAEE
                     KNILMRGAIAENSESSKTSKQMLDDDLSLLERGIKRSDEMTSKFTDYLYKFHRLPADY
                     GSNQLLTVVAELQQELQGILTSFKAPVKYAFGYGSGVFQQNGYHKEDTKPQIDLIFGV
                     DHPAHFHSLNMRQNPHHYSSLRYFGSTFVSKFQEIGAGVYFNPFAEINGHQVKYGVIS
                     MENLLKDLATWNTFYIAGRMQKPVKILKNDLRAQYWNQLNLKAAATIAKHMTLKKNNG
                     KFDELQFYKEIAGLSYLGDIRYDLGGEHPNKVNNIVSKNFENFQHYYKPIYKDVVLNN
                     SHYLPQGFTPENAGNLLQSRIAKSSVTQTLKGIFTAGVTKSVKYAWAKKSKTFRN"
     gene            complement(<191716..>192522)
                     /locus_tag="HG536_0B01060"
                     /db_xref="GeneID:59324364"
     mRNA            complement(<191716..>192522)
                     /locus_tag="HG536_0B01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282025.1"
                     /db_xref="GeneID:59324364"
     CDS             complement(191716..192522)
                     /locus_tag="HG536_0B01060"
                     /inference="similar to AA sequence:RefSeq:NP_014134.1"
                     /note="ancestral locus Anc_1.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137920.1"
                     /db_xref="GeneID:59324364"
                     /translation="MCIQRLRFAQEKQQALAKQDRRDVAKLLADGKEQKAHYRVESLI
                     NDDIHNELLELLELYCELLHARVSILVSIQDEEILISEHMNDGINEAVRSIVYATVHC
                     PEVKELTQMKELLALKFGQEFLSLIVEDRVGVPEKVLRKCSPTLPSQDLVTLYLKEIA
                     RTYAVTFSELEQEETEEESSDGGSKAVDSGKAGKEDEKKPIVAVDNDERFTEDAEHPI
                     SVRKPKKNSETVENDLKIPKAIKKDVKIIRKKPEEDNLDELRKRFAALRR"
     gene            complement(<192857..>195952)
                     /locus_tag="HG536_0B01070"
                     /db_xref="GeneID:59324365"
     mRNA            complement(<192857..>195952)
                     /locus_tag="HG536_0B01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282026.1"
                     /db_xref="GeneID:59324365"
     CDS             complement(192857..195952)
                     /locus_tag="HG536_0B01070"
                     /inference="similar to AA sequence:RefSeq:NP_011561.3"
                     /note="ancestral locus Anc_1.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137921.1"
                     /db_xref="GeneID:59324365"
                     /translation="MASERQEEGLNAAGGLDEPRSDQEVEDVEDENIYNVDELKMLIG
                     SDESEREVSGNDSEEAISENEDYASEADSLLAEFSDYGEMSEDDEQDFMDAIREANNF
                     KVRRRRKDKDGKSSRGPAARVLDPEVSLLLSQANEAFVRNDLAVAERLYNEVIKKDAR
                     NFAAYETLGEIYQLEGRLNDCCNSWFLAAHLNSSDWSFWKIVAILSADLGHIRQAIYC
                     YSRVINMNHEEWECVYRRSLLYKEVGQIGRALEGFQKLHVRNPLDGSILRELAVLYVE
                     YNRINDAIDIYMKIFEKNVERREAIVAASENALDSSEEESQEDEKEEQASPDAVEDEG
                     LSEEMKLYPNVNWKKIRSKYKCIIFDWSSLNILAELFLKLTGGEASGIKAIKRCARWI
                     ENRENQVFWNEVNDDSEFDNRRFKNSKFDSLKESEKRKSYDLPIDIRIRLGLLRLQND
                     NVVEALNHFQFLYDENFSDISDLYFEVALALQKAEKYKEAIDFFTPLLAVEEYCTLEL
                     FKPLAKCYKEIEDYAMAEKYYSKIIELEPDDLDNKLVLAEINYHLGNTEVFSKLLAEA
                     INLRKSQANQGLLHDENKERSSEPRDTSGKPLLEDSLFRRSGPRKKRTPQDAERERQE
                     REKRITAKVLDKYSKLAIYKSGMHHGDKSQRFLWIDTASDLVDVFSSVKNFFVKSKSK
                     KFVGIFRKTRKFNKVIDYKIERLSKLSEGDNLLNGLPLMEERVTLTSATELRGLTYDQ
                     WFELFMELALNLARYQNVEDGLSVIETAQDVNVFFQDPERAKIMKFVKLAIALRTKDD
                     EALIENLRNLLNQFQFNRKVLQLFLFSLIRGQKSLDILSSTVHQKFFLRQLKAFDSIR
                     YGKSVSGQASVTNKIVSNPEKRNSPYLYYIYAVLLYSSRGFLSALQYLVRLEQDIPDD
                     PMVNLLMGLSHLHRSMQRLTASRHFQILHGLRYMYRYYDIRSSSYSILEKQEADYNMG
                     RAFHLLGLVSIAVQYYDKVLNDYDDDKLKKHAAYNCMIIYQESGNTRLANHVMEKYLS
                     I"
     gene            <196192..>197265
                     /locus_tag="HG536_0B01080"
                     /db_xref="GeneID:59324366"
     mRNA            <196192..>197265
                     /locus_tag="HG536_0B01080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282027.1"
                     /db_xref="GeneID:59324366"
     CDS             196192..197265
                     /locus_tag="HG536_0B01080"
                     /inference="similar to AA sequence:RefSeq:NP_011562.1"
                     /note="ancestral locus Anc_1.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137922.1"
                     /db_xref="GeneID:59324366"
                     /translation="MFSGFGAFGSGYVNLPQKFEDFFRCYPVAMMNDRIRKGDANFGG
                     KIFLPPSALSKLTMLNIRYPMLFELTANENGRVTHCGVLEFIAEEGRAYLPQWMLETL
                     KVQPGSLLKIGSTDVPLGKFVKLEPQSVDFLDISDPKAVLENVLRKFSTLTVDDIIEI
                     NYNDRSYRIKILEVKPESASKSICVIETDLVTDFAPPVGYVEPDYQALQQKQLEERQM
                     LKKSGKFDVSAHQNGSMAKRIDYASKLKESKLGKSKFTGEGQKLSGKTGSKETSAVSL
                     SEINISLEGEPAKLSLPDGQLFFGFPIVLPRSAADGESPSSENVFRGEGQSLRKSNKR
                     KGKSDHSSAKSKTPRSPDVIEID"
     gene            complement(<197370..>200963)
                     /locus_tag="HG536_0B01090"
                     /db_xref="GeneID:59324367"
     mRNA            complement(<197370..>200963)
                     /locus_tag="HG536_0B01090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282028.1"
                     /db_xref="GeneID:59324367"
     CDS             complement(197370..200963)
                     /locus_tag="HG536_0B01090"
                     /inference="similar to AA sequence:RefSeq:NP_011375.1"
                     /note="ancestral locus Anc_1.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137923.1"
                     /db_xref="GeneID:59324367"
                     /translation="MMASRATVGRIKKFVRWWQHHFPCDRILAQRITKSTVNSTVAFI
                     FCLIPKVRDHLGTEPAMLPLISVMVHPGRRVSGTIQGAIYCMTGLVFGLAYAIFGRFL
                     AQRCLGSTWNTLSEPEQYAMHYERLQAALAILAVFETLMLFFHGWMRSVSHHYFGIVF
                     PLFLVVHFTFMAPLTESSGVIAQSFSSPFYLGIAMSIFWNLTLFPEFGSTFLGNATID
                     TLNEVHKAIDESVRFFVSMDNRENDDLYNGPPITLSKLVKMKSTISKKVGNCLLVLDE
                     CIYEISYSYLSPLQLKPIIDLLKPLNMYINGLVNACQLEFILLGSQQNIEGDTMDIDT
                     NKEILYADAAKLLKILERMKQPVYELHRYMSECIYISKLILSYAYDVDLGRVDTNGMF
                     ADMNLPTYNHREELPEDFNVDEHINKLTAALVEFDVTFREEMIHLDIDLLNPNDEMFL
                     LSSFLMNFKQSTQSVISILEHVKNIYSTRKAREEKGWIRGKSLWSTFLSDKRSFKIWL
                     KGGRPTSNVITENESLKGTFDYDQYNALGGLAVRRPSNEEDDLLGQKRSTAAASSNNQ
                     DSKQLPVSTRDIGDSSLPATKANKKIGYKYLSYYLTMFLISADKFYRKSKAHFRFGFQ
                     VAIALMLASFPMFVPKIRHWYVEYRGTWIGFVCILCLEPSVGGTFWVFFLRAVGVISG
                     SAWAYLSYVAGVNQTNPYLETIVTIFGAVPGFYFLLGTPYVKAAIIQIISIYIVMLAA
                     ILPSSNKGGILVSFAKRCLAVGYGGLIALVVQLTFFPIKARDQLNEEIAFVCGCISEM
                     ELLYASGLEGESLKISMTDDRYQKFNRISQSAKSALGRAEAYKGLTRQEPRLKGEYTE
                     LENVFSQIIFVQRQILDRMDNVALLRKQYGSGVIEELNSVVYPYRRQMVASLSNCMRA
                     IQEAFLNKTPLPQFLPSARVAHRRLINMVSRALHNRYRNQLEALKPRVVVDKFRDDES
                     SDVEEGLMMKTKNNRDRSRNTLPPHEYALKEKFLSWNASSAATEEVIEYVEELLDLTK
                     ILVGINEFKYGFLSRPLYEDWAAEAVVGFNNFVKAGVSKKSVSENESGDVNSAISEEE
                     EISSGSSTSRAEGEQPVAFNSKYTENNGINLARIASHKIGQDNQGLPINLKNRTYSIG
                     SYPDSVNQLSALSRKKTLGDADSNYFDGEDTSDDELPLALKKIVSHKSRKQ"
     gene            complement(<201272..>202144)
                     /locus_tag="HG536_0B01100"
                     /db_xref="GeneID:59324368"
     mRNA            complement(<201272..>202144)
                     /locus_tag="HG536_0B01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282029.1"
                     /db_xref="GeneID:59324368"
     CDS             complement(201272..202144)
                     /locus_tag="HG536_0B01100"
                     /inference="similar to AA sequence:RefSeq:NP_011387.2"
                     /note="ancestral locus Anc_1.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137924.1"
                     /db_xref="GeneID:59324368"
                     /translation="MSLNLNSVFSEKINLYDELEIPVTEGPELVPSSLIKKQYRKLAL
                     LYHPDKRPDDPGAIHKFHMLSLATHVLTDEALRATYDEWLQRTLLDGSKVDEQRNELI
                     TKLSKLESKARKDETAGQARDLTKIQEYGAMLRKMKHFRIPYGDWRTLNPAALAAEHR
                     TDKHRFYDSSTLRIELRNDLLDAKLSEKSVLCRILSDLFQVKRLYDLFYSSRNDYEHD
                     KSIVAYAVFETTTDSKQVYETWKASPRSPHWGELVLDISPRIPVSYYKNYEKEVELDQ
                     HIADLVANSTIVID"
     gene            complement(<202306..>203241)
                     /locus_tag="HG536_0B01110"
                     /db_xref="GeneID:59324369"
     mRNA            complement(<202306..>203241)
                     /locus_tag="HG536_0B01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282030.1"
                     /db_xref="GeneID:59324369"
     CDS             complement(202306..203241)
                     /locus_tag="HG536_0B01110"
                     /inference="similar to AA sequence:RefSeq:NP_014136.1"
                     /note="ancestral locus Anc_1.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137925.1"
                     /db_xref="GeneID:59324369"
                     /translation="MSYNPYAYTSNDVSINDRFSHETGGQFASSRERPIMQEAAPQGH
                     FASNSRPAQQDGIPFQNPTTSMAYQLGQSAFTNFIGQQNFSQFQETVTKAAGSSSSLS
                     HYFQVTTSYVLRKLQIIVLPFFKKASWQRIPDTQSQASGSLSFLPPKDDVNSPDLYIP
                     IMGLVTYILVWNMQKGLQGSFNPENLYYKLSSTLAFVGLDLVILKLGLYLLVNVNSPT
                     SSLTELVCYVGYKFVPLTLVLFSPNRPLYISMAAKVYLFIAFGVFLLRSVKFNLFMNA
                     NNDMANIKKSTVRKCNYFLFVYGFFWQSVLMWLMA"
     gene            <203620..>210252
                     /locus_tag="HG536_0B01120"
                     /db_xref="GeneID:59324370"
     mRNA            <203620..>210252
                     /locus_tag="HG536_0B01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282031.1"
                     /db_xref="GeneID:59324370"
     CDS             203620..210252
                     /locus_tag="HG536_0B01120"
                     /inference="similar to AA sequence:RefSeq:NP_014137.1"
                     /note="ancestral locus Anc_1.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137926.1"
                     /db_xref="GeneID:59324370"
                     /translation="MSSWSKGSNTARVVKNGWSNGVNSTANSLAVTANQMMQAGKIDE
                     IDSMMGFERYFPPQYTGRRDPGKLDQVPGRVGWLTNMHATLLSPVSMPGASASEPLGI
                     AGVDFYFLDEEGGSFKSSITYDPYFFIKCSDVSRANDVEEFIKKYLDSCLKGVSVVEK
                     EDLSLDNHLMGLKSTLIKLTFINSNKLFEARKLLRPILTFNENNNAQKQLYSAQGAGN
                     SLKDAKSLIEDIREYDVPYHVRVSIDKNIRVGKWYKITSDGLHEITEKVAFADPVVLA
                     FDIETTKAPLKFPDSAVDQIMMISYMIDGDGFLITNREIISEDIEDFEYSPKPEYPGL
                     FTIFNESDELALLQRFFEHIRDVRPTVIATFNGDFFDWPFIDNRSKIHGLDMFEEIGF
                     SPDSDGEYKSSYCSHMDCFRWVKRDSYLPQGSQGLKAVTQVKLGYNPIELDPELMTPY
                     AFEKPQQLSEYSVSDAVATYYLYMKYVHPFIFSLCTIIPLNPDEVLRKGTGTLCEMLL
                     MVQAYNGNIILPNKYTDPVERFYDGHLLESETYVGGHVESLEAGVFRSDIATDFQIDA
                     DAIDELLSDLPHALRFCIEVENKSKLEDVTNFQEIKEVITSQLLDLKLNSKRCELPLI
                     YHVDVASMYPNIMTTNRLQPDSMKTERDCASCDFNRPGKLCDRRLKWSWRGEFFPAKM
                     DEYNMVKRALQNETFLNKRKFSKKKYLTFDELSYAEQVSHIKKRLTDYSRKVYHRVKV
                     SEVVERESIVCQRENPFYVNTVRSFRDRRYEFKGLAKTWKGKLSSIPSADKHAKDEAR
                     KMIVLYDSLQLAHKVILNSFYGYVMRKGSRWYSMEMAGITCLTGATIIQMARALVERL
                     GRPLELDTDGIWCILPKSFPENFSFTLKNGKRLFLSYPCSMLNYRVHQKFTNTQYQEI
                     IDPVKHKYQTHSENSIFFEVDGPYRAMILPTSKEEGKGIKKRYAVFNEDGSLAELKGF
                     ELKRRGELQLIKNFQGDLFKVFLQGDNLQGCYSAVADVANRWLDILDSRGSMLEDEDL
                     IELICENRSMSKTLKEYEGQKSTSITTAKRLGEFLGEDMVKDKGLQCKYIISSLPAGS
                     PVTERAIPVAIFSADITVKRSFLRRWTLDSSLEDFDPRTIIDWLYYRERIASVIQKII
                     TIPAALQNISNPVPRVEHPPWLKKRLAIKDDKFKQGSLNRFLTKALKPHVSGQVQDIE
                     DLFDDKSQPQLRTLKTAKVSVSDKRSKRKRSQKNEEEALVLPSTMPSLDEDYVTWLQY
                     QKIKWKIQRRDRMRRTQLFGDMNSSAGRSALGGMMRKQAETYANSTWEILQYKPSTQP
                     GILNVFVSIQGQVQILKFRIPKTIYVNFKSIPNLTLEHLVMEPCNATIPNSSRLMQGT
                     CNNLYKCTMPESVYYDAVQKESNPFTDANVIAVFESTIRATERAILELGSSVIFRSNV
                     MGSLGKGLQNGFEMKNLSMSDTQRYLSRFSLPVVYLLHIHSSIGYEFFCLVKSWSKII
                     TLHVLKPSSTANELSLGLMQQIYAEAYQHKKSYVDKFSRFMALDENMTFEVQSFDDLS
                     KLHNKLSSNVSKLKEEKGLQFLLILHSPYPLKLRKKIKLLDQVPVLQLSMNEMNLPQL
                     QWQPILAKKMVSHFLSCGAWLSHLVTISQFSSIPLCNLKLDNAGYVIDILYARQLKQD
                     GFILWWNENDPLPDHGGVQKDFDLNTLSLMTDVAFQNVNIPSIFDHVVLEVGVGNLTV
                     NAVLASALINEAEGGESMGTDGASFSNGADRSTSEPFVKDAFSVGSLMILRNLLKEWW
                     DGALTGNTTSDLLINSFVTWIQNPDSKLFDASLRYHIHNLTKKSLLQLMSEFQNLGSN
                     VTYADRNKILVKTPKLTPETCYAYGQYIVKAVRKNLVFTYLDLRIEKYWDLLIWMDKH
                     NFGGLACAQIQEKETQDIRAFSKWQMKDFLPPIYQSEFDDWMMIILDSLAKTKKSYLE
                     ANNSTQRPTQILSGKVKKIDMDEDEGDGPLAGFTSFFFEPLLNRVQKLYRNEKAFILD
                     PKYAAEYAFPFLPGSFIKMKAPLLELVKYLCHLMSLSKANILEVRQLRKELLKIFEVR
                     EFDKRAEFRNPSASLLINGFLCESCFYTIDIDFCRDNPSTLFKCPNCHKELNRVLLQE
                     HLIQSIYVEVESYLTQDLKCSRCHKVKQDNMSEYCACSGSWVGSISKDMLIDKILVFQ
                     QVSEYYSLDLVLSALADISM"
     gene            <210371..>211792
                     /locus_tag="HG536_0B01130"
                     /db_xref="GeneID:59324371"
     mRNA            <210371..>211792
                     /locus_tag="HG536_0B01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282032.1"
                     /db_xref="GeneID:59324371"
     CDS             210371..211792
                     /locus_tag="HG536_0B01130"
                     /inference="similar to AA sequence:RefSeq:NP_014138.1"
                     /note="ancestral locus Anc_1.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137927.1"
                     /db_xref="GeneID:59324371"
                     /translation="MSGSLNDVLFRDYQINTLSAFLHRDPSITPPNLVIQGHSSTGKT
                     FALKRFFETNQELVNAWLEPIELVTWKPLMQAVLRTVQNGLRSLYPEVSIQESDPLDV
                     EETYLLVKLLTNLLSQYDSLLQEELSFFLVFDGLDQLNDLDAVLFRKLIKLHELLPAS
                     SKIQLKFVYTIQDMAFVERYSSHCLPVVVFPRYTTKEVTEILIATRADDLIMSDALRE
                     KVLKEGITECTDEQFLGVAINFIQLIVQSFHSYTGNNIAALNDLIDFKWDSFVDKVIK
                     ENIFEPLALYRAANKVFSSTGDTFSPEDSESAEITNEVALSYELSAISKYLLIAAYIC
                     SYLEPRYDSNVFSKKSHIKTGRASYGRRKKIETNPRFLQPSIFPLERLLAVFQAIFPV
                     ERKAQSGSLALLKEEPLMRANVEVFQNLAELHTLKLVSTTVARNIDFLNYKVKWKVNV
                     PWEIINEIGRSVDFDVGQYFGGQ"
     gene            <212000..>213022
                     /locus_tag="HG536_0B01140"
                     /db_xref="GeneID:59324372"
     mRNA            <212000..>213022
                     /locus_tag="HG536_0B01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282033.1"
                     /db_xref="GeneID:59324372"
     CDS             212000..213022
                     /locus_tag="HG536_0B01140"
                     /inference="similar to AA sequence:RefSeq:NP_012026.1"
                     /note="ancestral locus Anc_1.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137928.1"
                     /db_xref="GeneID:59324372"
                     /translation="MLHNGSKPARIEQETIKEDVSLEYADYEQAPEPLRKRRKISLTG
                     YESDSSDEEDSDIETVSKSDGKQKASEYAIEDDMFAADEVDQASRNAGNDEEYDHDQY
                     DEDTIDDSPETHLPDDGDFQVEAFNLVEEREKGYLDEAGNYIPTKDHDEDAMQDQDLW
                     INDFKDVQKAAASQKHAESSRRMENRKVQQSSRHYMIDEALLRFYFFLSCDGTIVDTL
                     AKLNKRRETGCQYVLNSINYISDLINSLEQKGLEDVYLLKRANVAALYKEECLSDSAV
                     IDDYKSLIWSFSWSKKPSVVHGPYTNYQMQRWKSSYFKDNVAVRFHDDADKPENWLDL
                     NSVTFM"
     gene            complement(<213030..>213518)
                     /locus_tag="HG536_0B01150"
                     /db_xref="GeneID:59324373"
     mRNA            complement(<213030..>213518)
                     /locus_tag="HG536_0B01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282034.1"
                     /db_xref="GeneID:59324373"
     CDS             complement(213030..213518)
                     /locus_tag="HG536_0B01150"
                     /inference="similar to AA sequence:RefSeq:NP_014139.1"
                     /note="ancestral locus Anc_1.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137929.1"
                     /db_xref="GeneID:59324373"
                     /translation="MDTDYLLNLEQQFYQEGYEQGSGEKARENYIEGKQFGLQVGFQR
                     FVILGQIQGILEVLKSSLVDGSNILKNVESIDRLLAEIEMSNDDAAVAEYESRIVKVR
                     NKLRNVLLSLHRQSGSASGDSLTLEDVEEACTKVAGQLKAYVDEGNEEEDVNGQDHAM
                     EW"
     gene            complement(<213673..>213894)
                     /locus_tag="HG536_0B01160"
                     /db_xref="GeneID:59324374"
     mRNA            complement(<213673..>213894)
                     /locus_tag="HG536_0B01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282035.1"
                     /db_xref="GeneID:59324374"
     CDS             complement(213673..213894)
                     /locus_tag="HG536_0B01160"
                     /inference="similar to AA sequence:RefSeq:NP_014140.1"
                     /note="ancestral locus Anc_1.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137930.1"
                     /db_xref="GeneID:59324374"
                     /translation="MSQQNHYQFIVVMTCSGCSNAINRVLSRLEPEVSKIDISLENQT
                     VDVFTSLPYDVILDKIKKTGKEVRSGKQL"
     gene            complement(<214099..>216345)
                     /locus_tag="HG536_0B01170"
                     /db_xref="GeneID:59324375"
     mRNA            complement(<214099..>216345)
                     /locus_tag="HG536_0B01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282036.1"
                     /db_xref="GeneID:59324375"
     CDS             complement(214099..216345)
                     /locus_tag="HG536_0B01170"
                     /inference="similar to AA sequence:RefSeq:NP_014141.1"
                     /note="ancestral locus Anc_1.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137931.1"
                     /db_xref="GeneID:59324375"
                     /translation="MNVGLTSVGDEIGSILGNRDEIARQLGNDPLFRNNEHGESSDIG
                     TEAILRREKELSSELHDFTALKTVPGLILEFKTNLRLLELENCFYSLQALRRKLHANF
                     AIINRSFGLQRSVATYVDNMHLDLVNTLFATLKDGFWKISADAIDFQSTVAHGEDQVQ
                     VQYADLMESVENLYFPSGQLDPKLWIISDMVLGTLQETLRDKLNTILNEHVKLSGIII
                     AIKSSLFAENKQFVLTNNNSKLLFENSMKIGDEKVEETANSFKSLLLFMRETVVLRDR
                     KILAQKLGSLIATELAEFIKANSSVVFRPENAQLRFIIEGVNEDLVKLSTETNSWSYD
                     GAAINDLFNNDQIPRNLQIDKVFHDQVTELRVFFADKAWQRLEVVASAAAPLSPAQSP
                     ARRKRLPSSSKRSINSDWGWEEKTGWDEHMDLDLGEKHSASEVASTESRKDTASDAAD
                     DAWDEAWNIEIEDDESEKQKSADNDLDDSEVRVTQLPAKITALVRDFDEGCHGSGQEI
                     DESYYKHKLNVLQTTIMAIASRQYRNNWWQLHIDLKQIIQLNPCLTRLQELTVNNLDL
                     YLNTSESVVYKLVCQQLNELKQNERYCSWNVTVDQLLPFVKTKILEPLVMIGNNDSQR
                     PLCSFLRFLYEECVIKNILQWQIISERSSENLSEFVSLLYSGTEISALNGNKSYRECR
                     EKFAIIGKFLPLHLKDIMEMFYNGDFYLFTTDELVRWIVLLFAETPLRRNAIDDIYEI
                     RNADVGED"
     gene            complement(<216898..>220566)
                     /locus_tag="HG536_0B01180"
                     /db_xref="GeneID:59324376"
     mRNA            complement(<216898..>220566)
                     /locus_tag="HG536_0B01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282037.1"
                     /db_xref="GeneID:59324376"
     CDS             complement(216898..220566)
                     /locus_tag="HG536_0B01180"
                     /inference="similar to AA sequence:RefSeq:NP_012025.1"
                     /note="ancestral locus Anc_1.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137932.1"
                     /db_xref="GeneID:59324376"
                     /translation="MEQKEKDKDAEWKRLKLISVAFKEASLDTPSFRASVNTFQFKLE
                     AFEDWIDKSVAFFQNRYTPSFENFQRAQQTFLSQLLPSPLILFNGFVANQTTTPMMVE
                     AFNNEYFEFASRILKIIAYHDTSYPDAVLELMNNDLEPYKAKRAEFEYCQGKFDAALA
                     KYCAIKVSNTNIEPVNIKDEALDLFEIRKSYLKASLELMAAISTLQVGLDKFLMRAVS
                     LISEKNSFLLKEAGKRIDLAMSLTESVAAYSEWVTNAVEASELLQEDMERAKQQVIEY
                     TLGQVTPSRELSDYNVKAINSSKLLANKSSPVLEAPEISGWLYMKTTVGTPSRQIWVR
                     RWCFLSSSVFGLLLLSPSKTYVEETDKFGVLLIDVRYDPDEDRKFCFEVKIRGRTPEM
                     SGDKQTRIVFQAESLKELKQWLLAFETAKRYAAKLDSNDPQYKHACRRISPAYFEFAS
                     STTTTTDQLITTYDENSLNLIETLNKKLPNLDLASIPGRNGFQYELALTPMSTKLTQL
                     AIFGSSIKQNTYLPSALLANIWGSTNWSDYATFKKAQKRCRDNEIKDKPHSDLDLLSN
                     YPSFYSEKMIINDLQFKSLFFSIDQNLAKFPQDLLLFSFSSFWCPNKRQKFCATIYVT
                     LDHIFCYMNSMGFICLTCRNLSDIASVELDPGSDHSLKLYGVDGNQLRLAVFFTDRRL
                     IANKLQCLLENIALANPKNEEQILKQLDGIESDFQSTLKDEKLRKIRSALGQDIAHSP
                     REAASGLYPTNTFWSMSATAAELLHRRRGFQSQSTAMYHHVYEIPCKGLMHILFGDQS
                     SAFPRCLFLSSNDGSSNISRPWIKHDETDGERMQLQRILQFRLNLTNNFLNGLHTGGP
                     PTILMKQSIVELIENKYCEVDQEPIIIKVPFCHPLRMKVKYVVTEPYESSTQNTLHST
                     SGSLLLAYYKLEFFESTTEKVVEHLSFIEKAVFRIALQATNKEFLLIRKVIRYYLERI
                     GKHGKVIRAIKLCGMLGVSQEKVEAEAVGGTDVHKPPVVNYSISIIFKLLMKLLVYKI
                     TSLALLLIRLIFGSILVAVTNLTHINKNLLFGLIASILINVLLSGKSSFAYWSARRSD
                     NLFQDYMQGKREILVRRAVSIKDLELLSQNLAFERNNLPFQKFNETYSAENHKFTQTR
                     LEVAQRRNELLVELKILQNMEKELLQTNYRSFLLSEIDKCHAIEKEICVVWEQDAKLR
                     DYCSSCREELYKLTDPLL"
     gene            complement(<221539..>222714)
                     /locus_tag="HG536_0B01190"
                     /db_xref="GeneID:59324377"
     mRNA            complement(<221539..>222714)
                     /locus_tag="HG536_0B01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282038.1"
                     /db_xref="GeneID:59324377"
     CDS             complement(221539..222714)
                     /locus_tag="HG536_0B01190"
                     /inference="similar to AA sequence:RefSeq:NP_010343.1"
                     /note="ancestral locus Anc_1.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137933.1"
                     /db_xref="GeneID:59324377"
                     /translation="MLQEPVNGKCVQHSLAQVAASSSSPLMRLFTDTYRALLCKELKR
                     DINPILTEFPSKNDFLPPKNPIVLCHGLSGFDKLILIPSVFQLTRIVSNFIVGNRDEY
                     FIEEDTDADATKSIFEVEYWMGVKEKLEEKGCTVITSKVPSFGSIEERAVILNAFLEK
                     ETKRLKETLNKGQVYNTEEVDSNASFKAEERIKLNLIAHSMGGLDCRYLISRIPNKSY
                     KVVSLTTVSTPHRGSEMADYVVALFEDLKEGAPFDTRKQVLPPSFYELTTQYMSYFNK
                     ITPDDPDVSYFSYGAYFEPKWYNAFVMPWKIIYTATNGQPNDGMVTVRSSKWGEYQGT
                     LADTDHLDLINWKNKIQKDIGKLFDNTSHSAEKAVKPEIDILNFYLRIADDLARKGF"
     gene            complement(<222949..>223944)
                     /locus_tag="HG536_0B01200"
                     /db_xref="GeneID:59324378"
     mRNA            complement(<222949..>223944)
                     /locus_tag="HG536_0B01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282039.1"
                     /db_xref="GeneID:59324378"
     CDS             complement(222949..223944)
                     /locus_tag="HG536_0B01200"
                     /note="ancestral locus Anc_1.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137934.1"
                     /db_xref="GeneID:59324378"
                     /translation="MSVLIETTVGEIVVDLDFEHFKIESYNFLKLCKCKLYEYQCLYN
                     IRKNQTVEFGDPLIGFGDRKELRVHNTSIEGILRPNSDGEVKALLIKPSREDNLPIQA
                     QKGSLGAVIKPGDPLNLIGSRMVITLNEEPRELENIVFFGNVVKESFPILDRINAAVA
                     DRSGRPLIDIRIRKMHLIHDPFPDPPNFRTLDVSQPFEDVRLPDDLQLAFCQDSLQQE
                     IHIDIRRKELSLEIMGDLPGVGLKPSDKVLFVCKLNPLTRAKDIATIFQRFGYVKSVE
                     IVRDKESGRSLGYGFIEFDSKKSCDSAYKSMDGVLIDDRRIHVDFSQSLKKSQVR"
     gene            complement(<224124..>225560)
                     /locus_tag="HG536_0B01210"
                     /db_xref="GeneID:59324379"
     mRNA            complement(<224124..>225560)
                     /locus_tag="HG536_0B01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282040.1"
                     /db_xref="GeneID:59324379"
     CDS             complement(224124..225560)
                     /locus_tag="HG536_0B01210"
                     /inference="similar to AA sequence:RefSeq:NP_011771.1"
                     /note="ancestral locus Anc_1.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137935.1"
                     /db_xref="GeneID:59324379"
                     /translation="MLSRSAIGILRSSSRGVSTTSSGAKLTDVLIVGGGPAGLTLAAA
                     IKSSPKLQHLCTTLVDAGDLTGKVAPFYDSPPTSYTNRVISLTRPSKRFLQDRAGVTL
                     MEDRIQNYDGLYVTDGCSTATLDMEQDSMSCMIEILNVQSSLLKRLSDLQLDTSSFQL
                     LDKTKVASIEYSTPNDAGSWPLVTLDNGEVYKTRLLVGADGFNSPVRKFSKIPSRGWF
                     YDRFGVVATMKLEYPPYKIRGWQRFLPTGPIAHLPLPDDNATLVWSTTEPLSRLLISL
                     PPEQFTALVNAAFVLEDADMQFYYKQLTDGKMSTEELLADIEFRTEQVYDTLQVQDLV
                     DEVYPPTVKSVLGETRARFPLKLSHADTYCAERIALVGDAAHTTHPLAGQGLNMGQGD
                     VEALLNALEHAVSRGSDIGSLLALQPFWADRYPINNMLLGMVDKLHKIYGTDFAPVVA
                     LRSIGVNFINSFPPIKNLIKGTLSESGR"
     gene            <226145..>228547
                     /locus_tag="HG536_0B01220"
                     /db_xref="GeneID:59324380"
     mRNA            <226145..>228547
                     /locus_tag="HG536_0B01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282041.1"
                     /db_xref="GeneID:59324380"
     CDS             226145..228547
                     /locus_tag="HG536_0B01220"
                     /inference="similar to AA sequence:RefSeq:NP_014143.2"
                     /note="ancestral locus Anc_1.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137936.1"
                     /db_xref="GeneID:59324380"
                     /translation="MRDKVHIENLQVETAIGPDSWNQINPQQCYLSMEMLTDFSKAAE
                     HDDLTHTLNYAVICREVGKFVGSRTDWGSLGNLSKSVTKFVMSNFPGVDSLKLKLQTR
                     TGHIRSDDISCVIEENRRRDEEINTLRYDLLCISNLKLLTLIGVFPFERLQKQYVTLD
                     LKLPWPKQVVRHATVRSAIERVVEHVEHSKFLTVEALAESVAKIISSDSYFAQYTDFP
                     IDVKVIKLNAITATSGVGVSCVRSVNELRHLKKPLILPDVDEYEFAKEKSEVIPHHGL
                     NVAPSDTWNTAYLAFGSNVGDRLQNIRTAIDLLNQRKTIRVKCMSSLFESEPMYFKDQ
                     ESFLNGCLKIQTSLSPHELLVCCKEIEYDELKRVKKFDNGPRTIDLDIILFLNGAGEP
                     VMIDDEKLTVPHKRLLERSFVLEPLCELIPPNFVHPLTAEPLIDHLNKLSKKGNDEDR
                     LFNLVPVGSSGSTVNFLKFQNVTEEGIFGSTLGRGSKVATLVMAIVNTTPDSFSDSGE
                     LYCDLDKQLSCVKEICSQTLRLHEKLIIDVGGCSTRPNSPQPSEEEELRRVIPTIQAI
                     KSCPDLPSDKVIISVDTYRSNVAQKAINAGASIVNDISGGSFDSSMFSVIAANPNVAY
                     VLSHTRGDIATMAKLTNYEESQNGKLSEYISDKICKTSETATTRIIGRELAERYFAAV
                     NNGVARWQIIMDPGIGFAKNGDQNLQIIRQLPLLKSFSCTWENGEHVSFRNLPWLVGP
                     SRKKFIGKITKEENPSDRDFATGAVITASIGFGADIVRVHNAKDCAKAVKVADALYKQ
                     LP"
     gene            complement(<228752..>229228)
                     /locus_tag="HG536_0B01230"
                     /db_xref="GeneID:59324381"
     mRNA            complement(<228752..>229228)
                     /locus_tag="HG536_0B01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282042.1"
                     /db_xref="GeneID:59324381"
     CDS             complement(228752..229228)
                     /locus_tag="HG536_0B01230"
                     /inference="similar to AA sequence:RefSeq:NP_014144.1"
                     /note="ancestral locus Anc_1.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137937.1"
                     /db_xref="GeneID:59324381"
                     /translation="MSQKACYVCGKIGHLAEECDSERLCYNCNQPGHVQSECTLPRTV
                     EYKQCYNCGETGHVKTECAIQRCFNCNQTGHISRECVEPKKARFPSTPSRGSKVSCYR
                     CGGPNHMAKDCLQTGSKCYSCGKFGHLSKECPNGPDEKVCYNCNETGHISRDCPVN"
     gene            complement(<229430..>230479)
                     /locus_tag="HG536_0B01240"
                     /db_xref="GeneID:59324382"
     mRNA            complement(<229430..>230479)
                     /locus_tag="HG536_0B01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282043.1"
                     /db_xref="GeneID:59324382"
     CDS             complement(229430..230479)
                     /locus_tag="HG536_0B01240"
                     /inference="similar to AA sequence:RefSeq:NP_014145.1"
                     /note="ancestral locus Anc_1.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137938.1"
                     /db_xref="GeneID:59324382"
                     /translation="MTARKALKSKRNLVYSTREDRDEKLQVFKRRRAAIFQQRCTGGE
                     QAASDGVSGGTERRVVGRRRRSAKSRALQAIAAGEDSDSSSDAGRASSEGSEPLVNLR
                     QSIAPEDIEEIKKQNSKGVRSVGDLIEKCEHSMEYSSRSPADQLLGSSGDKGHVARKL
                     ELRRKYEQKFALPSILYRSELIMRIQPFLRLVEDLFKNRVSSYYKHEAASASKASNNA
                     FLSLDEFRSMDISRFVAGYYGLRRQLSVGEEILRQFRPFLLKRQGKTMKWWGVADFAN
                     YVLAPEVLASFCIDEMQLGDDIYDRETREKAYELFHNTTEFGLAIADAEPLEQWEAPV
                     RDQRATGPKMTESQR"
     gene            <231003..>232289
                     /locus_tag="HG536_0B01250"
                     /db_xref="GeneID:59324383"
     mRNA            <231003..>232289
                     /locus_tag="HG536_0B01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282044.1"
                     /db_xref="GeneID:59324383"
     CDS             231003..232289
                     /locus_tag="HG536_0B01250"
                     /inference="similar to AA sequence:RefSeq:NP_014146.1"
                     /note="ancestral locus Anc_1.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137939.1"
                     /db_xref="GeneID:59324383"
                     /translation="MSSSKIEHARLADERVFTPELATSMTEKVLTVLMNKSQTEEIED
                     DRYVNVVSRTQSRFASPLSPNQIVSLEIHPSGKSLAYSRADGSLTVWVMTGPTFARSR
                     KLYVANAVGRDKSVSCLSWDSTEMNQLATVCNGSEVLVWAVDEKKRTMSKVRTISVGA
                     KLKLHTCAYDPTGRWLLALAKSEELYLFDARKDHELHTVSDLKQLIAGDSVHCLAWNN
                     TGSHLFLGLKSGKLALLEFDASNGFKLCMSVDAHRGLVSSIAVDPWGRFVVTGGSDGI
                     CVVWDISSMCCSVVIDGLDSPIASLSIDHLGKCVALCTEKGDLRFYDLHSGKCLLRQK
                     MGASGSDLVARFYPDRTWLIIPSKWDILERHFTPSTYNDALGLWKAGHEKPKIDLRNR
                     NVTRKSLKRSRENDKNDRGRAGKRESSRGGRFSERR"
     gene            complement(<232353..>233159)
                     /locus_tag="HG536_0B01260"
                     /db_xref="GeneID:59324384"
     mRNA            complement(<232353..>233159)
                     /locus_tag="HG536_0B01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282045.1"
                     /db_xref="GeneID:59324384"
     CDS             complement(232353..233159)
                     /locus_tag="HG536_0B01260"
                     /inference="similar to AA sequence:RefSeq:NP_014147.1"
                     /note="ancestral locus Anc_1.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137940.1"
                     /db_xref="GeneID:59324384"
                     /translation="MLPFSRGMASVAKSSSNNAILAGLILSRIPIVTKDMTTLEKRYY
                     EYQSALKERLMWTFPHYFYFKRGTLAERRFLLAQKGPISKQPGVWFPKGVPDIKHNRE
                     RSRKQEVNLPGQESNNTTEAQNGDDISRPVVPNSRVTEADKSNDFSSLERKLSRTLYL
                     LIKSNEGVWSFPSFAVEDKPLHISAEEGLRALGGDNINTWTVSNTPAAVLEKDNGAHE
                     FLIKSHILAGRFDLQKNKHVADFAWLTKEEIGERVSEDYFNEVRFLLTEY"
     gene            complement(<233395..>235119)
                     /locus_tag="HG536_0B01270"
                     /db_xref="GeneID:59324385"
     mRNA            complement(<233395..>235119)
                     /locus_tag="HG536_0B01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282046.1"
                     /db_xref="GeneID:59324385"
     CDS             complement(233395..235119)
                     /locus_tag="HG536_0B01270"
                     /inference="similar to AA sequence:RefSeq:NP_014148.1"
                     /note="ancestral locus Anc_1.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137941.1"
                     /db_xref="GeneID:59324385"
                     /translation="MSEEDHQSFVATLESFRELKSGISGSRIKKLTTNALEHVEDEEK
                     IISLIINYSRTCSDSHKLGSLYIIDSIGRAYLDEARANDEYIKSTAKPGTCAHAVYTL
                     GESIQELLTSAISKSNEDHREKIRTLIDIWDRAGLFQKGYLNAIRAKCFSMDVVANEG
                     QSATSASTTNHLAEDPKERCIQILNDLKPLKFFPSLTLPPALSSPDAAQQQAGLLQAL
                     ATIQQQFNQQQQQMKLQGQYGQASGLAPSARNGHVTTEYGSRRERERERERYSSRRNR
                     SRSPPRRDSHQRASGPHSNSNGPLGTNNHHLYPDEQNVPSNPHFRPKPVSFEPNLPPE
                     HIKVFSRTLFVGGVPMNMKEWDIANVLRPFAEVQSVILNNARKHAFVKVYSRSEAENV
                     LLNFNKDGSSPLRTRWGVGFGPRDCCDYQHGFSVIPLHRLTDADKKWCVHAQWGGTGG
                     QPLQGGVVFEEPDIIVGEGVSSKAISQKMPTDSGRNGPRSGKSSKTTTGTPPMASFAP
                     NQAPSPGQMYAQIQQPYPPQPTASAYAQPQVSAPITTYAQQPPQQQSFDATAQLNSLM
                     SMLNQQQN"
     gene            <236183..>240100
                     /locus_tag="HG536_0B01280"
                     /db_xref="GeneID:59324386"
     mRNA            <236183..>240100
                     /locus_tag="HG536_0B01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282047.1"
                     /db_xref="GeneID:59324386"
     CDS             236183..240100
                     /locus_tag="HG536_0B01280"
                     /inference="similar to AA sequence:RefSeq:NP_014149.1"
                     /note="ancestral locus Anc_1.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137942.1"
                     /db_xref="GeneID:59324386"
                     /translation="MSAIYKLSIQGIRSFDSNDRETIEFGKPLTLIVGANGSGKTTII
                     ECLKYATSGDLPPNSKGGAFVHDPKITGEKDIRAQVKLAFTSANNLNMIVTRNIQLLV
                     KKTTTTFKTLEGQLVIVNGNGNRNTLSTRSVELDTQVPLYLGVPKAILDYVIFCHQED
                     SLWPLSEPANLKKKFDEIFQAMKFTKALDNLKGIKKDMSIDIRLLKQSVEHLRVDRDR
                     SKMTEVNINQLEAKVDAYKAEVKEIENQLVDITEQSDHLFKSNQDFQKILSRVENLKN
                     NRESLSQQIKRLSNAVDIIDLPRKEVEQLLKSFASTLKVKEMEMKHLEEETKQMKERV
                     SKLQAECNGLMIRQGELTAACDLNEKRKDRLRQKGQEVIALYKLTVNDQCSSDVILSK
                     LKSVRDKLRLQSEEIEEVANREIEALERELNGIRRSAIVRNERLEYGKQDRDKISREI
                     DRLQKELAALDISGEDLETERASLNRFTEKLKEWEKVDVVGALNKQIKEKNDQMVILE
                     NELDTLQTRISRTNDQADLYARLSIVKQSLQDKFEEMNKKIQTLEDDPMTHRWQLKYG
                     PDLDIEFKRKYIDVQKETSGKRQLLQDLDKKYTEAALNLNNTESELAKNRKLKENLLA
                     KLQKALPEDCPIEDYDEVVAESESSYRIALENLKMHQTTIEFNKRALEVAEKERSCYL
                     CSRKFENEKFASGLLEKLRTRTDSRFEDTLKETVSNEKEYLDTLRGLKEDILSLQSAK
                     SRIADLSEAKSNLREEVKRLKIDRDQCEVELKKVEEDRSHAEQILRPIVDYIIRSVKE
                     VKQLEDQNKTITDELALYGTSEDGVRTVEELQTLQRSKNDLLRSCRKEINYLQEEKQN
                     KLGEYTRLSSVIKERGSKVTELEKQLMLKENITADINSKSEQLNDLESTIESLGKEVD
                     AQNEKMKHSETQLTKRKKTFAEEHAASQNSCKAIDGHINELSKLKTDVDSFALDGPQE
                     LESCTKQLEERQREVRSLSEAIERESEGLMKQAQRVKDSNNEKRNLEQNLELINLKES
                     LSSIEKEINDLDVQNAEAERDKYQQESLRLRNLYEKLSSENAGKLGEIKQLQNQIEAF
                     ARQLQTDYKDVENDYHKKWVELQTRTFVADDIDTYSKALDSAIMRYHGLKMQDINRII
                     DELWKRTYSGTDVDSIRIRSDEVGSSVKGKSYNYRVVMYKQDAELDMRGRCSAGQKVL
                     ASIIIRLALSETFGVNCGVIALDEPTTNLDEENIESLAKSLSNIIEMRRHQKNFQLIV
                     ITHDEQFLNHMNASEFTDHFFRVKRDDRQKSQIEWVDISRVSD"
     gene            complement(<241726..>242958)
                     /locus_tag="HG536_0B01300"
                     /db_xref="GeneID:59324387"
     mRNA            complement(<241726..>242958)
                     /locus_tag="HG536_0B01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282048.1"
                     /db_xref="GeneID:59324387"
     CDS             complement(241726..242958)
                     /locus_tag="HG536_0B01300"
                     /inference="similar to AA sequence:RefSeq:NP_014151.1"
                     /note="ancestral locus Anc_1.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137943.1"
                     /db_xref="GeneID:59324387"
                     /translation="MGSKRNFTEVEIEEYQDHPSVVVGSFFKGVRVPKETTFELYKKK
                     GSKDAFVLHGENDRLEYEGDGSVSLSNQYVVGVYNPNKKAIRLYKAPLIDSKVISKSC
                     KSLSGPRIKSESNIKNSALRNALGEAFGTKKAKKAIADLERNRVDSDKLVDSAIDIVD
                     SVRSAAKGLPTRQELEDKITLDRPTPVANVDATDVEQIYPIENIIPKREMQFIRVGAF
                     FKENDHEKRLEMLPYSKSQYVSEKLPTLTQVTQSTKLQLLYYLSLLLGVYENRRVNNK
                     TKLLEKLNFPPEMLLDGVLERFTVSKASQVGRSKDRSFVIDPQNEDKLLCYILIIIMH
                     LNNFIVQVSPLAKELALKPSKIVNLFRVVGATVKGATVAQAEAFGIPKSSASTYKIAT
                     LKVPFKLPQMTRRGRAAR"
     gene            <243757..>244242
                     /locus_tag="HG536_0B01310"
                     /db_xref="GeneID:59324388"
     mRNA            <243757..>244242
                     /locus_tag="HG536_0B01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282049.1"
                     /db_xref="GeneID:59324388"
     CDS             243757..244242
                     /locus_tag="HG536_0B01310"
                     /inference="similar to AA sequence:RefSeq:NP_012631.3"
                     /note="ancestral locus Anc_1.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137944.1"
                     /db_xref="GeneID:59324388"
                     /translation="MASSHYEVLGLSCDSSLGCIKKAYKERLLSSHPDKTRNDSSSVE
                     VNKIQEAYKVLSNPELREIYDKSLKDDQKKQGLHSSGDGLDEYSLDEFCFNPAICEYC
                     MDCPRCHGKDGFHFSEGTLEEHCQERASGGFLVLAQCSACSLWLKVNFDLAEEYEQAD
                     V"
     gene            complement(<244251..>246413)
                     /locus_tag="HG536_0B01320"
                     /db_xref="GeneID:59324389"
     mRNA            complement(<244251..>246413)
                     /locus_tag="HG536_0B01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282050.1"
                     /db_xref="GeneID:59324389"
     CDS             complement(244251..246413)
                     /locus_tag="HG536_0B01320"
                     /inference="similar to AA sequence:RefSeq:NP_012632.2"
                     /note="ancestral locus Anc_1.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137945.1"
                     /db_xref="GeneID:59324389"
                     /translation="MKHEDASSEQLSYYSLSDSEIDSDLRRDRADQPVRMTETKFRSS
                     SDGVSENSSPDFFIGGAKVRTNSKSHESLYRGKSIYDDEPEEEDSDILQSTSTTSPIG
                     QLYGTNSGKNQPDFDKTEQDIQQKRATHKIFTFALPFGGKSILPSSPISSIVSSMMSN
                     ESVDKNGATDKYKIKEKLKRSESITTLEELALFKNTKGIDNVRARALKKTFELESLKQ
                     TLKNITSSTGDLTSDGYQITRLDTIWNELEGNFLVMGGYRGSILRDAKTNRRVWIPIR
                     AGLNIRKVDLLIGPTDEDEAQAQRIIKPDGMLTHIGPVDVSKRLIKKLKSNPNVEVEN
                     YGYDWRLSLDISAEQLRQKLQDIYDSQTVKKGTFIIAHSMGGMVAHKVLQDHTHLIRG
                     IIYVGAPSECPNILGPLKFGDEVIMNKTILSKEANFFMRSSFYFLPTNGTCFVNKTTY
                     KKYHIDFFDPTVWVKLGLSPVVDEDRKKLEMKLTRKEEGDERATIIEYKNQKQNMAKT
                     ESKEKQPQPGISAEVKDLLGLINPVPILRSLSGPSAFTSHTIKPLKVLNPAPLLSKFS
                     SATTDVIGLKDGKECDQEDGALTFLTPYEECLQYLIRTLRRAKNYLNSLGHIKDKTYP
                     PLVIVYSKSVPTVRGVKIDGLDDIKRGNYNNFYYGPGDGVVHHKWLLPEQRGFPLAAK
                     IESTCGHVSLLSDLDSMAKALISLVDEEKKADTEESCK"
     gene            247004..247098
                     /locus_tag="HG536_0Btrna3K"
                     /db_xref="GeneID:59324972"
     tRNA            join(247004..247041,247062..247098)
                     /locus_tag="HG536_0Btrna3K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59324972"
     gene            <247266..>249506
                     /locus_tag="HG536_0B01330"
                     /db_xref="GeneID:59324390"
     mRNA            <247266..>249506
                     /locus_tag="HG536_0B01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282051.1"
                     /db_xref="GeneID:59324390"
     CDS             247266..249506
                     /locus_tag="HG536_0B01330"
                     /inference="similar to AA sequence:RefSeq:NP_014152.1"
                     /note="ancestral locus Anc_1.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137946.1"
                     /db_xref="GeneID:59324390"
                     /translation="MKNFGFSVRKFMSTGKVAQPKWIEPKVHKERPCLKLYNSLTREK
                     EVFVPKSGGKLVTWYSCGPTVYDASHMGHARNYVSIDINRRILSDYFGYNVKFVQNVT
                     DIDDKIIVRARQNYLFDKFVSRSEEHNMGDVVDALSVYVAKNMNLSGLETIESIRSAI
                     ETLNVDEEKLKNPKFNMHYNAVMRALKALESLEKKGFNDDIKDIYVPFLDSKFGSSVT
                     DPEIFRKLPAYWEEQFDNDMRRLNVLPPTVTTRVSEYVPEIIEFVKKIIDNGYGYATD
                     DGSVYFDTVKFDSSEKHDYAKNQPWNKGQLDLIKEGEGSLTSSNGGKKSANDFALWKA
                     SKPGEPRWISPWGSGRPGWHIECSVMASDILGECMDIHSGGIDLAFPHHDNEMAQSEA
                     CFESEQWVNYFLHTGHLHIEGQKMSKSLKNFITIDEALEKYSSRQLRLAFLLTQWNNQ
                     LDFKESLLLEVKSLENMFSNFFKNTRALKSDDSSRVSKKLGSREKDLLSYLEKVEEDI
                     DCALCDNLSTPQCMKLLSELVNKSNTYISDAGADVRTEVLVAVCKYISKFFGIAGIPI
                     REDQLGWYEGDVRQENNKEEQILPYVQCLAKFRDQVRQFAIDNRDPKKFLELTDKLRN
                     EELLNLNVLLDDRSGQGALVKLISEEEKVRIVEEARQETEKRQAKKASEEAKRREREA
                     KEKERLEKAKIPPQELFKQPELYSEWDEDGIPTKDKEGNAITKSMTKKLKKLWLQQEK
                     LYKSVN"
     gene            complement(<249511..>249876)
                     /locus_tag="HG536_0B01340"
                     /db_xref="GeneID:59324391"
     mRNA            complement(<249511..>249876)
                     /locus_tag="HG536_0B01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282052.1"
                     /db_xref="GeneID:59324391"
     CDS             complement(249511..249876)
                     /locus_tag="HG536_0B01340"
                     /inference="similar to AA sequence:RefSeq:NP_014154.1"
                     /note="ancestral locus Anc_1.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137947.1"
                     /db_xref="GeneID:59324391"
                     /translation="MAGSSDLNLLKSWNPKLAKNRQKVQKKEQEALEEEKKIRQAAKE
                     RELNDLATAKSKTGLEWMYDVPKQPETKSLPQEKPKLQRKNSTEKRIPTANKAKASRY
                     DKDDPMNKFKVAKKRLNKK"
     gene            complement(<249949..>250275)
                     /locus_tag="HG536_0B01350"
                     /db_xref="GeneID:59324392"
     mRNA            complement(<249949..>250275)
                     /locus_tag="HG536_0B01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282053.1"
                     /db_xref="GeneID:59324392"
     CDS             complement(249949..250275)
                     /locus_tag="HG536_0B01350"
                     /inference="similar to AA sequence:RefSeq:NP_014155.1"
                     /note="ancestral locus Anc_1.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137948.1"
                     /db_xref="GeneID:59324392"
                     /translation="MSIENLKSFDPFADTGDDETTTANYIHIRIQQRNGRKTLTTVQG
                     VPEEYDLKRILKVLKKDFACNGNIVKDSDMGEIIQLQGDQRAKVCEFLTTQLGMQKKN
                     IKIHGF"
     gene            <250473..>251624
                     /locus_tag="HG536_0B01360"
                     /db_xref="GeneID:59324393"
     mRNA            <250473..>251624
                     /locus_tag="HG536_0B01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282054.1"
                     /db_xref="GeneID:59324393"
     CDS             250473..251624
                     /locus_tag="HG536_0B01360"
                     /note="ancestral locus Anc_1.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137949.1"
                     /db_xref="GeneID:59324393"
                     /translation="MSAVDLARSIKKACSIEEVEPKRKHVRACIVYTWDHQSATQFFS
                     ILKSVPLAPSEIQVFKCLIVVHKVVQEGHPTALREAIRNTEWIRSLGRVPSNEYGRLI
                     QRYASCICEKLMFQASHRGFDGGMFEYKEYTSLAVVSDPDRGYDTLWSLMDLLEEVME
                     TCKLMLASMGRRRKAELVVAAVVPLVTESYGIFKFCTAMLRALTQEIDDHAALEQLSE
                     RYRMQHRDLFELYADCSSIKSLTSLISLPKLPPEPESFDMTDKTPLERAKVLSTDQRL
                     AIHLALQSINHSREPVSFYSVSQLANEIAVSAEPSIPAIIRLTHQVTTLLQRNPSPLL
                     AQASQLYFQALLSPSQQDIINANTNLQNLLINSPAHIFDPPTPQTHTSA"
     gene            complement(<251566..>252162)
                     /locus_tag="HG536_0B01365"
                     /db_xref="GeneID:59324394"
     mRNA            complement(<251566..>252162)
                     /locus_tag="HG536_0B01365"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282055.1"
                     /db_xref="GeneID:59324394"
     CDS             complement(251566..252162)
                     /locus_tag="HG536_0B01365"
                     /note="MATalpha1"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137950.1"
                     /db_xref="GeneID:59324394"
                     /translation="MHEKSFRGFKANRPLFKVQIKRKPGQCRPAKARCMEGSCSHTSG
                     YTKEKSTKTFMAKLGPIKIPSPPNTLLRKIEEEKLKLQSESSAEKGSLWDSPISWDSE
                     EILFSIANDVLDNIYKKPARKGASTKPLNSFMAFRAYNSQFGYGLKQNILSPLLASAW
                     HSHPEQQEIWDTFAQQFNFVKPKCGFVEWVDQRYERES"
     gene            <254204..>255085
                     /locus_tag="HG536_0B01380"
                     /db_xref="GeneID:59324395"
     mRNA            <254204..>255085
                     /locus_tag="HG536_0B01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282056.1"
                     /db_xref="GeneID:59324395"
     CDS             254204..255085
                     /locus_tag="HG536_0B01380"
                     /inference="similar to AA sequence:RefSeq:NP_013452.1"
                     /note="ancestral locus Anc_1.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137951.1"
                     /db_xref="GeneID:59324395"
                     /translation="MSGKVAMTDTPIKYPWWYGGAGGIFACIVTHPLDLAKVRLQTAS
                     PPKPTLLNMIRRILQQEGPRGLYAGLSASVLRQCTYTTARFGCYDIIKENLIPQSEIN
                     NSLYLLPCSMLSGAIGGFVGNPADVVNIRMQNDSAHDPHLRRGYRNAFDGLNSIVREE
                     GFYKLFTGLAPNLIRGVLMTASQVVSYDVFKHQLATKFGMDPAEKKTHFAASLLAGLV
                     ATTVCSPADVMKTRIMNAQQHHESAVRVLWRSVQTEGVLFMFRGWLPSFARLGPNTIL
                     IFLAVEQLRKYRVGMSG"
     gene            complement(<255082..>256884)
                     /locus_tag="HG536_0B01390"
                     /db_xref="GeneID:59324396"
     mRNA            complement(<255082..>256884)
                     /locus_tag="HG536_0B01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282057.1"
                     /db_xref="GeneID:59324396"
     CDS             complement(255082..256884)
                     /locus_tag="HG536_0B01390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137952.1"
                     /db_xref="GeneID:59324396"
                     /translation="MVVPSEKKPLRSCARCRKNKIKCDSFIRRPEPCSSCVKKGVECH
                     VDYVNPPQRSQEMKVLFDNIKYAKERISSLCAVYDRLLEDAHVGRSDMQVRKLDSPTR
                     ILKILDKFYLFVIDEDAGSFYVNNYKIDLRLLEESFEHFRKLISKSLEIYVTWENVRD
                     IEGRELDLFISQFSLESMVENNQLLLLICILNFYFDIPGLDYLKIYNHVVDSYCDGAS
                     KNGTAGSKFLSKSLLAKLVIGDSYGWHFHSEMFIKHFTVYLFLHVVLYGPQHFMACFM
                     DRYIRILESLRKKINFDKNWEVKWVNFYIRLLNLVESRASGEEGRSVDEVVLEVMLND
                     VYEKDDLLSSFICLVNIDQYLVERRAWPLGNFSKSVLHRICKRVGNVLAMDFSGTERP
                     SFLELLFAQLLSLNKLLCINNHFACDLDDQRMNGFNQQVYVEVGDRQMEAAYSCQAEY
                     HLVSGYDENENGYALKLAGPVVGKHRCRLSSRCLIDIVESDLDAYRNRDDMALKILKS
                     SCLLIWSLYEHVIYYETLNRVLYYVPFEWNAQLLLETSGLVCQHDDQRARVKLARENN
                     GAKGDAGIDRILNDVDWMKESADDVLRKIHGVLN"
     gene            <257151..>257957
                     /locus_tag="HG536_0B01400"
                     /db_xref="GeneID:59324397"
     mRNA            <257151..>257957
                     /locus_tag="HG536_0B01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282058.1"
                     /db_xref="GeneID:59324397"
     CDS             257151..257957
                     /locus_tag="HG536_0B01400"
                     /inference="similar to AA sequence:RefSeq:NP_012325.1"
                     /note="ancestral locus Anc_1.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137953.1"
                     /db_xref="GeneID:59324397"
                     /translation="MSRVAQLDSTALDQELHSLFRTELSQNLDIHKNEEEWHFVLDTL
                     VFFFGSKFFQKAHQTKTYGSELSGVTYNCKRRTLYIVAILSSYLGSKISKKVYSTTDG
                     TVWSRLKPLYVYLSHFYSAADLVNFACFLLSTGQSDFKYLTPIHRLLGASSSTDTYNP
                     VSFYHNTVYAGIEFQNRQLLWNAILEFFNATLLNNARWLNGRRQRPSTTKMSAQLPEI
                     CARCQELPTNPFQIQCCQANYCYVCVIRAIDSKCCDNCSSSTNLRAEPIY"
     gene            <258020..>260107
                     /locus_tag="HG536_0B01410"
                     /db_xref="GeneID:59324398"
     mRNA            <258020..>260107
                     /locus_tag="HG536_0B01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282059.1"
                     /db_xref="GeneID:59324398"
     CDS             258020..260107
                     /locus_tag="HG536_0B01410"
                     /inference="similar to AA sequence:RefSeq:NP_012326.1"
                     /note="ancestral locus Anc_1.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137954.1"
                     /db_xref="GeneID:59324398"
                     /translation="MTEAYTVRLKNLLVYVELLEQLRSKGQIGGPLSSHLALHLVAML
                     PRFLTCHSLHNTLHRSLYSTTLVKVPRTRSFSDSTDHSAEKVLGIIQNSKKLVNNEKP
                     AFRDYWKFVSTTKNTANSVLRRIPIDSIAQFVNANKLNSSTVRGFYRREMIYNLHCDF
                     QKIQELAEKLHIDPELIKSKTDILAFCINDSIKTKDIMIAVEVYLLYYKLYETEPLNN
                     DLCQSIISALAFENPRYDHIHLLKFLELDHLHEIRNTKMTLTRTQIATICNKALALEH
                     SPILTKSVLDRAMNIELTPISDFRNDKIIAAYHLIERDYAINNAAGVFLTWTTIKNYY
                     TSVEKHDPRIIYKLINIFTHHKAYRKACKELVASLSPYFYSNNALLLPSLIDYATKTN
                     NLSLARELMNNVNKFLDKNNTQVVLFSKRCLSSMLRMHLKFKDSNGVDRVLKYIQESF
                     GKPSEENLSSIVSHLVEIKSFDNLKKAVQLVDSFPTKRALLAYASIINKIVEWQIASD
                     DRFTAASLPVVDKLLRRAHIQDPNHKSSLWNIIASLFIKKIVHHRNFQRKTFSSNLYS
                     KGKKLDTANLDLAKLLYLRSKKTQRDSSMIDVNPFIRSSPHKIVLKITDGNRFVILRN
                     IALNAIKGRRKDIFLWCCSELYQHGMPVKELLLDWNMMLDHQMRRASFPERKQIDEKL
                     SIGKLAFISKNLK"
     gene            complement(<260165..>261160)
                     /locus_tag="HG536_0B01420"
                     /db_xref="GeneID:59324399"
     mRNA            complement(<260165..>261160)
                     /locus_tag="HG536_0B01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282060.1"
                     /db_xref="GeneID:59324399"
     CDS             complement(260165..261160)
                     /locus_tag="HG536_0B01420"
                     /inference="similar to AA sequence:RefSeq:NP_012327.1"
                     /note="ancestral locus Anc_1.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137955.1"
                     /db_xref="GeneID:59324399"
                     /translation="MSYKNIATVLGSAAVGGGIANYLFGRSSKAPAGDQTVPSKLEPA
                     PSRPDGSVSLVGSSVNPSGFFQYGFPGPIHDLQGRDEFVSCYNRQTRNPYWVVEHITS
                     ESLAARNADRKFSFFKEDEAIPEIFRGKLKDYFRSGYDRGHQAPAANAKFTQKAMDET
                     FFLTNISPQVGDGFNRDYWAHLEYFCRQLTKKYTSVRVVTGPLYLPKVDPVDGKTKVC
                     YEVIGNPPNIAVPTHFFKLIVVEKPVGNLNTDNISVAAFVLPNDVIPNETKLTDFQVP
                     IDALERSSGLQFLQKVPPNKRKELCKEVNCQITVREFQKALPPPKEVLGLPGPGK"
     gene            complement(<261638..>267610)
                     /locus_tag="HG536_0B01430"
                     /db_xref="GeneID:59324400"
     mRNA            complement(<261638..>267610)
                     /locus_tag="HG536_0B01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282061.1"
                     /db_xref="GeneID:59324400"
     CDS             complement(261638..267610)
                     /locus_tag="HG536_0B01430"
                     /inference="similar to AA sequence:RefSeq:NP_012328.1"
                     /note="ancestral locus Anc_1.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137956.1"
                     /db_xref="GeneID:59324400"
                     /translation="MSEAKLVERIESSVNKKHALLSWVALKLEEVNAEEALKDDDSRC
                     EEFLGVCAEIDAFIRYNAGLPEDEQLDSYYVFQALSHLYGLYLTRLEKVRPGRIYDSA
                     ELLATVLAEDDVTIEVTEKKKKKSSKKRSYIRSAAKEMACIALIQFYETFNQQLSSLA
                     PLLFGIIFKNLKKIMEKSKYAHATFATSLMQLLKAILKNVGGSSFYHEYFPKFSKLSK
                     KVFEAICSDRQEFSTDMVSAIMEIWSYHFRRESFVKDNKHNLENAILANYSEGELGPL
                     GFVNDFSRHVVARTLAEVMFDYFKISEVLGIEQILQFYATLFERSVTRDAQAGTFESI
                     VHFLGLCLSADISFFEGSQYLEIVRTLASSIFSPSCTSNHRVDSMSRSLRYFVYMHTL
                     LLPKIEESSKNLIVLQLLSPSQSAADTTSDYTINSDPENLWLNLALLDLAQLLLSELS
                     SCFGNEKHLVDEVKKTLIRLSICDNFTLRIHASAVLKLFLSNFPQYLSGTIEGSLNAL
                     SKNFKQDDNFLYTANHGHALVIANLIACADKDYVSFELIMRITVFATSFIKNHTTTTT
                     TPLYSKNLLCWILLIGCMNYKDDRYLQMQSSQLFLFWKVLLTHNYSSRHEDDLYRNLE
                     IRNHALTCLLAFLGNDSIGNKAVAKQVSYLLTKCSSFNHAIIEKSDKIDKALLTNELR
                     LLQIHLRLHKYIKDDFNSSLLILIMKNFSDPNLYSEGTHSLIESLTSVADGKKSSSEQ
                     TPNFGEPSVVTLLRQDDGFAYGLSSRLSGANVSELYVKDHGELRQHLSFESKQWSWNF
                     EFENEITKPISCALSQDYLLTLYCAGGYSSSDKCSPKITTALIDASMEVFSLKFPFLN
                     DKIKYSIIETLNSSMFCRTTSTLRNVAIAANTLVSINKALEVMHEEGITLEHSVGELL
                     LKSVDKIKFDNDHLLTEMKAKCIGLVCGIINRNSDEDRAGKDMVTERVDILIDGLIKV
                     DEPFTRVLRALSLVNIYRYRPADAPFCRIFDVILSLISDPHPVVHCWSLKAMHLLIDK
                     HAAIDHTTASTLLGCLEDISTNPSYGMYGSSVLRYNYCLETDSHLTVGLILQSLSEAI
                     GAYISELPANVCERFKYLIYGLAISNSTAHQLLALEIYANLAIFKNQNSLDDRIFIKL
                     AESIVNGAILVGFSSACCNCHFMVKNGNIPNSFSSLSVMKCFDLFCLLTKLQKGHLFA
                     QDLENSSWRWLFLSPSSKELQNYLFTWMGQSPEDEIKWFDKLYVIFHISKWRLFFSYY
                     RTLNGLLKKIRFKKEGDEEIPSEEEKSIAQAELADFDGSQNSDLLPWRARLLILKMVK
                     HLCLASARREGKSVLLSRKIPELIKLAFQASTSSVASVKSLGLDILRLVLKANSSLRS
                     SESGPSELQQQEAQIVSAMMPAFNSGTPPDIVVSAIDLSAEILTSGISTVQEMHRVSQ
                     LLIDCLGIFNENKSSVRLGDVLIETQKSKKKIELSVLSAWAELTEKSVNTDELNLREF
                     TENYWDILVPLWIISLREYAMVKYEGKQTDELTGGHIKESFFEKSKLELFEGAWLNMV
                     VALSCVLEANPDVVLQRLSKTETESFMLILFIQCMEIVVKSLDDHEVLMKILPALHSL
                     LMCCVPLDLLFEDGTNEEIVGVLDRIMTMGNNQEKLMLVRIINDLIMRYVKKNDTHDT
                     FLQGIDKLYELLRLLIKPIAQLLPFIKYSSLENEVSRTAGLAEDEVRLLRASFSALES
                     NVGKFDDLFKVDLYSCLLFMIGEIFESDAREEVIPIVLPLLKSVSRNLLSGSLNSCLM
                     QTFFESIKKALFDQVQLTNQLAICFILLANNYPYFTESDLNRFISLILSGLRSSDTQA
                     ITMHGLRSLVNKGMSQHACRYIIRNLILEIFKSIGREDTQTVDLMFEFVQHFVKRVLD
                     TEPKSAPTAMAVILSLELLYCGKDGVPDERVGGRMMTLIAMDKESFKIASSSLLDEKQ
                     RARIEHIIEKSPEFGSSGPSGRKADLLLKNFV"
     gene            complement(267983..268053)
                     /locus_tag="HG536_0Btrna4G"
                     /db_xref="GeneID:59324975"
     tRNA            complement(267983..268053)
                     /locus_tag="HG536_0Btrna4G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59324975"
     gene            complement(<268362..>270128)
                     /locus_tag="HG536_0B01440"
                     /db_xref="GeneID:59324401"
     mRNA            complement(<268362..>270128)
                     /locus_tag="HG536_0B01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282062.1"
                     /db_xref="GeneID:59324401"
     CDS             complement(268362..270128)
                     /locus_tag="HG536_0B01440"
                     /inference="similar to AA sequence:RefSeq:NP_012329.1"
                     /note="ancestral locus Anc_1.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137957.1"
                     /db_xref="GeneID:59324401"
                     /translation="MAPEKRSQSKMLVLSIDSATKELKTGSFRASKACDFCRLKKKKC
                     DGQQPCSLCQAFGNKHCVYQDRRSPRQVRRKTQESPLPRRVLQDLPDRDVAIQLIHKT
                     WDNVCVLFRFLYRPSVIEDLISLYDAKDTTHFTERQLKSLPLIYSVIAVGALFGKEDC
                     EKSDVVARDLYREAGYKYFEMAKSLIDVTNVRDIYSIQTMFMLTMFLQCSANLNTCYS
                     YIGIALRAAIIEGLHKRTSSVGPTVIEDETKKRLFWSVYKVDLYMSCILGLPRALAEA
                     AVNQELPCDVDDEKITRDGILEQEWGKISSCGMNNQHTKLMLIMARIHESLYPVLTWD
                     QATYINILTLEEQLEKWFQELPYQLKPDSSFFNDDERAYYLKPAKLLYLDYLLAKIIL
                     YKPFIHYLAITSPLFDFQISMANKCIQVAHKVICLSDEMLKNDLLSASYWFSIHTIFF
                     SVTCLMFYQHQINLGLISEKHIDVEKDCELGINILLKLKNSSPVGEKSFSVLNSIFKE
                     FNKKTMELYSQVNESVTQLMKDPTSGASVEMSVEFFGQSEQDQILDQLLQDFDIPISN
                     ILPDFQMTSFFPTSLSERAAEK"
     gene            complement(<270765..>270938)
                     /locus_tag="HG536_0B01450"
                     /db_xref="GeneID:59324402"
     mRNA            complement(<270765..>270938)
                     /locus_tag="HG536_0B01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282063.1"
                     /db_xref="GeneID:59324402"
     CDS             complement(270765..270938)
                     /locus_tag="HG536_0B01450"
                     /inference="similar to AA sequence:RefSeq:NP_012330.1"
                     /note="ancestral locus Anc_1.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137958.1"
                     /db_xref="GeneID:59324402"
                     /translation="MAHQAPYLLGRFLDPIYALMVGTLSYYLYERKVGRPEGHRLNEL
                     IMKKYHRRFSREN"
     gene            <271063..>271482
                     /locus_tag="HG536_0B01460"
                     /db_xref="GeneID:59324403"
     mRNA            <271063..>271482
                     /locus_tag="HG536_0B01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282064.1"
                     /db_xref="GeneID:59324403"
     CDS             271063..271482
                     /locus_tag="HG536_0B01460"
                     /inference="similar to AA sequence:RefSeq:NP_013255.1"
                     /note="ancestral locus Anc_1.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137959.1"
                     /db_xref="GeneID:59324403"
                     /translation="MERKVDLTGDHDALPTYTAHLVPCKVRYSGPTAEFQDNLHMDSE
                     HHRSLKKPEAEQQCDVSHVTYIRGRKIVGRQVFGSAEYTAFLMNSSSDASGDLTMKPI
                     ARVSEIVNYERDGNEGRLHEEVGRLEELLELSDMVHS"
     gene            <271671..>272657
                     /locus_tag="HG536_0B01470"
                     /db_xref="GeneID:59324404"
     mRNA            <271671..>272657
                     /locus_tag="HG536_0B01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282065.1"
                     /db_xref="GeneID:59324404"
     CDS             271671..272657
                     /locus_tag="HG536_0B01470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137960.1"
                     /db_xref="GeneID:59324404"
                     /translation="MGIKRSSVQGSRERDIKMVKCDVKIRFFEGLPHEIVIRILSLIS
                     RRDLIALSSANHGLRRLFLPYLFAYTKVSWDDLISNWNKHQKPFPIGVSQLIESLRLT
                     GCCSKSEWTFPFAELYSSPRLPNLKSLAMPTSGSTNFFKYSSKGSHLRRLKITATKPG
                     SVFNLEHLRPFEQLKKLSLQDYEIESFDEDPSCCRLLDSLELINCSWCYPFELENFGR
                     CKIQKIELCYSNAFIISERFKMFLSSPNFENLNHLSITNHASNLKLTLSVQVVKLIES
                     NPTLVTLKLNGNIYDETLQQFTASDIDNCINHVALNNVKIFYSSFFRKHQAV"
     gene            complement(<272683..>275010)
                     /locus_tag="HG536_0B01480"
                     /db_xref="GeneID:59324405"
     mRNA            complement(<272683..>275010)
                     /locus_tag="HG536_0B01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282066.1"
                     /db_xref="GeneID:59324405"
     CDS             complement(272683..275010)
                     /locus_tag="HG536_0B01480"
                     /inference="similar to AA sequence:RefSeq:NP_012331.1"
                     /note="ancestral locus Anc_1.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137961.1"
                     /db_xref="GeneID:59324405"
                     /translation="MEDLLKVKGIVVNIAGNLNTRDYLTFQQINKNVHDAHLHGYDDD
                     RYWCEKLLRMGLKKDIELEEASGALGSLSETSEDSASIFDVVRTFSSKNAKQTYRRFY
                     RCFHSYCVKLKQNNMAHFFPEHYDNDPVMQVKIFNYISRYNKSNYNDPQECQTIEQNL
                     AILKEIFTNSVLQEMEDNYNLENYEAVNRFILVLLLCHEEKNAVEFFRSKAEYAGKPI
                     SFESFFNDDGVLETKLLVDTLVEMRDFLNSKIKLIDLLFEDRYPVVLQFIESFIQDTL
                     LDFLNNLFSLNDARLNFMPVVYSLVTKSMCDEMIESKNAGPSFHEVMKEFLDMYLEPM
                     IIKYLDMQPQAFEKETSEKFLEYKKEAAIKEKEASEYIYNSLRDQSFDEKNIVDDKND
                     FLSSFTRIFKLPNNERQKTEEQLQLAYNLNLITNNLQNIKTLVSLDLCYKIVKKAQDR
                     TDQMCSFYAVENATQIVKVRCQELFKILIDQLSTNHIKPAFDKAMTLLKRYDSNEIQR
                     VELKLEGVETQVEPLVQFTELINIGDIILQMISIFYRDELLHKNIIDKNRDFLNDVVQ
                     AKKNFENLLDDYVAEGLNIGINKLMDEVEFVFNTVQIPTDFNPDPKDRNSREIKPTQC
                     AEKIVELLSNHSFLLTGATDKGTIDVYQQEIGERFFNEIVKHIKKNFISSDGAIFLIC
                     DLNCYYDFIAYKLKQKNIVPLFAALKNVAQLYLISGKDSKELGKMISDAGRFHGIFSQ
                     EEIYEFVERRSDWVKVKRDVEKVIYGLGVKDCTIM"
     gene            <275164..>276291
                     /locus_tag="HG536_0B01490"
                     /db_xref="GeneID:59324406"
     mRNA            <275164..>276291
                     /locus_tag="HG536_0B01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282067.1"
                     /db_xref="GeneID:59324406"
     CDS             275164..276291
                     /locus_tag="HG536_0B01490"
                     /inference="similar to AA sequence:RefSeq:NP_012332.1"
                     /note="ancestral locus Anc_1.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137962.1"
                     /db_xref="GeneID:59324406"
                     /translation="MANQAVSTSKMNDINVLTGSVRNGELLREAIEKTAKYVVENGSS
                     FEEKLKGDARFSFVMPGDENYELYQQTLSQERSSRASEDEQAGRREMPKEPYAFCFSN
                     YDENITQRDLEIIKLAAAYCVANESNNYLEKMRHEFANDELLVFLNPDHALNNTFVQF
                     VNQYKQVKNNSLGAPFFEWRKGDYKFQILQRSFQRAEFNVYNKESRAKKDKVLSLQKI
                     QFAAYDWTRFKVVNKVTLPTSDSSDLPAPLDFNQLALKRLEKSDMLSVFDKLEAEEPR
                     KGPKSKKRKLKAAGATRLKMGKTTTDTEDKAELRYIKCPITNKLIPEDKFDKHLQVLL
                     ADPHYKAEREKFEAKHRLSNLSSAEVYENIKRVAKASSPST"
     gene            277078..277172
                     /locus_tag="HG536_0Btrna4K"
                     /db_xref="GeneID:59324976"
     tRNA            join(277078..277115,277136..277172)
                     /locus_tag="HG536_0Btrna4K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAA"
                     /db_xref="GeneID:59324976"
     gene            <277354..>279111
                     /locus_tag="HG536_0B01500"
                     /db_xref="GeneID:59324407"
     mRNA            <277354..>279111
                     /locus_tag="HG536_0B01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282068.1"
                     /db_xref="GeneID:59324407"
     CDS             277354..279111
                     /locus_tag="HG536_0B01500"
                     /inference="similar to AA sequence:RefSeq:NP_012334.1"
                     /note="ancestral locus Anc_1.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137963.1"
                     /db_xref="GeneID:59324407"
                     /translation="MLHVNVNRIFFKSYSIDPISGHSIYVFDSTFLPEPDEVGDKQIY
                     DMLIDELTDKLIERIPCAPFSLVVFSSGFIQKKISWVYGVKMFSKLPHELRSLLQKTF
                     IVHESFFVRTVYQVLSNAMSIKMLGAYSSQSTKSSEPFSMVHVSNLTELSQLIDITRL
                     RISLNVYLHDYQINDYIELPDGYYSRLSSVGSRQYRQLIFDKIFKRLRLEAVANELIF
                     QKPGSYKKVNILLDVIERNNYVDLSQWDIYSLASVFLHFLRNKSQPLIPIDLVPLPIK
                     DDFQYTFQTFYNIIVHNHYFELLKAIFPLFISILECSDVTKHNKTSLGKALTPTLCKE
                     KMSMMSADRLALGGRFIRNLFEYFPAIVDQLHNRRTAMAASVTSAIEQPQRPTKLTAP
                     VALPPPNIPRARKSSPSRYGDLKSTDASRSSSQQSDNSRAVSSASTFISEGGPILKNR
                     ELSISLRVHNDSVTTLTDESTESRSTSPVRTAEAINQMVTDDTADDKSTDNANNKITA
                     EPTNVSSEKYSKIVQFDKDLEKQKQLSNKANLNAKFSLQGYSDIKVGNKVSKLAALYE
                     ERLQGLQILNQINKTESHS"
     gene            <279517..>283608
                     /locus_tag="HG536_0B01510"
                     /db_xref="GeneID:59324408"
     mRNA            <279517..>283608
                     /locus_tag="HG536_0B01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282069.1"
                     /db_xref="GeneID:59324408"
     CDS             279517..283608
                     /locus_tag="HG536_0B01510"
                     /inference="similar to AA sequence:RefSeq:NP_009967.2"
                     /note="ancestral locus Anc_1.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137964.1"
                     /db_xref="GeneID:59324408"
                     /translation="MNSGISATTPLFLHNDDDFVSPTRSLQINFEHSEEGMLELPEQQ
                     YKSTAGHRKDHSSKSLSSVSDTSFQTAPSAHIEVRADAEDEEDLTLMSNNALTGFRGY
                     QEELADNTPVIGRKSPTEEDVMTPRCIRDNNTEKSHESEGDRALLYKEPETGLGISKR
                     ESSITISSYIKTANSTKIVSPTSSPIRAIRASAIINNRAGRKLLDGGLQKGNPVSNDQ
                     SNSVSNSNTSLAPDLDKRPMGLSKAPTLKKSSEISLHDDSFAYLFIIAIHSFNAESLE
                     NPEDVSICLSFEKNDIAFVHTVDESGWGEVTLIRNRKRGWVPFNYFSDTVKPTESSRS
                     DLSTYDLIKSRLPLQELLSACAKFLLHPQDTRLPGAKEATFNVEYINQIRDGVKTVLE
                     MTGCVSRSNDLVKQKPDLRKARKLLLANWYNLMIKADFHKHSTNPANIQKLIDLTFEV
                     LNRAFEFFNIWSTETTAAIQNPEQKAEDVQQATKSALVPSASDLQMPHLTKPPTAMAR
                     LHEIYDLLILYVGLILGRLDLIEHNPSGVEALEYIVHQVIVLLRELLYINKSCSAIIQ
                     EKFQYAYENTLHKNLDPLFSLVSELVSCVKALVTETLKEDFGHTARHLSIKEGTYHYT
                     DQGQRLCDVVANMTGLISDSISGCSSYLRLIGDFQLSADRQNLDFQKIKMTPAKFFQR
                     CSVGLTKHIDKGLLKEKFFEAESGRDPRSWKSVSRYSCIRSGSMDDPGITRRGTQFLQ
                     DYLQDQKPFGRDSTFEAFRPDELEQEKQDSKWDNINDKQLMLDELVFDNDGNIVAGSL
                     RALVYKLTDEIDKPDDFFIATCLYNFRSFGTAIDFIDLLISRADLNDSTSQFDCSTSN
                     GPYSSRSSRIKNRRKLVSFIFQTWMESFWDSSTDYKVLPTMINFFNEGLSLHLPIESK
                     RLIEIAAKLSAWKPTSKAYKRGQKVHPQLKPKKIRSRCNSIYSDISSSSLSSRLSVFS
                     LDEKIIEEYELNHVQPRSVSSISLPLPVLNLGTSSLLSKRNVQDMERLVNRYRSMVGK
                     SIQTTTPNAFVPKSELSLLIMEWNDLVNRCKEVPRNLIHNDMSLVDLNALEVAKQLTL
                     IESRLYLNIHSFELLDDKLLEKNLDEKSSPNVTTLLGFTNRLSNYVFETILSPQISLK
                     ARVSRLKVWLKVALSCSYFRNYNSVASIMTALQNHAITRLNTIWTDLRKKDIELYEYL
                     SRIVHPNNNFKVYRKKLKRYMKEDAVGTLSQDRSSVPVVPFFNLFLQDLTFISEGNNT
                     FRNPDSFRPHKLINLDKFYKITKTLNITAYFQVDYEVQEERTENLSSFFNLNDQVDGD
                     TKSIKPIPLLQEFILYEIWRVNILYKETTDRAYQLSLQLSPRK"
     gene            complement(<283785..>286154)
                     /locus_tag="HG536_0B01520"
                     /db_xref="GeneID:59324409"
     mRNA            complement(<283785..>286154)
                     /locus_tag="HG536_0B01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282070.1"
                     /db_xref="GeneID:59324409"
     CDS             complement(283785..286154)
                     /locus_tag="HG536_0B01520"
                     /inference="similar to AA sequence:RefSeq:NP_012335.1"
                     /note="ancestral locus Anc_1.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137965.1"
                     /db_xref="GeneID:59324409"
                     /translation="MLSAVSRVNLKRSLATHAQFPATPKDFATRMPPYAKLLSKLGKV
                     KELTNNAPLTFAEKILYSHLCDPEESITSSKLEDIRGLQYLKLHPDRVAMQDASAQMA
                     LLQFMTTGLSETAVPASIHCDHLIVGKKGETEDLKSSIATNKEVFDFLQSCGKKYGIQ
                     FWGPGSGIIHQIVLENFSAPGLMMLGTDSHTPNAGGLGAIAIGVGGADAVDALTGTPW
                     ELKAPRILGVKLTGRLNGWGSPKDVITKLAGLLTVRGGTGYIVEYFGAGVETLSCTGM
                     ATICNMGAEIGATTSTFPYQEAHKLYLQATGRGAIAEHADVALREYGFLRADEGAQYD
                     KVIEINLSELEPHVNGPFTPDLSTPISKYGEKSLKENWPQKISAGLIGSCTNSSYQDM
                     TRAAELVSQAAKAGLKPKIPFFVTPGSEQIRATLERDGLIETFTKNGAVVLANACGPC
                     IGQWAREDIPKSSNQTNSIFTSFNRNFRARNDGNRNTMNFLTSPEIVTAMIYSGSAQF
                     NPVTDIIELENGKKFKFEPPKGQDLPIKGFEHGRDEFYPANDPKPEAEVQVEVSPSSD
                     RLQLLEPFEPWNGKELQTNILMKVEGKCTTDHISAAGAWLKYKGHLENISYNTLIGAQ
                     NKETHEVNRVYDFDGTAYGIPELMMKWKQEKRPWTVVAEHNYGEGSAREHAALSPRFL
                     GGQIILVKSFARIHETNLKKQGMLPLTFADEADYDKLASGDVLQTVGLIDMVAKGGDN
                     GGQLDVKITKSSGESFIIKAKHTMSKDQIEFFKAGSAINYIGNLRKTRQ"
     gene            complement(286389..286461)
                     /locus_tag="HG536_0Btrna2T"
                     /db_xref="GeneID:59324970"
     tRNA            complement(286389..286461)
                     /locus_tag="HG536_0Btrna2T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59324970"
     gene            <291221..>293884
                     /locus_tag="HG536_0B01540"
                     /db_xref="GeneID:59324410"
     mRNA            <291221..>293884
                     /locus_tag="HG536_0B01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282071.1"
                     /db_xref="GeneID:59324410"
     CDS             291221..293884
                     /locus_tag="HG536_0B01540"
                     /inference="similar to AA sequence:RefSeq:NP_009966.2"
                     /note="ancestral locus Anc_1.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137966.1"
                     /db_xref="GeneID:59324410"
                     /translation="MRFSHFLKYNAVPEWQSHYMDYSDLKNLIYTLQTDELKLNGEVV
                     EVAENGELKGSSSPRQMARRLFKSKLFNKGSAAERAGNDAKNDDNIQEETFELEELPS
                     PKLGPSNHLKNAPFRKVKEKFFESRRSSLSSEGKTLLSPQDTFVRSLEEEKLKVDDFY
                     KRMEAKFYEKFDNLVKDLEKIGVCGLSDDSARSLNNGSSFGQEDERSQEPSYRAQNDF
                     YSEEEFDEEDDYDVQDNTALLNYSQFNVKSQKTSLLKQSTVNLYIDLCQLKSFIELNR
                     IGFSKITKKFDKVMHQNTRRDLIQSEEFYKDTYIFQHATLRVLNGKISKAIEFYAILK
                     DQPSNIEMCKHELKSFLHDHIVWERSNTWKDMLGLLSQEKDLQGEGTGSDFSRSKLEL
                     EYYQYYLPRPLNFKVFQVTKLMVPKLFFTWKAFKIAFIITVTGVLLGVKTFNDEAQHR
                     CMALVECVAFLWASEAIPLYATAILVPLLVVLFRVLKDSEGHVLGAAAASSEILSQMW
                     SSTIMILLAGFTLGEALAQYDIARVLASWLLAAAGTKPRNVLLMAMGVVFFLSMWISN
                     VAAPVLTYSLLSPLLDPLEASSPFAKALVMGVALAADVGGMASPIASPQNVISMNFLK
                     PYGIGWGQFFAVALPTGILSLLCAWGVMCFTFKFHKTRLQKFTPIKTRFTLKQYFVIV
                     VSIGTILLWCVESKIENAFGSSGQIAAIPIVLFFGTGLLSTHDLNSFPWSIVVLAMGG
                     IALGKGVSSSGLLGTIARSLQRKIANDGLFAILCIFGILMLVVGTFVSHTVSAIIIIP
                     LVQEVGDRMTAKNSAPVLIFGCALLASCGMGLPSSGFPNVTAISMTDKKGQRYLNVSS
                     FITRGVPASLLAFLCVITIGYGISISVIKGV"
     gene            <294198..>297743
                     /locus_tag="HG536_0B01550"
                     /db_xref="GeneID:59324411"
     mRNA            <294198..>297743
                     /locus_tag="HG536_0B01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282072.1"
                     /db_xref="GeneID:59324411"
     CDS             294198..297743
                     /locus_tag="HG536_0B01550"
                     /inference="similar to AA sequence:RefSeq:NP_012338.1"
                     /note="ancestral locus Anc_1.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137967.1"
                     /db_xref="GeneID:59324411"
                     /translation="MISDDKTCQTIEASEDAMLDASSKDGGKAVERAEEAGRRDESPD
                     ILTLESQREIISKILKDHSELAREGDEMCIIPQLWYDKFLDEEISDSTELGPMDTSSI
                     CRDYKNFILEDYERRPYLSIPRSAFEKLVEWYGLTARSQPVTTVLVHDSEAGGLVTEY
                     NKCILKIHYLVLSSEERRYANEHPIYITTSRLSTVGDVLEEIYQAFYRKESHLGVDNK
                     TKVWYVKDSSTDNRDSVLSLTYKLNPLQFMELPVKTLVTSQLEKYTLKKLEITSGDFV
                     VEVKQRGQNYHWLSNYFIYNKLKPSEGTIGLSNLGNSCYMNSALQCLMHIPELRDYFL
                     YNGYESEINIENPLGYQGHIAKAFSMLVQALFMDSIVPRNTAFSPTSFKSTIGHFNSM
                     FFGYMQQDSQEFLAFILDGLHEDLNRIRDKPYLEKPSLTPEMDADDPKTVKKLADDTW
                     KMHLLRNDSIVTDLFVGLYKSTLECPQCETVSITFDPYNDLTLPLPVNATCCLNIKVF
                     PQNSPPCIIKIEISKTASYQQLKTYVGEYAKIEPSNLYGCEIFNHQFCSNYESPETMS
                     HFLPVQELISDPEDVIFYELVASPTDIIVPVLNTRIEEGFETASLFGVPFFIVLSSDE
                     AKNPGLIRLKLEKYYTNLSGGFVEFPLSTMNEVPSIESRPLLQQKYNRDELCAHEEIF
                     RYSATDTANLDGYFSIKVLQSSKLKPFARVPSTESDSQFYIPTSRLNLKEASNINELL
                     DPIVRDIYDYSNFEKRFTSCGESENHLEQTNNHYSSEAACEDQIGSDIEIDSVGAAED
                     MGKSREGEEDEMNRKPDAEINAIIQPRDIILCEWTTSGIEEAFAQDKDIDWEHPAELV
                     NKEITRGSTQEGKTKKENITLYDCLKLFSKKEVLSMDDSWYCPTCKEHRQASKQIQLW
                     NTPDILLIHLKRFENQRSFSDKIDDVVHFPIEGLDMGEYIVESDSKGSIYDLIAVDNH
                     YGGIGGGHYTAYVKQNDKWYYFDDSRVTETDPQHSIAGSAYLLFYLRRTGNGKVGGEK
                     LQAVLNESRREHDLKMQKMQEQQYALYVTNKTDEEEETDDESNASDDSNDDHLSDACC
                     NAQPSINNSARGFVSRPSQRSIASLEVGSANRELAEGLENNLGRRKLRKTHTAPSTSN
                     SPASSVSSDGAESISAVLTGSKINDGVIAQSPAKE"
     gene            complement(<298012..>299019)
                     /locus_tag="HG536_0B01560"
                     /db_xref="GeneID:59324412"
     mRNA            complement(<298012..>299019)
                     /locus_tag="HG536_0B01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282073.1"
                     /db_xref="GeneID:59324412"
     CDS             complement(298012..299019)
                     /locus_tag="HG536_0B01560"
                     /inference="similar to AA sequence:RefSeq:NP_009965.2"
                     /note="ancestral locus Anc_1.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137968.1"
                     /db_xref="GeneID:59324412"
                     /translation="MSITVVGSLNYDLVTYTDRLPEAGETFRANSFETHAGGKGLNQA
                     IAIARLRHPGSKSLLRMVGNVGEDMFGQELLDLLTENGVDCKEVKKVGGMSTGVATIL
                     VEEKNGGQNRILLSEGANGKTVYGPDELSRIFNGKSSGGEKHYVVFQHEIPDPSSIMS
                     WLKLNRPEFQIVFNPSPFKHLELEAWKNVDVLIVNEIEALQIVEAVYPEEECESYRSM
                     IGNDFLGGYQKLCLEFQRRVVSQTNSATVVITLGSQGSLFCSKDHPQVGYTPSLTGIN
                     VVDTTGAGDTFLGSLVSQLHSGARLEDAIRFSTKSSSLTIQKKGAAETIPTFSEVMSL
                     E"
     gene            <299287..>300447
                     /locus_tag="HG536_0B01570"
                     /db_xref="GeneID:59324413"
     mRNA            <299287..>300447
                     /locus_tag="HG536_0B01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282074.1"
                     /db_xref="GeneID:59324413"
     CDS             299287..300447
                     /locus_tag="HG536_0B01570"
                     /inference="similar to AA sequence:RefSeq:NP_009964.2"
                     /note="ancestral locus Anc_1.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137969.1"
                     /db_xref="GeneID:59324413"
                     /translation="MAENEAESLEIHPITFPPQVLARIEPELSLQRHLSLGIRPCLRK
                     FEEFREVHVDQGSLSRYNSRSGGSNATSNSILGSNVLKCGSTFVITSITGAIIEETVP
                     LRSENIGEEELMELTKRRDEVGKYATVFPLVEVERGRVGAPTDEEMTLSQRLHDCILH
                     AGIIPKRALDVKCGVRITGKDGDVKIVYPDEQAEDVTVSHLQQQKKWSYVLYAKQRVF
                     SRKGPVFDLCWNSLIYALKDTKLPRAFIDERATDFKMTVRTRGRSATIRETYDVKCDP
                     EAWVPLNLVESKIGYASNFGIVDLDPEVQLNDDEDEDMELPTSLLLADIDTEAEEACI
                     RSTISIIGDSSGNLSSVSLVGGGAKITPEAIRNALSLSRKRSADLSSKLATA"
     gene            complement(<300578..>301630)
                     /locus_tag="HG536_0B01580"
                     /db_xref="GeneID:59324414"
     mRNA            complement(<300578..>301630)
                     /locus_tag="HG536_0B01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282075.1"
                     /db_xref="GeneID:59324414"
     CDS             complement(300578..301630)
                     /locus_tag="HG536_0B01580"
                     /inference="similar to AA sequence:RefSeq:NP_009963.1"
                     /note="ancestral locus Anc_1.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137970.1"
                     /db_xref="GeneID:59324414"
                     /translation="MKQEYAIQWLEEYAIQLLEEYPKLREFMPTLDRPFFNISLWDHF
                     NCVATKVTAGRFIPNEFEFVEGELPLSTLPSVVAAIVTYYVVIFGGRAVLKGSKPLKL
                     NFFFQLHNIFLTTASLLLLVLMIEQLIPMISRNGLYYAICNIGAWTQPMVTLYYLNYL
                     IKFVEFVDTLFLVLKHKNLTFLHTYHHGATALLCYTQLVGTTAISWVVIGLNLGVHVV
                     MYFYYFLAARGIRVWWKEWVTRFQIIQFILDIGFIYFAVYQKVAHLFFPSFPHCGDCV
                     GSTPATLSGFAIISSYLILFISFYIEVYRNKGTKKSRVIKRARGGVAAKVNEYVNVDL
                     KNVSTPSPSPVRRRKI"
     gene            complement(<301924..>303612)
                     /locus_tag="HG536_0B01590"
                     /db_xref="GeneID:59324415"
     mRNA            complement(<301924..>303612)
                     /locus_tag="HG536_0B01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282076.1"
                     /db_xref="GeneID:59324415"
     CDS             complement(301924..303612)
                     /locus_tag="HG536_0B01590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137971.1"
                     /db_xref="GeneID:59324415"
                     /translation="MGKDLPPQVYSLENGFAYSHHPYGSQIARPDGPLLMQDVHHIEN
                     MAHFDRERIPERVVHAKGGGCRFEFELTDSLSDITYAAPYQEVGYKCPGVVRFSTVGR
                     EQGSPDTVRDPRGVSWKFYTNWGNHDWVFNNTPVFFIRDGLQFPHFIHTQKRDPQSHL
                     GQDDDSSTFWDYLTQNVESIHQIVYMFGPRGTPAHWGDMSSYSGHTFKFINKKNELTY
                     VQIHVLPVNGFKCLSTEEAKKLAGSNPDYNQAKLFRQLENGEKSKYNCYVQTMTPKQA
                     ENFRYSVNDLTKVWPHSQFPLRKFGEITLTENVDNFFEEIEQIAFSPSNTCIPGIEPS
                     NDSVLQARLLSYPDTQRHRLGANYAQLPVNRPRNAGCPYASLFSTGSKTRKQAADCPH
                     TLSNFQRDGPQCLYNKGGEPNYISTLSKASMNFKASTDDSLSKKFAGVVLDEEAKRSL
                     IQQEAERERHEKIINGKINDYHFKSGVSELDLEQPRALYEKVFDEETKKIFIDNVVDH
                     VSLCLDPAIKARVTQYFGLLNRDLGATLAKRLNVEYQPLDLAGYAEAVGISSAA"
     gene            complement(<304118..>305815)
                     /locus_tag="HG536_0B01600"
                     /db_xref="GeneID:59324416"
     mRNA            complement(<304118..>305815)
                     /locus_tag="HG536_0B01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282077.1"
                     /db_xref="GeneID:59324416"
     CDS             complement(304118..305815)
                     /locus_tag="HG536_0B01600"
                     /inference="similar to AA sequence:RefSeq:NP_011602.2"
                     /note="ancestral locus Anc_3.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137972.1"
                     /db_xref="GeneID:59324416"
                     /translation="MDKDLPPQVYSLENGFAYSHHPYGSQIARPDGPLLMQDVHHIEN
                     MAHFDRERIPERVVHAKGGGCRFEFELTDSLSDITYAAPYQEVGYKCPGVVRFSTVGR
                     ERGSADTLRDPRGASWKFYTNWGNHDWVFNNTPVFFIRDGLQFPHFIHTQKRDPQSHL
                     NQDSDTSTFWDFLTQNVESVHQIVYMFGPRGTPAHWGDMSSYSGHTFKFINKKNELTY
                     VKIHVRPVNGFKCLSTEEAKKLAGSNPDYNQAKLFRQLENGEKSKYNCYVQTMTPKQA
                     EEFRYSINDITKIWPHSQFPLRKFGEITLTENVINFFEEIEQIAFSPSNTCIPGIEPT
                     NDTMLQARLFSYPDTQRHRLGANYAQLPVNRPRNAGCPYATLFSTGSKTREQALGNFD
                     CPYTLSNFQRDGPQCLYNKGGEPNYISTLSKTSLSFKNLTDDSLSKKFAGVVLDEEAK
                     RSLIQQEAERERHEKIINGKINEYYYKSGLSELDLEQPRVLYERVFDEETKKIFIDNV
                     VDHVSLCLDPAIKARVTQYFGLLNRDLGATLAKHLNVEYQPLDLAGYAKAVGISSAA"
     gene            complement(<306262..>307530)
                     /locus_tag="HG536_0B01610"
                     /db_xref="GeneID:59324417"
     mRNA            complement(<306262..>307530)
                     /locus_tag="HG536_0B01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282078.1"
                     /db_xref="GeneID:59324417"
     CDS             complement(306262..307530)
                     /locus_tag="HG536_0B01610"
                     /inference="similar to AA sequence:RefSeq:NP_015433.1"
                     /note="ancestral locus Anc_3.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137973.1"
                     /db_xref="GeneID:59324417"
                     /translation="MSKDTSNQVSNDSDENGEETRFVDPAVHRVPNYEVSEKAFILTQ
                     PKVNADKQSLIESILELVKKEEMAPYYKYLCDEYLPSGTLKFDEALYQELLKKNEEKV
                     ASLKNKLTEVEENDEGELEKAQCWIELGEYYTQIGDRANALDTLEKALGKAISTGAKI
                     DVMFTITRIGFFFNDQFFVKEKLEQINVMIEKGGDWERRNRFKTYKGIHCLAVRNFKE
                     AAKLLVDSLATFTSVELASYESIATYASVAGLFTLERTELKSKVIDSSELLSLLNTTS
                     ALQSISSLTISLYTSDYSSFFPFLLETYENVLLPCKYLNAHSDFFVREMRRKVYAQLL
                     DSYKTLSLRSMAGAFGVSVEFLDNDLGKFIPNKQLNCVIDRVNGIVETNRPDNKNAQY
                     HLLIKQGDGLLTKLQKYGAAVKLTGSERVA"
     gene            <307741..>308373
                     /locus_tag="HG536_0B01620"
                     /db_xref="GeneID:59324418"
     mRNA            <307741..>308373
                     /locus_tag="HG536_0B01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282079.1"
                     /db_xref="GeneID:59324418"
     CDS             307741..308373
                     /locus_tag="HG536_0B01620"
                     /inference="similar to AA sequence:RefSeq:NP_015432.1"
                     /note="ancestral locus Anc_3.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137974.1"
                     /db_xref="GeneID:59324418"
                     /translation="MSLAHPDTSNYPFKFEPFLRQEYSFSLDPDRPICEFYNSREGPS
                     SCPRGVSCPRKHVLPIFQNKIVCKHWLRGLCKKNDQCEYLHEYNLRKMPECVFYSKNG
                     YCTQTPECQYLHIDPQSKIALCEDYTMGFCPLGAQCKKRHIKKVICPRYITGFCPLGR
                     KECDMAHPEFVVPSKISRLWIKKDEEINTRKSDAEKERRLNAIINGEIEI"
     gene            complement(<308351..>309421)
                     /locus_tag="HG536_0B01630"
                     /db_xref="GeneID:59324419"
     mRNA            complement(<308351..>309421)
                     /locus_tag="HG536_0B01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282080.1"
                     /db_xref="GeneID:59324419"
     CDS             complement(308351..309421)
                     /locus_tag="HG536_0B01630"
                     /inference="similar to AA sequence:RefSeq:NP_015431.1"
                     /note="ancestral locus Anc_3.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137975.1"
                     /db_xref="GeneID:59324419"
                     /translation="MASMNTPPTSPSLAFGTQASDGGVPCSSTQCLARDLRRWGNECP
                     KSPCSARGDSDVDERLLCSLAGRGLDLIADAKAHLGTLPVGRGPYCYVYEVLNTGKVI
                     KFPRSKRHSKMVLLEAAVQYTIALQCRHVTPVLAVSYVSKQQFTGLRASECVPGIVMP
                     RMRMDLQRFYQAHDHVEVRRIWWKAAEQTLSCLQSLKTQAFIHGDIKTANILLDFEQE
                     PNFFLADFSTAKKVPRGSRAIRGASIQATMEYCAPETLRDSIESFDTDLYSLGLCLLA
                     LITRQEPFRELQQAKNHGTYSVQQSQWLVNAVLKNDPINLNVLSKSLHCQWPDELSFL
                     SLILVKRLPVEDCIVAISRFHR"
     gene            <309820..>310845
                     /locus_tag="HG536_0B01640"
                     /db_xref="GeneID:59324420"
     mRNA            <309820..>310845
                     /locus_tag="HG536_0B01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282081.1"
                     /db_xref="GeneID:59324420"
     CDS             309820..310845
                     /locus_tag="HG536_0B01640"
                     /inference="similar to AA sequence:RefSeq:NP_011600.3"
                     /note="ancestral locus Anc_3.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137976.1"
                     /db_xref="GeneID:59324420"
                     /translation="MHRTYSLRNTRAPTASDLQNPPPPPASTRGKFFGKGGIAYSFRK
                     NAAGSWGPELSRKLSQLVKIEKNVLRSMEIASNERRDAAKQLSIWGLENDDDVSDITD
                     KLGVLIYEISELDDQFIDRYDQYRLTLKSIRDIEGSVQPSRDRKDKITDKIAYLKYKD
                     PQSAKIEVLEQELVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSIIEHSEKIALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAETALNEWTLDSAQVKPTLSFKP
                     EEYENYEDQVEEEEEVEGGQEGAEEEGRWAQHEEAVQEVTSEQERHNHEKHVHEAHGE
                     TATTTVA"
     gene            <311145..>313685
                     /locus_tag="HG536_0B01650"
                     /db_xref="GeneID:59324421"
     mRNA            <311145..>313685
                     /locus_tag="HG536_0B01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282082.1"
                     /db_xref="GeneID:59324421"
     CDS             311145..313685
                     /locus_tag="HG536_0B01650"
                     /inference="similar to AA sequence:RefSeq:NP_015430.1"
                     /note="ancestral locus Anc_3.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137977.1"
                     /db_xref="GeneID:59324421"
                     /translation="MSSNSSSSWDTDVLEGQLFKKLTKYSLYLQKLSTASQVKKLSQI
                     IERDHEEQLRSLDQFIQESQTKHNRAVRSLELQRTDLTTTLSKYHTSLTAISNSNVTA
                     TAIHDDIVTVEREDLLIKKTFQFVQSVSILKNNISVIHSALEARDHQLAAKSIHEIRS
                     LPKEIVGSEFAKKVVPTSDIPEEPAVLIEKWCSDLTDIFKADFLEAAKAQDIPQLTLI
                     FKMFPLIGQNSLGLDLYSKYVCGIIAEESRKIMTMEAKKRGVFAQALLHLFKIVSTII
                     NDHSKVISACYGDNFMIHVMEKVQKEADLQAGLILDTFNETRKVDRITRAISSLNLSH
                     QEFVNEYGLEPDTVRARTHKMNDQVSERDGGLSDISDITDVLSEFSQMLQNWSMYSRF
                     FSVRWYEFLNVTNLEMVTPPPPIADSQYFSKLQKDAFYANFEILVTHCLEKSFKQSLS
                     LEELPSINDLVIFKRVEHTDIFSYPVSSILDDLSLLIRKNLILTLNTGQTQIFSRFLD
                     QIAKFYQNEYLVRYMQTELKNLQSRLNSSLVLKKYVPKAGPDGSLSSRAASPSAMETY
                     ATNKLSQFGFNFRGAAANALTNFQSNLQAVVSDEDAVLSLHHYLIYVNTLYMNPKIAH
                     RLFITEILEENPRLLHDNFPFGTDADILAKKVASCEALLAKQTNKLQKWSIKFLFENV
                     LANKIRTILSNILINSNDNHYISGADDYDDLSTVHEFISKWNTHMVPYENILTKDAFL
                     ELLSLIVNCIIEKLEQRIWALQVNELGATKLDRELSLLIATVCQQNYALREKFAKLTQ
                     LVLILGFDDDDFDVDGGDLKEEISNDINWVISPQERVKARSLKIDRRH"
     gene            <314112..>316718
                     /locus_tag="HG536_0B01660"
                     /db_xref="GeneID:59324422"
     mRNA            <314112..>316718
                     /locus_tag="HG536_0B01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282083.1"
                     /db_xref="GeneID:59324422"
     CDS             314112..316718
                     /locus_tag="HG536_0B01660"
                     /inference="similar to AA sequence:RefSeq:NP_015429.1"
                     /note="ancestral locus Anc_3.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137978.1"
                     /db_xref="GeneID:59324422"
                     /translation="MGSESVMSDNGSSESAGPKPATSDHTISSNERLNQNVPSTPSES
                     LRGSPEANEPMRHRQSQKEEDYLATSGELKLELPDTLEHEDFSKLLEFSEKHDDDLFT
                     TQEILRHAIHEAGAEDQSIENLSTELRDTGLEHNDEEKSEINTSPKDSQSSAQDYGHE
                     NEKAVSDIKKETTSPRRTSFEINQSESSREQSSHTFDDRIKGTASVPLNSGEESPKNE
                     QEPSATTILEKGNLLQSKRHDSLTPVMFQQHELLTAQADPHRDSGNQDNVMLSDEQPT
                     ISAYARLDFQSFTFYVQTLHVIIGRRSENDFSHKVDVNLGPSKSISRRHAQIFYNFGT
                     GRFEVSVIGKNGAFVDDIFVERGNTVPLKNKTKVQIGQIPFQFVLPEQEKAEQIHPAE
                     QEKGSSQLHKSPDAQKSESPVRVEPGSSRSPETQPVKQVLKKQAPRKEKKPTKVPKKV
                     YALEEIPQEYRTKPTLSYSALLTTCIRKYSSPKGMTLSEIYNGIRELFPYYKYCPDGW
                     QSSVRHNLSLNKSFRKVSKEGKGWLWGLDEEYIAERERQKKKQAEAAAAKAAAAQRRL
                     EQQQQQRAKKGTIPGTMSSINGTSALPKPNNGKPQNISQTLAANRAADKNSSMDDHQR
                     TMKYLQEQLVVLTRDRKGLSKQAIASILTQALAMTINQVSQAAKSKGITGNPLTALMD
                     KNPQHLNLILAAAVNAATSKVTNGKIKQLVDMSQISDITKHVKPASAGRKTTTSGPTY
                     KASSGNGSLGPGSKGGSSFDPTSLSRFFQPRQPSRVATSPALEPAVPQKRFLEDNDEE
                     EESSDSDESSSSEEENSDDGDDSDDTDDTDDTDDTAENEDPDDEPRDNGTNGDDKHDS
                     QHRGDVTDDNSE"
     gene            complement(<316859..>317722)
                     /locus_tag="HG536_0B01670"
                     /db_xref="GeneID:59324423"
     mRNA            complement(<316859..>317722)
                     /locus_tag="HG536_0B01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282084.1"
                     /db_xref="GeneID:59324423"
     CDS             complement(316859..317722)
                     /locus_tag="HG536_0B01670"
                     /inference="similar to AA sequence:RefSeq:NP_015428.1"
                     /note="ancestral locus Anc_3.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137979.1"
                     /db_xref="GeneID:59324423"
                     /translation="MEAIADRFTASKALVKELQYDREEELERDFITGTSQFQRLAPSI
                     ALPPISTPQEFLRAHTDDSKNPDCKIKIAHGTTTLAFRFQGGIVVAVDSRATAGSWIA
                     SQTVKKVIEINPFLLGTMAGGAADCQFWETWLGAQCRLHELKEKERISVAAASKILSN
                     LVYQYKGAGLSMGTMICGYTKKEGPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDAN
                     YKWELSVEEALYLGKRSILAAAHRDAYSGGSVNLYHVTENGWVYHGNYDVGDLFWEVK
                     EKEGSFNNVVG"
     gene            <318178..>318702
                     /locus_tag="HG536_0B01680"
                     /db_xref="GeneID:59324424"
     mRNA            <318178..>318702
                     /locus_tag="HG536_0B01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282085.1"
                     /db_xref="GeneID:59324424"
     CDS             318178..318702
                     /locus_tag="HG536_0B01680"
                     /inference="similar to AA sequence:RefSeq:NP_011599.1"
                     /note="ancestral locus Anc_3.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137980.1"
                     /db_xref="GeneID:59324424"
                     /translation="MSDKSQNPMRELKIEKLVLNISVGESGDRLTRASKVLEQLSGQT
                     PVHSKARYTVRTFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRNKNFSATGNF
                     GFGIQEHIDLGIKYDPSIGIFGMDFYVVVGRPGNRVSRRKRCKSVVGNSHKTSKEDTI
                     AWFKQRYDAEVLDK"
     gene            complement(<318747..>319310)
                     /locus_tag="HG536_0B01690"
                     /db_xref="GeneID:59324425"
     mRNA            complement(<318747..>319310)
                     /locus_tag="HG536_0B01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282086.1"
                     /db_xref="GeneID:59324425"
     CDS             complement(318747..319310)
                     /locus_tag="HG536_0B01690"
                     /inference="similar to AA sequence:RefSeq:NP_015426.1"
                     /note="ancestral locus Anc_3.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137981.1"
                     /db_xref="GeneID:59324425"
                     /translation="MRDLGIEMDYLPFIDDESALEEYEDAVEKSIQEELRKNGEEIHP
                     EARDMKLEELRAYPVHSLYCETSYDGDRLLQQYKRSIPRIDMERYSTDSRGDVDILCV
                     IDSYLRHQELVLERLMPQTLLNQWAINNDFLAASSATLQKVIDDQETNIYNLNSYRKN
                     VQLQNARVFAALEEQWKKSLIDTLNVE"
     gene            <319473..>320429
                     /locus_tag="HG536_0B01700"
                     /db_xref="GeneID:59324426"
     mRNA            <319473..>320429
                     /locus_tag="HG536_0B01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282087.1"
                     /db_xref="GeneID:59324426"
     CDS             319473..320429
                     /locus_tag="HG536_0B01700"
                     /inference="similar to AA sequence:RefSeq:NP_011598.3"
                     /note="ancestral locus Anc_3.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137982.1"
                     /db_xref="GeneID:59324426"
                     /translation="MLVFKRFASSTGAKTVLDEFFTYHTTNAALKPWIYRPKNANILL
                     TMDLKDPVTKAPIKPRKAVPTVAQKVLNDYVASIQPGSNELLEWVRNWTSVTTRKKAL
                     WNYISGSHLQNILVSSFFRVGFYTQVVGLLYSRRRDFVKAGNKTAFDVEHFFNTIIMC
                     SLHRNAYKCLRDKEVAKKKLENAWRQVSNRANHTGLANALIKTYCKQQGLETVPVLEQ
                     LAETEIKLDQPADIATAADGELAAFVFANKNKYLVARTIQEFSEAQDVDPKISQFVQD
                     YQAVCQKLGKEDLYDLYKSSMAETFAANQDSTKQEAPETANA"
     gene            <320953..>322812
                     /locus_tag="HG536_0B01710"
                     /db_xref="GeneID:59324427"
     mRNA            <320953..>322812
                     /locus_tag="HG536_0B01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282088.1"
                     /db_xref="GeneID:59324427"
     CDS             320953..322812
                     /locus_tag="HG536_0B01710"
                     /inference="similar to AA sequence:RefSeq:NP_011597.1"
                     /note="ancestral locus Anc_3.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137983.1"
                     /db_xref="GeneID:59324427"
                     /translation="MSLSEEVIPKKASKDAAGASDAPTPAEGTKKLSNKELKELKKRE
                     KAAKRSAKKQESGISIEQQQQQAQAKREKKQQQREQQLQHQKEQQRKQEERRKKVKQN
                     LKKNTLFGHLETTAERRATILAVTGAISSSKASRITAAGLMLPAVTSALTGSQIPINS
                     SLHTSSGASTATSGANTTNGGSGDAKNDISKGLASMSLESEEFSVVPGVGSVIPNVIE
                     QSFDSPQLVSSVKELLLNKEFIHPAVSLLTSRIANYMIVGSIPRCIAMLEAFQTVIRD
                     YQTPSGTTLSRNLTSYLSHQIDILKKARPLSVTMGNAIRWLKQEISLIDPCTPDKEAK
                     RDLCEKIAQFAREKIELADQLIIGSASDHVENNSTIVTYGSSKVLTDLLLHNAVDLQK
                     KFKVIVVDSRPLFEGRKMADVLRSHGVDVTYALITSLDGILNMSVDYVFLGAHSILSN
                     GFLYSRVGTAMLAMSAKRRNIPVLVCCESLKFSQRVQLDSVTFNELADPEDLTTIDSR
                     NLVDRNNVRGTLLKQFLKERKEEKQKMALENKANNKSTNGASSTRADSHSLDDDKAGR
                     NILDGWQNIPSLNIVNILYDLTPPEYIKKIITEFGALPPSSVPVILREYKSSA"
     gene            complement(<322886..>323308)
                     /locus_tag="HG536_0B01720"
                     /db_xref="GeneID:59324428"
     mRNA            complement(<322886..>323308)
                     /locus_tag="HG536_0B01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282089.1"
                     /db_xref="GeneID:59324428"
     CDS             complement(322886..323308)
                     /locus_tag="HG536_0B01720"
                     /inference="similar to AA sequence:RefSeq:NP_015425.1"
                     /note="ancestral locus Anc_3.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137984.1"
                     /db_xref="GeneID:59324428"
                     /translation="MVVKAVKQASIARNGVGAFVFPCKKITLQYCNWGGSSQGMREFL
                     TSKRLEKLGSQYPFIQFEVLRKSGHPLLRAQYNNGREKVICVRNLNIDNVENKLKLLK
                     DSSGEILRRRTKNDNVETLNKSVRGVWSPIHASMRYRV"
     gene            <324144..>324693
                     /locus_tag="HG536_0B01730"
                     /db_xref="GeneID:59324429"
     mRNA            join(<324144..324190,324255..>324693)
                     /locus_tag="HG536_0B01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282090.1"
                     /db_xref="GeneID:59324429"
     CDS             join(324144..324190,324255..324693)
                     /locus_tag="HG536_0B01730"
                     /inference="similar to AA sequence:RefSeq:NP_015423.2"
                     /note="ancestral locus Anc_3.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137985.1"
                     /db_xref="GeneID:59324429"
                     /translation="MSLLKPASHLLFYSFVFGGTTFYSYVASPLAFKVLDKDHFSALQ
                     NKVFPYFFQMQSFSPAVLALTAPFVLTSGPMAALATASVGGLANLCWLLPLTRRIKEE
                     RRAVADRLKGDELEAADEPLRKQFGKYHGMSLLCNLTNVCGMLVYGVYLCRGLIRHVP
                     K"
     gene            complement(<324844..>325407)
                     /locus_tag="HG536_0B01740"
                     /db_xref="GeneID:59324430"
     mRNA            complement(<324844..>325407)
                     /locus_tag="HG536_0B01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282091.1"
                     /db_xref="GeneID:59324430"
     CDS             complement(324844..325407)
                     /locus_tag="HG536_0B01740"
                     /inference="similar to AA sequence:RefSeq:NP_011596.1"
                     /note="ancestral locus Anc_3.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137986.1"
                     /db_xref="GeneID:59324430"
                     /translation="MSQGNSIARALTITGVLAAVSLTGYALYFDHKRRNNPEFRKQLR
                     QKVKKQAELQRKEQEEAKQVKLQNVREFLTQELVTDPIPSDPSQRETTFTTNVELGER
                     LSMAPGKELESASKFYKALSVYPNPADLLGIYQRSVPEAVYEYIVMMIAILPPANIST
                     FLSGAKDQVAAQQAESAAMAEANEIDE"
     gene            <325632..>326243
                     /locus_tag="HG536_0B01750"
                     /db_xref="GeneID:59324431"
     mRNA            <325632..>326243
                     /locus_tag="HG536_0B01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282092.1"
                     /db_xref="GeneID:59324431"
     CDS             325632..326243
                     /locus_tag="HG536_0B01750"
                     /inference="similar to AA sequence:RefSeq:NP_011595.3"
                     /note="ancestral locus Anc_3.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137987.1"
                     /db_xref="GeneID:59324431"
                     /translation="MVAKRRTTLRNKAAAAAARNLEEVEDEELDVSSRSFLHQPRESK
                     KEKQLNKHQIFLNRVLEKSSGRDDLAGISKSAVRRRKRKLRDELKPRMGDLLTSLREE
                     DDLKQHVLEGSTDGGPSDGNSDPIAKKNVVRVLSKDERRAGELGYVHIRKNEPNIRNQ
                     KGAKALSIRETSRMNDILHNSSFQQNPFGALREAIMMKQQDRQ"
     gene            complement(<326303..>329302)
                     /locus_tag="HG536_0B01760"
                     /db_xref="GeneID:59324432"
     mRNA            complement(<326303..>329302)
                     /locus_tag="HG536_0B01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282093.1"
                     /db_xref="GeneID:59324432"
     CDS             complement(326303..329302)
                     /locus_tag="HG536_0B01760"
                     /inference="similar to AA sequence:RefSeq:NP_015422.2"
                     /note="ancestral locus Anc_3.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137988.1"
                     /db_xref="GeneID:59324432"
                     /translation="MPRTLDPTEEHYLKRELLKYQLDREFAALNNQYALRKFGFPFSN
                     EDPRAKRSSMKRALKHAKSSVSPRSSTNKSSLEEKSDSSSVALQVETEFPMLSYVLQR
                     FVIPFPLLSKDLASDESFWQEKVQVFFEHFMELGFSDSYNREESTKRKKISTKLSKAL
                     LLLFNSGIGTSQETEYYCQDKFMLKQNGAKKSTVIEQFTMPSRENLQYLMATEPIFIG
                     GWDLNIVAVVHETDLFPERKKVASPKGTPLSPRWMKSTFSMASSSAALFSKLNIMDSG
                     DSAKSSKNPHYFILRASRESESKQQYYTAKSYEDFKQLSHSLKTDFPGKRLARLPHRT
                     KKSVQAVATSDVPYTPKERIISTFPDDVTQSNSTGDIDRTDSAENSDEDEDTEAMEEF
                     HDAWEFRDSKLLCERMRTSLRQYLRTLCSDKEIASSSILSRFFTVSPIKYEMLSREIR
                     EDIAQRNLVDVRNLEIQVKFQKLALEKSLKLQESMKEFKTSLLRDEGYLLGLMQELKV
                     KTRMRDLSPLLLSFVEWCKIYVSSTIYQMFLGNDGGYEFFNQVKKLHRLMPYGVMAQI
                     LKLTNPMGIMKAMIDLFMAQPFGSQSLLQTMFATVLSDDLRNQEKVIQELETKIIEVS
                     ALNLEIIKCLKAVIFENDDGAIMDMQSAQEESETTKTPISLVILLRKAESGSISHEVV
                     GEVIESYAAWKSKQDNLDENHPDGPKDEGALFSRIKELLHLYIRERDKKLMKKLWQDP
                     ELSQLLKSIMALLYEPMVRIFKVARVDIALKNFEKFMNDLIKLIDSFLEGQLGASTRF
                     NVVESINDLVTKHEDSFLEFIHDVYVHDTEGIFEGFVTWIVDVVKFLQQSKYGSADGR
                     IDFDCLLQSSDIEVSLLINQLDNVIEKKQIARKAYSKLLDKKRKKDDVKINRHATKVL
                     EEKWKQLNSFVMPSNTETLGLQDGDLVDLDLDVADYEALFDDNEKDLEEEYQILLNRK
                     VDESEIMRFGTQVFEGELRKMLSPAHV"
     gene            329952..330025
                     /locus_tag="HG536_0Btrna5V"
                     /db_xref="GeneID:59324980"
     tRNA            329952..330025
                     /locus_tag="HG536_0Btrna5V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59324980"
     gene            <330501..>333608
                     /locus_tag="HG536_0B01770"
                     /db_xref="GeneID:59324433"
     mRNA            <330501..>333608
                     /locus_tag="HG536_0B01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282094.1"
                     /db_xref="GeneID:59324433"
     CDS             330501..333608
                     /locus_tag="HG536_0B01770"
                     /inference="similar to AA sequence:RefSeq:NP_015420.1"
                     /note="ancestral locus Anc_3.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137989.1"
                     /db_xref="GeneID:59324433"
                     /translation="MNQSLAMLMKLKLFQAGHPDSSDERDFPIGHKKDKKHKLWGKSR
                     LGGHNGKSLPELSSGITHESPQLKSIGEEESSKARKSELDPEGSQDGNLSTQGSGRRN
                     GKLRNLKHKISLHDIKSFRSSSSQSVKQADADQKGRPRSSGDDESSHALDNEMTKRGN
                     GEVARAPMYSTSSVWSARSPSSAAKTEYHGHTSTASSVRFSSNITSSRSHASIAFHHS
                     RSGSMEVKGSKIRSAPMGRRRSRTVGGSDCVEPNKHTPLAGATGSDFMSSITSHLGRS
                     RSSSQASRSPLISSQSNSHIQFPNTAAVRAATPPTPPRLSNGTIPFPTAGSQQAMSQQ
                     SISRRSSSLVNAFNSFVNLRSSSASSMKGPSVKTLTPKFDISLDDFSEPPEPTPDESP
                     KEYLLKLGQFGKFIGIILCSENDPFKLQSLKYFLTHYFDFNHDPLDISLRKLLMFLDL
                     PKETQQIDRLLSVFSQVYYEVQLATEAFCPWSNSDQVYFVAFSLLMLHTDYFNPRNRF
                     KMTKCEFIGLVHDDQQSDGFKIPKEILAYYYDNIVAKESPKFDFFSVQQPLNSSDVRA
                     QNETSGSHSSPVYSPIEIINAAGSLAYQDQIPVTYASRGRVSSNSYSSYFPHVPISTS
                     SSSASVLQDDVDIYSHILENSLSEMDMSGEVNRYWDDNCISRPLTSANNRYAKYFSIL
                     KEIKGGYLKIRKDLVARIALPNFEILNESDDDYRYLKIIQMGEIQHLTINKKFSIVGA
                     VHKISWKKEYAILTPSGLLIFDCMDWVSPDLVKDEKTGTSNYIIEYKCDAPIISESPI
                     CCNGLLAIRKEDEMAKTGIFYCQTADEHNLDAELADIPADCIMHLHGSQKVNVWKCSG
                     QYERDNWIDAINLMAAYDGCYYKPGSLDNSIMTLRKHSMKERISKLEHSTEEKAAKLR
                     ELQTVMPLYRQCMPLSYKTRNELTAHIKQLAVRMDWLVYETKRNEVYLDVIRQVDASF
                     QLCLNKASEAEDFDSRNNVNSIHESFIFSEELIPARHAEDSSKFNDSLEIDTNDFFLE
                     GYNDR"
     gene            complement(<333681..>334007)
                     /locus_tag="HG536_0B01780"
                     /db_xref="GeneID:59324434"
     mRNA            complement(<333681..>334007)
                     /locus_tag="HG536_0B01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282095.1"
                     /db_xref="GeneID:59324434"
     CDS             complement(333681..334007)
                     /locus_tag="HG536_0B01780"
                     /inference="similar to AA sequence:RefSeq:NP_015419.1"
                     /note="ancestral locus Anc_3.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137990.1"
                     /db_xref="GeneID:59324434"
                     /translation="MSRHQLDLVMCMKQPGTHIGLLCEKCDGKCPICDTLERPRSKVR
                     ICEQCAFGRSGINCIICGSTGVTEAFYCWECCRLEKSRDGCPRIINIGSNRTDKHFEK
                     KTLSNR"
     gene            <334221..>334514
                     /locus_tag="HG536_0B01790"
                     /db_xref="GeneID:59324435"
     mRNA            <334221..>334514
                     /locus_tag="HG536_0B01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282096.1"
                     /db_xref="GeneID:59324435"
     CDS             334221..334514
                     /locus_tag="HG536_0B01790"
                     /inference="similar to AA sequence:RefSeq:NP_015418.2"
                     /note="ancestral locus Anc_3.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137991.1"
                     /db_xref="GeneID:59324435"
                     /translation="MPEVLQALCSICLTEIGGEFGELSPCKHKFHQECIRQWHTCAPD
                     LRCPACRVESDSFIVAGQHKIDLTTGFKVKTLVDAQQTELLDRLNNTAVCRDQ"
     gene            complement(<334803..>335789)
                     /locus_tag="HG536_0B01800"
                     /db_xref="GeneID:59324436"
     mRNA            complement(<334803..>335789)
                     /locus_tag="HG536_0B01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282097.1"
                     /db_xref="GeneID:59324436"
     CDS             complement(334803..335789)
                     /locus_tag="HG536_0B01800"
                     /inference="similar to AA sequence:RefSeq:NP_011594.3"
                     /note="ancestral locus Anc_3.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137992.1"
                     /db_xref="GeneID:59324436"
                     /translation="MSNQSGILADQNLLDLLSNPDSNEVFAITAQISKDATAVQFSAK
                     YSSLEQVIDNLAEEPLYVFIRGTLEDPKQYHFISYVPDSSPVRSKMLYASTKNTLVRQ
                     IGTSGIGRQSLLTDASELLQVVDERNAQEASVLTESEKADIEIAQQQQRLKASEYYPN
                     GRKLVSQTDGVPKSLAFRVKTGEGSIAELMKNYNVISFRIDLASEQIQVAAKYNIDSP
                     RKVEIVEDHPSYVIYRNGSLYYFIYCCPSGSKVRDRMVYASNRAGFIKHLKDEDHLEL
                     AKIIEIGDPEELELSSLSPSTPEALAAEDAESKSASDVKFSRPKGPTRKRRT"
     gene            complement(<336003..>336818)
                     /locus_tag="HG536_0B01810"
                     /db_xref="GeneID:59324437"
     mRNA            complement(<336003..>336818)
                     /locus_tag="HG536_0B01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282098.1"
                     /db_xref="GeneID:59324437"
     CDS             complement(336003..336818)
                     /locus_tag="HG536_0B01810"
                     /inference="similar to AA sequence:RefSeq:NP_011593.1"
                     /note="ancestral locus Anc_3.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137993.1"
                     /db_xref="GeneID:59324437"
                     /translation="MAVKKQPHKKSGKGASSSGSKQFQLVNGVITKEDITPLAKSSQH
                     STASSDDESSTSTTMESDLLFSPMGSAVDDAEDEDEYDHELLSPVYFGATYPKRFHHV
                     SNAYYDDGAVESRKGSVCGQFLKDLLGNTTNEDFWKEVGTTSEEAIFASQPLEPPVES
                     PSVQDQSITSLDEYIREDATAPASSALSAAQWDDNYKIKLLCYRDTTGNLRLRTQEES
                     CSGSRSLLVGSNHKVNKIRRGKGKSKLLKNAIRRKSGVREMVSTGVGIGEFML"
     gene            <338052..>340319
                     /locus_tag="HG536_0B01820"
                     /db_xref="GeneID:59324438"
     mRNA            <338052..>340319
                     /locus_tag="HG536_0B01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282099.1"
                     /db_xref="GeneID:59324438"
     CDS             338052..340319
                     /locus_tag="HG536_0B01820"
                     /inference="similar to AA sequence:RefSeq:NP_015416.1"
                     /note="ancestral locus Anc_3.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137994.1"
                     /db_xref="GeneID:59324438"
                     /translation="MNTFQWFLLIYVIGGVTFLPLVLCVFWFFKQKMDQIHERNEEGF
                     DGDSLVAGGVDRKFTAGQIEEEKGVEVVRQGWLTVTRKYYYHHTELSAQDSEEAGNIP
                     QRSQIKRKHKFYAILRHGNLFLYRDSAPKSNLVHAISLQDSFVTIWPRKAGEELPESI
                     LFTKKTCISILRKGTTSLEGGMLKFDTTQAENEESQATNQFFLYIDNSIEKEDWYFSL
                     ISASKSEAPRSQLSANLLDPNVSARTAHLRTADSLFLIQTINSTENQLTTKWINALIG
                     RLFLAVQESDRLKDYLYTRLYQKLAKINKPDFLSDFVVEEVDVGRSAPLITAPKLLDL
                     TPEGLTKISMNFMYKGDLSVIVSTKATISLGSRFKQREVPIQLSIKLKELSGPLLILL
                     KPPPSTRFWYTFQTEPILSLEIEPIVSSSKLSYTMITNAIKGKFAEAIRESLVQPFWD
                     DIVFYDTEKELYRGGIWEQYDRSDGTDQHWVDQMPSIPSQATLSSKKKQPLDEKNEIA
                     AAEGQGSADTVNSDDEEAVNTLRTQDDTLKRRTFAKVESLRRALKNKSRETFSDDKSS
                     VESLGGSPVVLGDNTDSEELSSSNKLFKSSIKKFGKWYKDTVNLGTEDMIGQELSSAN
                     PPSPEMISNRRKSLPRRQPPSTIPSSSVFDSDSVLSTSNATEMFANKDQKRARSSAAS
                     SGKSFNSNLISNLKQVHNQAFVKTTSDEIAEEIFHEDFVRKVSAKSMTLSGHVDGATH
                     EKENKQTVERNEDAT"
     gene            complement(<340432..>347568)
                     /locus_tag="HG536_0B01830"
                     /db_xref="GeneID:59324439"
     mRNA            complement(<340432..>347568)
                     /locus_tag="HG536_0B01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282100.1"
                     /db_xref="GeneID:59324439"
     CDS             complement(340432..347568)
                     /locus_tag="HG536_0B01830"
                     /inference="similar to AA sequence:RefSeq:NP_009694.3"
                     /note="ancestral locus Anc_3.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137995.1"
                     /db_xref="GeneID:59324439"
                     /translation="MESNIKYLDELKEAISESRIPFSGGGSDDFSSGSSTRAEEDESK
                     SVPIKILTTMLRNLKDPQKNDMMKNNTVFAKSIQVMDALIRSRPGLLLQRNGNVDLTT
                     LISDLLDISVMNYDQVHRMWFIRRKLGSWCKLFAQLYGGVHKMLISDCIMGLLVRFEE
                     RLAQIFEMAREPEVVAHDLKSLYVICYWLCGPPETFGSSLTMLNSWLGVTKWDSQFQK
                     TIRFVFYVFSSLKQSSSFVDVSAIHAKFLSLTVEHLVNKVTLHSSKSQLYSTDHLRFT
                     LRIVKQFLREKFGCLRDDAIVAKCLLRVYLLCSTVEDTAVNDLFAAFDDVLSLRQWVD
                     SNEALGNNLETFGFSPLTRKALLLIHLDRSRRSASEDDLEFDQETKIWYFKPGGCDML
                     RTVLIPSEPPSQQLDALCQAILKKFRSSGSELNSNSEIARIGKQAAALYRNTPDQAMA
                     MLTRLLKEQGSSKDINAFFGVSRILGHLACLESQKNGAEYDLRAFNACNICDSIRSET
                     LYHFVDPDRPTAQKSAPFRLLDAYVLSSDKLDEFPEPLLAAILLALQRIFTHHQPPKL
                     TLDVSHSAYINRPFAFVQRCFRSPSRYLRILAARLIPLWNITNLYNSEDQHTAVLIRF
                     LQENDFSYAVETSAMSWAQLALTATGEVFDTLLLKLIDIFNSTNYALHIMMAFQIKNT
                     AGTLRKSSYQLLSPILPILLRRIGKNLLEKRVSFQRLIWLLGYSAKTILDIYQRYIIP
                     HAITQYKSDVFSEIARIMCDDDSAQIGEAKRILLEKNSRQIFAVALVKHGLLSLDTME
                     SLFSNRVPFFDKRYVIAYLPDYKTLAEILKLYKNDADDESQPSDNEAMVLVSLRYLVT
                     NFEKDKRHGSRYKNISDWTHEQEVRFQERLQEHILGIFQVFSSDVHDAEGRTTYYEKL
                     RVVNGITFLIRRACKKSIIASLAQVSICLQTALEIDEVSFSALKCWRLLIFNLNDEEL
                     AAVIDGFLCYILQKWGQFNIRLGPLISEILTFLVKEKKDLLLRIKPYLTLALIEKSEI
                     DILSRDGNFARAAGHVISSTDWIIVFADNLQSTNKYVINQSLDDLEVYLKRKQAKRSA
                     DFFQRNEQVSDISLLLGSLLNTSQRFKSDELICIKCAKCISIIGAVDATRQKALRKTA
                     AIREVYDLNDEAQTRNFLIWVMNDILVPAFWQSENPNKQLFVALVMQESLKYCGLNSA
                     SWDVNQKGLYPNESKLWDKFDSVAKTTLYPLLSSLYLAQSWKEYEPLSYPSFTFKEGY
                     IIWIKSFCLDLLKTGTEENHPLHVFSSLIREDDGTLSNFLLPYISMDIIINADSSNSK
                     AKLMRNMIEEFKSIFESDLDGLNHLQIDSLRMCYQAIFRIFEYCKKWMTQFKQDYYHT
                     KGSYIIREKELNDMLKRIDEFLGSFSPALLAQRSLETDSFERSALYLEQSFRQESIRG
                     LGEVEHKNLILPLQRTYEEIGDIDSLDGLLKAFSKGNLRSKIEELQYSESWKLAQDCY
                     NTLGSFADWSFATTKMLTSMYDHQLYSELLFRLESLAPRVCQLDGESILWYRMGVEAA
                     NLEGNPKSLDSWLERVECLQEAKDPELLFQYNMARALGYARAGNRDRVEQYLNKCLKI
                     MGTHLMASTVATTLLKKQTLLMRLHSLYDITLLSSSADSAQFQSNTETLDFRMTRIGP
                     NFESNHYLLSVRKSYELLAQKPYAEKDIQGVFFEISKLCKDNGRLDRASDSLMHCLSF
                     NHPQAELEFAEILLKQGENDRAIKLVKEINERYKNDPLMKPRDKAAALLKYTEWLDLT
                     NNSASEQIIEQYQNIFQLDPKWDKPYYSIGLYYSRLLEKKKAEGYITNGKLEYMSISY
                     FLLAFEKNTVKIRETLPKVVTFWLDIAAESVREKSASRREALKQATEDICRHVEESLR
                     KSPAFIWYPVLTQLLSRLLHIHQSTEELISQILLNLTSEYPSHILWYIATLLNSTSPA
                     RASRGRYIIDSYTKASNCVQGMISNAIDLTQAFTKVCLKDVKSAISRSGRSLEKDFRF
                     DMSMAPSNLAVPVQVNLDMVSPLSSQSNQKYTPFGEVISIAKFGTTYKVFSSLKKPKK
                     LNVIGSDGKAYGIMCKKEDVRQDNQYMQFATTMDFLLKKDVESMKRNLGITTYSVLPL
                     REDCGLLEIVPNVVTLRSIFVTKYESLKVKYSLKNLYEKWQNSPDNSKLSFYRQQLET
                     FPPILYQWFLETFPDPIVWFNARNTYARSYAVMAMVGHILGLGDRHCENILLDIESGK
                     VLHVDFDCLFEKGRRLPVPEIVPFRLTQNLHDALGIVGTEGTFKRSSEVTVSLMRDNE
                     VSLVNVIETIMYDRNMDSTIQKALKILRNKIRGIDARDGLVLSVPGQVETLIQESTSD
                     ENLSKMYIGWLAFW"
     gene            complement(<347900..>348304)
                     /locus_tag="HG536_0B01840"
                     /db_xref="GeneID:59324440"
     mRNA            complement(<347900..>348304)
                     /locus_tag="HG536_0B01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282101.1"
                     /db_xref="GeneID:59324440"
     CDS             complement(347900..348304)
                     /locus_tag="HG536_0B01840"
                     /inference="similar to AA sequence:RefSeq:NP_009693.3"
                     /note="ancestral locus Anc_3.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137996.1"
                     /db_xref="GeneID:59324440"
                     /translation="MYHHHHAFQGRKLTEQERARVLEFQESIHYSPRYSDDTHEYRHV
                     MLPKAMLKVIPSDYFNSETGTLRILTEDEWRGLGVTQSLGWEHYECHAPEPHILLFKR
                     PLNYEAELRAAAAAVVAQQQEQQQPETQVGVQ"
     gene            <348538..>351084
                     /locus_tag="HG536_0B01850"
                     /db_xref="GeneID:59324441"
     mRNA            <348538..>351084
                     /locus_tag="HG536_0B01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282102.1"
                     /db_xref="GeneID:59324441"
     CDS             348538..351084
                     /locus_tag="HG536_0B01850"
                     /inference="similar to AA sequence:RefSeq:NP_009691.1"
                     /note="ancestral locus Anc_3.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137997.1"
                     /db_xref="GeneID:59324441"
                     /translation="MGSNVFVGVKLPGNSSGEFGERYATDPSRVSKLPSNYDYVLLPI
                     TNARYRENVRSQFENFQQQRRAVSECVLKIKEPQLQELCIPPFNPGRKNDGPAFIGLL
                     SSWLELENADNSVRELCYQVLLNECRYARFVGIDKLIVAPPRKLSELHRYSQVISRLL
                     NDETVSAYPRLTLSVSLPLYEDSDPLATWELWHTVRKLCSYHPSLTISLAVPRIRTPS
                     HVLNRWLSEPVSCLLLSSSIFATNQYGYPVLHKFNQSLITKFQGVNGNSLPDANGELC
                     IIIHGMEKYVDQIKGGEGSYLEYINFLLKKGDKQLFSSHEDLSNGSINQVGHKTAHQD
                     NSNSHNINTNHNPINSNGPVSPNFRTPRLMKPLKPHSETLSNYVYSIFEKDLAKYNMY
                     QAAIEQALTALLSEHRTSPLTILIAGAGRGPLVDRTVLLLKKFNVLNQAKVIALEKNP
                     QAGLYLQKRNFDLWHNKVEIVIEDMRQWRDKSVKADLCISELLGSFGCNELSPECLFA
                     IEQHHSKPDTIFIPQSYTSYIAPIACPLIYQNLREKEGSQESPWVMHNIPYCILSSRI
                     NELWSFHHPLRKRDSEDDLFSRNAVTEFKIKHRGEIHGILGFFTAQLYNDITLSTVPD
                     DSIVKVSKARDGAIGTHLQKEVRSPQEDSGVDSDELKDQFRKLDHTPNMHSWSPLVFP
                     LNQPFVVTDDTELAVFLSRNHAQLDSATWYEWSVESYVYLVSSDTSLSRTTPRQTVDP
                     RNHSSRNRENAPARNSRTSKKNETLAFDNSISDNNFSPNQENVWQSVSDIHGLTSAVH
                     KTTEPMFNLKDAYLECTEDEDEEEEEVHIRVKTGVSTLHNANGKFFSVAL"
     gene            complement(<351340..>353745)
                     /locus_tag="HG536_0B01860"
                     /db_xref="GeneID:59324442"
     mRNA            complement(<351340..>353745)
                     /locus_tag="HG536_0B01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282103.1"
                     /db_xref="GeneID:59324442"
     CDS             complement(351340..353745)
                     /locus_tag="HG536_0B01860"
                     /inference="similar to AA sequence:RefSeq:NP_015414.2"
                     /note="ancestral locus Anc_3.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137998.1"
                     /db_xref="GeneID:59324442"
                     /translation="MVRHIGIVEAIGGVELDLVVSKRMDDIWSQATSSVGVDGAPCDK
                     SAVVKATTDELRKIDSEALEADPWAKLVLLMADNRPGEEELVAFRELLETVGDINDVA
                     RTGVALIHYAIVYDHAPYIELLHQQSKQPILNLLDSLVGYTPLMWCVQLNRQDCCVEL
                     FSFIDEIDFGKRSSDGLKAADMVVPGSAMAAFLDQNNFSQYERGSSGPVHLPMDGLSL
                     NAVSAKLDRSDNIGAFGEFEEFEFDKISKNQYLELADYDIPQILDLLISLSRTHQHVT
                     TYPAALLFQCIRYADHKLASAPLVESLIHLSLTRIIATASVEVNPESESQGDIVTQSY
                     WLSAVSFLYYYLCRDEGFFKKYPSALQDIVNTLHTLMTEIVSATHSRLVPLMEPTLLS
                     YTTIEDVKQTLYKRDWNFFKKRKQAKQLALLEKKRNDPRFYDDEVLRHLYPPSLEEQM
                     KLSPMKIVQIFGALSYVLDLHQIHPLFQQQCLSTVINWFSSTLFNKIMKDKKKKALSR
                     AHAIQIRLNLSSLETWIRNNDLTVPKPVLIDNFLWQRFPFTLVCDLNNIDLSNPPIRN
                     VATYRPVDTDPSTDDVPIVSDTSNSLFYYQPFHEITKIHLDPVLQLLQWLQIATTLTN
                     EESLDTTLALLPRLNPVQLLKSIDKYNYEVDESKFNSSLRKKISNAAKSRAAKEEAYL
                     PERQSPALVLPTVAELTDAYSRSSNSRSFQPLLPMDIQDSVYEIHEENSSLRRTDSSY
                     NLNGSKTDEQDDAEQELKYSSNGNQQDGHKADEYFKELDTPLASVQRPAWAADDEIEA
                     NPW"
     gene            <354285..>356006
                     /locus_tag="HG536_0B01870"
                     /db_xref="GeneID:59324443"
     mRNA            <354285..>356006
                     /locus_tag="HG536_0B01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282104.1"
                     /db_xref="GeneID:59324443"
     CDS             354285..356006
                     /locus_tag="HG536_0B01870"
                     /inference="similar to AA sequence:RefSeq:NP_009690.1"
                     /note="ancestral locus Anc_3.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037137999.1"
                     /db_xref="GeneID:59324443"
                     /translation="MMSGSFKKQSEVKLQQVEGDELESLPTNGGVAMVKNDYEEGLLE
                     DNDNVPKTQYIHSTQTFRRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPASLLIAF
                     AVWSVPILCITVSTAEMVCFLPVSSPFLRLAAKCVDDSLAVMANWNFWFLQCVQIPFE
                     IVSVNTIIHYWRDDYSAAITLVVQIVLYLLISICTVKYYGELEFWLASFKILLALGLF
                     LFTFITMLGGNPKHDRYGFRYWGETPFKKYYPDGDTSAGAAVGYLQGFLACLIQASFT
                     IAGGEYISMLAGEVELPRKAMPRAFRQVFVRLTFLFLGSCLCVGIVCSSNSPDLTAAI
                     DESRPGAGSSPYVIAMNNLGIRVLPDIVNAALITAAFSSGNAYTYCSSRTLYGMALDG
                     YAPSIFARCNRFGVPIYAVGVSLIWGLISLLQLNENSAVVLNWLINLITASQLINFAV
                     LCITYLFFRRVYLLQQNSLPPLPFKSWWQPYTAIFGLVCAIAMILLQGYTVFFPSLWN
                     VRDFLFCYLMVFIDIGIYIGYKFLWKRGLDTFKDPKTVDFTEELREIELHEIDHSYEK
                     FRHFHAA"
     gene            <356564..>357007
                     /locus_tag="HG536_0B01880"
                     /db_xref="GeneID:59324444"
     mRNA            <356564..>357007
                     /locus_tag="HG536_0B01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282105.1"
                     /db_xref="GeneID:59324444"
     CDS             356564..357007
                     /locus_tag="HG536_0B01880"
                     /note="similar to Lachancea kluyveri SAKL0B08690g;
                     ancestral locus Anc_3.396a"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138000.1"
                     /db_xref="GeneID:59324444"
                     /translation="MKAVCRRNGLKRYRCQKHSCGEERELYDRSTIQKLTEIFDFDYP
                     ASKEVLQAKQLFGSDSGGSRYDCSQCSGNSVPDELQYTPLETFSSPSYPLSLPPPGSD
                     EDIQPVPSERRHENLRSLQEYVSAFVSAERRLLLHDLLSGDIYDS"
     gene            complement(<357029..>358933)
                     /locus_tag="HG536_0B01890"
                     /db_xref="GeneID:59324445"
     mRNA            complement(<357029..>358933)
                     /locus_tag="HG536_0B01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282106.1"
                     /db_xref="GeneID:59324445"
     CDS             complement(357029..358933)
                     /locus_tag="HG536_0B01890"
                     /inference="similar to AA sequence:RefSeq:NP_009689.3"
                     /note="ancestral locus Anc_3.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138001.1"
                     /db_xref="GeneID:59324445"
                     /translation="MLQYVTVFDPSQSDGEDEVHKQLLLYHSFEDLEITLNEKLGRIG
                     MIQGIWSLTDSFGGMGERQEKVVELHKEVILIIKVECRFFISLCVSTEEGRMSPAIPH
                     ELYVSQLWYCYQIFVLHYGPFSRFEDMGELTDLLNEQIVPFWHHIQLKPETIVRRGIA
                     GLWPDGCKVSQLEFDSSGESWESLINQNILLAPENYMAVKDVLVYHLPSYNDQNAQFA
                     GRRLGYKTYGLVRHFSDDISIVTQLSNWIYHLHAVHGDLSSHVLAGNAHYEEAPSGSD
                     GVENAADNSTELSSAAPSNLQAQGRALLHNLMLPLSFAYDAVHEVGSTTGISKSMSLI
                     MDYVPRWDHNASRERENDRQRSRCGYLISPLCSGMLPMSYRVKKVVYESSDGHLRSFN
                     LLFWFYDDVLVVTVCEPEFAKIWDSQYLEDLSYKFRESITRFYETAFQHAESKAKGPS
                     KRESFAYTTYSKITKEIKCSVPAWFDSKSDNRGSNPMKLVVDGVDHLFGLNSQDASEL
                     QDANRNPWGLDIMGSLLGFRNDKTNQNVAEEQYPHFDRRYENFLDGMTQEKLWGLQVQ
                     TIQFLTSIKNSNRACGLVEERLSKLNNGLLCYIKQDDESVSVVIRNWFEHREDFESHK
                     RLSDFGKVLG"
     gene            <359164..>360759
                     /locus_tag="HG536_0B01900"
                     /db_xref="GeneID:59324446"
     mRNA            <359164..>360759
                     /locus_tag="HG536_0B01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282107.1"
                     /db_xref="GeneID:59324446"
     CDS             359164..360759
                     /locus_tag="HG536_0B01900"
                     /inference="similar to AA sequence:RefSeq:NP_015413.1"
                     /note="ancestral locus Anc_3.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138002.1"
                     /db_xref="GeneID:59324446"
                     /translation="MVLADLGKRINSAVNGALSNSQDDYATTVDHMLKAIVTALLESD
                     VNIRLVSKLRNNLKSKLIDSKSDGRSVSNGQTKKVIQKAVFDELCDLVDCKVDEPFQP
                     KKKKCNVIMFVGLQGSGKTTSCTKLAVYYSRRGYKVGLICADTFRAGAFDQLKQNAIK
                     AHIPFYGSYTETNPVKVAAEGVAKFKKEKFEIIIVDTSGRHQQEQALFQEMVEISNVV
                     KPNQTIMVLDASIGQAAEQQSKAFKESADFGAIILTKMDGHAKGGGAISAVAATNTPI
                     IFIGTGEHMHDLEKFSPKSFVSKLLGIGDIESLLEQFQTVSNKEDTKATMENLQQGKF
                     TLLDFKKQMQTIMKMGPLSNIAQMIPGMGNMMSQVGEEETSKKMKKMIYVLDSMTKEE
                     LESDGRLFIDQPSRMVRVAAGSGTSVFEVEMILMQQQMMARMAQSTKAAQQSGNMPGM
                     PGMPGMPGMPKIPGMPRMTPQMMQQAQQRLKQNPSLMKNMQNMMGGSGFPGAGGMPDM
                     NEMMKMMQDPQMQQMARQFGMGI"
     gene            complement(<360961..>362031)
                     /locus_tag="HG536_0B01910"
                     /db_xref="GeneID:59324447"
     mRNA            complement(<360961..>362031)
                     /locus_tag="HG536_0B01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282108.1"
                     /db_xref="GeneID:59324447"
     CDS             complement(360961..362031)
                     /locus_tag="HG536_0B01910"
                     /inference="similar to AA sequence:RefSeq:NP_015411.1"
                     /note="ancestral locus Anc_3.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138003.1"
                     /db_xref="GeneID:59324447"
                     /translation="MSAPASVLARERNSKRGPNLNIVLTCPECRVYPPKVAERFSEGD
                     IVCALCGLVLSDRLVDTRSEWRTFSNDDQNGDDPSRVGEASNPLLDGNSLSTRIGQGE
                     GGDLRATRDLNRAQGKNVMDKKDNELQAVFAKITMLCDAAELPKIVKDCAKEAYKLCH
                     DEKALKGKSAESIMAAAIHFGCRRASVARTFKEIQSIIHVKTKEFFKTLAIMRGILRE
                     KSSDGFIKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTAAEYTAKKCKEIEEIAGKSP
                     ITIAVVSIYLNILLFKLPVSAAKVGKILQVTEGTIKSGYKILYEHRDKIVDPQLIASG
                     TVSLDNLPKVDKDRSKTDKKKK"
     gene            <362910..>364199
                     /locus_tag="HG536_0B01920"
                     /db_xref="GeneID:59324448"
     mRNA            <362910..>364199
                     /locus_tag="HG536_0B01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282109.1"
                     /db_xref="GeneID:59324448"
     CDS             362910..364199
                     /locus_tag="HG536_0B01920"
                     /inference="similar to AA sequence:RefSeq:NP_009688.3"
                     /note="ancestral locus Anc_3.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138004.1"
                     /db_xref="GeneID:59324448"
                     /translation="MLEMGDCENEYNGSPVAAVGPEIRSPLKSPARTPKLKTPGASAA
                     KLAPNHTIFMANIDSSPSRRKEDRNNGGGSSSTRVIENLHDQIDTLTSTNLQLTLQSN
                     NLLSRLEAAQQREAKLLETTASLRHENENVASMLNRKSRKLKDLEDDFVKLDEKYNSL
                     LKDKADLEDRVRDTSEKESKLKQEIEMVKAQYDALVDSQDYYRKHYTSELDTLRGQLD
                     LLKQEQRRRLEQSKAEEALLDTKLSEFETKCENWKGLDDARLSHLESKCNDIVSQLDL
                     PAWINLYKESKNMLLKCGQEMNIKIPEDLERTMQDPSMTSLELTSQQRNVSPGLSLKM
                     AKVRSGRSTTSPNVNTFSNAPHAKRSSFYGGAKQIPQSVTGSLPGLKRSSSRRKNSGR
                     AEQINSSAEASPVLRQASRNASSPSPRMVSQATFRKS"
     gene            <364571..>365914
                     /locus_tag="HG536_0B01930"
                     /db_xref="GeneID:59324449"
     mRNA            <364571..>365914
                     /locus_tag="HG536_0B01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282110.1"
                     /db_xref="GeneID:59324449"
     CDS             364571..365914
                     /locus_tag="HG536_0B01930"
                     /inference="similar to AA sequence:RefSeq:NP_015410.2"
                     /note="ancestral locus Anc_3.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138005.1"
                     /db_xref="GeneID:59324449"
                     /translation="MKEHHLNDIQLPEYSLRCHKSGVTASTFVEWPSRSSVPILITGD
                     SSGLIVLWDLIVRRPLVTHTLAGGAQVVAMQDLGDGLIAILSKDHKLRLLEMTAKEMK
                     SLAECTTSFEAPQQQLHEIYEVPVNTLNFANFVLQKLNKGFYRLICTNTQDSEAIDVY
                     QFHLSNVHSLQRVFRGVTFGGVIQKLATDPESVKARKLGIVMRFLEHQETIYCGFESG
                     LVVGFKIHDLDCERTNIDEDADRNHNTCIEIVYVSSVHYPEPVLALELNDATGEILTS
                     STKDVVGIHPPISTQGAIGCQSNFFHDQASSVLIRRDLKICGTNFKKVPASSIGYLAV
                     VNGNLVASSWSGITYVLSPDYRVLVTMSKSRPNVFVSDSSQGSLQGANEEKTQKRHIK
                     VSSLTGISPAVIQRFSSLDHQLTRWQGQNRRMRAFAAKSWCIIGYDDGSIAVHQI"
     gene            complement(<365983..>367383)
                     /locus_tag="HG536_0B01940"
                     /db_xref="GeneID:59324450"
     mRNA            complement(<365983..>367383)
                     /locus_tag="HG536_0B01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282111.1"
                     /db_xref="GeneID:59324450"
     CDS             complement(365983..367383)
                     /locus_tag="HG536_0B01940"
                     /inference="similar to AA sequence:RefSeq:NP_015409.1"
                     /note="ancestral locus Anc_3.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138006.1"
                     /db_xref="GeneID:59324450"
                     /translation="MSDQRPIRLAVLGGELTGKTSFTSGLTVNIVHEVHYPTRQQSNW
                     LFDYLPRTASAKALLDGQAHERILLRTQGSQTPEPLFSSPCLSPHLMLSPLLYQAFLD
                     DYARVKDQHRNRSANHIKHVELKRQDNPFYKYLPSQESDLEEARPLNTATNSDINILR
                     SAELGSTSKPNSLDVALKLPDNYIPPEYTPIAIDIIDTPGFNPDMVVPFLEVSLFSRL
                     DKRVLRGLAEEPRMPVSTTSMLVASGASELNAKIDGYLFVYSAVPELSNDISPPDYGD
                     TKKSDSEDEIQTTVSGDFWSANSKRTDGGFSLLEVMRNCILEAWTEFGDYKKRREDDK
                     EGDVYSLAYAFKSVWKTEKQRRAKLAELRNPNSKLKSLDLDPSSPHSPPPCLILCTHA
                     HDPMSSPRLIELGQALAAEWRCGFAAVDSMDDYNVDVAMSLIIREVVEKNKLLGKGRS
                     KSFSGGASTLKKLMRP"
     gene            <367559..>368653
                     /locus_tag="HG536_0B01950"
                     /db_xref="GeneID:59324451"
     mRNA            <367559..>368653
                     /locus_tag="HG536_0B01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282112.1"
                     /db_xref="GeneID:59324451"
     CDS             367559..368653
                     /locus_tag="HG536_0B01950"
                     /inference="similar to AA sequence:RefSeq:NP_009686.1"
                     /note="ancestral locus Anc_3.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138007.1"
                     /db_xref="GeneID:59324451"
                     /translation="MRCPLCLNSSRPMYCSHCVNTSPNILARLKIDLLMLREENRRLK
                     DRVESILAYGLGVMEGSEAAAVVERTLEEGHEDVEGEILGQRLLKLNQLRAKRKHNRI
                     RYRTAQLLSSLEAKKRTIDRLTQEREKVPVLDVNAEEKLSRVRTAVLVEKTSQIAQIQ
                     RVLLNSQEAKLNSLRRWFIIRKRDSYEFPYSIAFQPVVSLKNFYKLPPMVAWGSISKM
                     SEFVVLLSEVLQYKLPCELPDASFKALRAADNTVEDAYDDDTNVAEHLTKLLVNIIQL
                     ARRAGLMSKNPVDLAWMLDQLDIDTLFYNMATSTEIPTKSVAQHWTYNKLLSVVSEAL
                     QLSIYAASPASRQTLTGTLANNNDHWFLVG"
     gene            <368904..>370436
                     /locus_tag="HG536_0B01960"
                     /db_xref="GeneID:59324452"
     mRNA            <368904..>370436
                     /locus_tag="HG536_0B01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282113.1"
                     /db_xref="GeneID:59324452"
     CDS             368904..370436
                     /locus_tag="HG536_0B01960"
                     /inference="similar to AA sequence:RefSeq:NP_009685.3"
                     /note="ancestral locus Anc_3.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138008.1"
                     /db_xref="GeneID:59324452"
                     /translation="MVLSDKELFELNKKAASQGYKIKPRSNYNTVRGVNGPLVILENV
                     KFPRFNEIVNLTLPDGAVRQGQVLEVRGDRAIVQVFEGTSGIDVKKTTVEFTGQNLKI
                     PVSEDTLGRIFDGSGRPIDNGPKVFAEDYLDINGSPINPYARIYPEEMISTGISAIDT
                     MNSIARGQKIPIFSASGLPHNEIAAQICRQAGLVRPTKDVHDGHEENFSIVFAAMGVN
                     LETARFFKQDFEENGSLERTSLFLNLANDPTIERIITPRLALTTAEYLAYQTERHVLT
                     ILTDMSSYADALREVSAAREEVPGRRGYPGYMYTDLSTIYERAGRVEGRNGSITQIPI
                     LTMPNDDITHPIPDLTGYITEGQIFVDRQLNNKGVYPPINVLPSLSRLMKSAIGEGMT
                     RKDHGDVSNQLYAKYAIGRDAAAMKAVVGEEALSIEDKLSLEFLEKFEKTFVSQGAYE
                     NRTVFESLDQAWSLLRIYPKEMLNRISPKILDEFYDRSRDEDEDAGDEDEDESDKRKG
                     KD"
     gene            complement(<370552..>371766)
                     /locus_tag="HG536_0B01970"
                     /db_xref="GeneID:59324453"
     mRNA            complement(<370552..>371766)
                     /locus_tag="HG536_0B01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282114.1"
                     /db_xref="GeneID:59324453"
     CDS             complement(370552..371766)
                     /locus_tag="HG536_0B01970"
                     /inference="similar to AA sequence:RefSeq:NP_015408.1"
                     /note="ancestral locus Anc_3.387"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138009.1"
                     /db_xref="GeneID:59324453"
                     /translation="MNEDQRYKDPIVSLFCKTDVKGKLDEDAIRSWIAQQSQSDEDIK
                     NCAEALEIYTDLLKLEFYIAKSWDIRTLVQSVAVKFELAETNLDSKVDQDHDDSFYRD
                     IALKCIHDCDKLSNGLQKKQSRLDEIRRYLSSKRETILEDSSTFLLELWFTCRQELCL
                     MRDRVAAVFIRSKALMIDHELESFEHRLSDTTILSSYRSFMKILIEQLQDSEISSDQS
                     LFSECLQVFLDIEAMYNALNFNLLLDDNESLQDSLMVCSQSETNLDSSYNGQESSRWS
                     LPSRNPLNDHSRTSSLSGSSSFSMMMDRTNLAKELPSLLTAFNNAKKMEQEIESVRTT
                     PLGAQLPHITSHHEQQFTPSNLFRSKLYMMNQQQDCLRSFISSAGNSHSVNNGSDIAK
                     SLCKTGNGSSRR"
     gene            <372841..>374697
                     /locus_tag="HG536_0B01980"
                     /db_xref="GeneID:59324454"
     mRNA            <372841..>374697
                     /locus_tag="HG536_0B01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282115.1"
                     /db_xref="GeneID:59324454"
     CDS             372841..374697
                     /locus_tag="HG536_0B01980"
                     /inference="similar to AA sequence:RefSeq:NP_009684.1"
                     /note="ancestral locus Anc_3.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138010.1"
                     /db_xref="GeneID:59324454"
                     /translation="MVDLDKERPLQDVGKNYLQNFDENGRTEIIARRTLMTGLLGGKS
                     RSNAARFAILALHLLENYRKPSRGECEKGEAGAWSVAARNFCEKEEGGIAQAVYKRLR
                     GSISGSKPYFELEKDDYQEMAELAKGKELRTTNTESHSDKPAPGNIIVVSNRLPVTIN
                     KNQKTGEYEYKMSSGGLVTALQGLKKTSTFQWYGWPGLEIPDDEKEGVRKDLLEKFNA
                     IPIFLSDEIADLHYNGFSNSILWPLFHYHPGEINFDENAWLAYNEANLTFAEEIFKNI
                     HDNDVVWVHDYHLMLLPEMIRERISQTKLQNIKLGWFLHTPFPSSEIYRILPVRQEIL
                     KGVLSCNLIGFHTYDYARHFLSAVQRILNVNTLPNGVEYQGRFVNVGAFPIGIDVETF
                     TDGLRKPEVKERISKLKETFKGCKIIVGVDRLDYIKGVPQKLHALEVFLNEHPEWIGK
                     VVLVQVAVPSRGDVEEYQYLRSVVNELVGRINGQFGTVEFVPIHFMHKSVPFEELISL
                     YAVSDVCLVSSTRDGMNLVSYEYIACQEEKKGSLILSEFTGAAQSLNGALIVNPWNTD
                     ELSDALNEALTLPEEKRDANWEKLYKYISKYTSAFWGENFVHELFSTSDNAE"
     gene            <374983..>376185
                     /locus_tag="HG536_0B01990"
                     /db_xref="GeneID:59324455"
     mRNA            <374983..>376185
                     /locus_tag="HG536_0B01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282116.1"
                     /db_xref="GeneID:59324455"
     CDS             374983..376185
                     /locus_tag="HG536_0B01990"
                     /inference="similar to AA sequence:RefSeq:NP_009683.1"
                     /note="ancestral locus Anc_3.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138011.1"
                     /db_xref="GeneID:59324455"
                     /translation="MGQLLSHPLTEKEIEYNDYKNSSHGHSSGSGHKNDQVGIPRYYN
                     CVGSMQGYRLTQEDAHLVLNEDKSLVVTFYNPFEGKSELLKLSVFALFDGHGGDECSS
                     FLSGAHQKSSKNGIAKWIAYSFEHHQYGALLSEAVDASVEDGDSGISPPTAKRGFRTL
                     VGLISQVLKDAFFLQDQELYKHFSNSSCGSTAVVAIIINQESLYVANCGDSRCILSSK
                     ALGIKTMSFDHKPQHIGELLRINDNGGTVSLGRVGGVLALSRAFSDFQFKRAVSYTRK
                     SPKSHHSTGIPPQESQVTVEPDVLMHKINYSKDEFLVLGCDGIWDIYSNKQLVQFIKY
                     HLTLGVNLEGIVTKLLDHGIAQANSNTGVGFDNMTAIIVVLNKPGETLSAWYAKMKVR
                     LERERGLS"
     gene            <376601..>377080
                     /locus_tag="HG536_0B02000"
                     /db_xref="GeneID:59324456"
     mRNA            <376601..>377080
                     /locus_tag="HG536_0B02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282117.1"
                     /db_xref="GeneID:59324456"
     CDS             376601..377080
                     /locus_tag="HG536_0B02000"
                     /inference="similar to AA sequence:RefSeq:NP_009678.3"
                     /note="ancestral locus Anc_3.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138012.1"
                     /db_xref="GeneID:59324456"
                     /translation="MSSSQAVRDAAKQLVSVLERFPAQRIRHIVSFKDSQIERFKRVA
                     GLSVDGGSGNNKKASIEEIKDIINRTSGPLGLQKDLLKKMQAALPDDELSLQSIEEQI
                     KALNSLTSNKYKNYYDVGDKLYKPAGNPQYYQRILDEIEGKKKETFMSAFRTVVFGK"
     gene            complement(<377105..>377944)
                     /locus_tag="HG536_0B02010"
                     /db_xref="GeneID:59324457"
     mRNA            complement(<377105..>377944)
                     /locus_tag="HG536_0B02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282118.1"
                     /db_xref="GeneID:59324457"
     CDS             complement(377105..377944)
                     /locus_tag="HG536_0B02010"
                     /inference="similar to AA sequence:RefSeq:NP_009677.1"
                     /note="ancestral locus Anc_3.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138013.1"
                     /db_xref="GeneID:59324457"
                     /translation="MVEYNCLYLKNLPRRPRSNANFTRLLLNHINPHNKFAIDPSLPL
                     PANETFGNGPLRLLDETLGIIQISRSVRLENQCFITFIDHESANSFKSRFEHDWKVKG
                     RLIEVQFATKNSLMGLAVTDQDLLHHVLKKRQMQRRIDSNEDLKESRRLQRRLRRLRC
                     KLRKKGLSAEEIGKVTETVKDQRPQVSEPRKKQTGEKPVVLRENPPNKVLLVQNLPRD
                     TTVSAITELFRSAALLEVRLVAVRRLAFVEYESIEAAAATRDKLGASHSWNGHQINIE
                     FAK"
     gene            complement(<378091..>379467)
                     /locus_tag="HG536_0B02020"
                     /db_xref="GeneID:59324458"
     mRNA            complement(<378091..>379467)
                     /locus_tag="HG536_0B02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282119.1"
                     /db_xref="GeneID:59324458"
     CDS             complement(378091..379467)
                     /locus_tag="HG536_0B02020"
                     /inference="similar to AA sequence:RefSeq:NP_009676.1"
                     /note="ancestral locus Anc_3.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138014.1"
                     /db_xref="GeneID:59324458"
                     /translation="MGKEKSHVNVVVIGHVDSGKSTTTGHLIYKCGGIDKRTIEKFEK
                     EAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYQVTVIDAPGHRDFIKNM
                     ITGTSQADCAILIIAGGVGEFEAGISKDGQTREHALLAFTLGVRQLIVAVNKMDSVKW
                     DESRFQEIVKETSNFIKKVGYNPKTVPFVPISGWNGDNMIEATTNAPWYKGWEKETKA
                     GVVKGKTLLEAIDAIEPPARPTDKPLRLPLQDVYKIGGIGTVPVGRVETGVIKPGMVV
                     TFAPAGVTTEVKSVEMHHEQLEEGLPGDNVGFNVKNVSVKEIRRGNVCGDSKNDPPKA
                     TESFNATVIVLNHPGQISAGYSPVLDCHTAHIACRFDELLEKNDRRSGKKLEDSPKFI
                     KSGDAALVKFVPSKPMCVEAFSDYPPLGRFAVRDMRQTVAVGVIKSVVKTDKAGKVTK
                     AAQKAAKK"
     gene            complement(<380108..>380881)
                     /locus_tag="HG536_0B02030"
                     /db_xref="GeneID:59324459"
     mRNA            complement(<380108..>380881)
                     /locus_tag="HG536_0B02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282120.1"
                     /db_xref="GeneID:59324459"
     CDS             complement(380108..380881)
                     /locus_tag="HG536_0B02030"
                     /inference="similar to AA sequence:RefSeq:NP_015404.1"
                     /note="ancestral locus Anc_3.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138015.1"
                     /db_xref="GeneID:59324459"
                     /translation="MLKRNQLWKVVLLLLTLVTAVTCVRNYHDRITDAADNKPSPGGD
                     HEEADLFCAVMNPTTGTFIDLSQLSSTPNNPRGSRGSGQHSDPSKTRWLVSGWGYYTN
                     FTLGVCSSPVTADQEPELHNTTGAYYVDPRSQKLVSIGDFATHPTLSRAKKLTLQYDN
                     GALCPNGVDRKSTVLSFMCDRDVASNAQITFVASVHDCAYFFEVRSVHACPTSARSNE
                     VNVLGIFVGIFAVFFLVEFGGRRWLYGKVKTHFHSGGSG"
     gene            complement(<381210..>382139)
                     /locus_tag="HG536_0B02040"
                     /db_xref="GeneID:59324460"
     mRNA            complement(<381210..>382139)
                     /locus_tag="HG536_0B02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282121.1"
                     /db_xref="GeneID:59324460"
     CDS             complement(381210..382139)
                     /locus_tag="HG536_0B02040"
                     /note="ancestral locus Anc_3.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138016.1"
                     /db_xref="GeneID:59324460"
                     /translation="MLPVSQHNASDLTVRSGYAYLLSDPSHVRVTRRASRNSLYLVHL
                     FQINNSHACVVPQTMGFGLSAEPWAENDLPSGRDEILNGGLQMASDVLKNWKRGKLYK
                     FKNPNGEDFQVQTFHTYHGSEYWLSRQSKHTIDEALYEKMVYYLNGSERTKTGEWAMP
                     DRTRRSRLEKEYIEVLSDCEILKVTDSGWALVNLEYNLGKPLSIRDFNEWVYPIAPYV
                     DETGREVSLIVSLNAQVPMKQSSVEKNHTAAYYASVERLAYDRDTGELEWLMCTTSDA
                     GGNVPKWMQNATIAKTVAKDVPYLFNFLNTKQT"
     gene            <382138..>383214
                     /locus_tag="HG536_0B02050"
                     /db_xref="GeneID:59324461"
     mRNA            <382138..>383214
                     /locus_tag="HG536_0B02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282122.1"
                     /db_xref="GeneID:59324461"
     CDS             382138..383214
                     /locus_tag="HG536_0B02050"
                     /inference="similar to AA sequence:RefSeq:NP_015400.1"
                     /note="ancestral locus Anc_3.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138017.1"
                     /db_xref="GeneID:59324461"
                     /translation="MSVASISSSGDGTSYSVVSSTGLVLADSSTSSCVECGTPPPCPQ
                     CASDEYCLQTEQTCSECSTTRCVKKNGSSTSSLNGSGNQSGGANGKVVGGVVGGVVGG
                     VVVLAALLLFFLYHRYWKKALRERAEAAKAGTGSYFMDDNEMGDADDFTDSESEEEDL
                     LSENRRRSHHPHAVDRETFAAKGPPGADHSDRHSTVTVQTRASNILPIAYIPGVTSGG
                     AGGSRASRLFRGLNTSNLNTAGDMRSHITLGSSILGGIEDEEEQADHDTKKEPQRNRS
                     QDNLTTAIRARPKLVQIQEEEIPEKPSQDHTTNADSQRPEQASSEDDDNGSFILDVAI
                     GDTKRSSPTASHASSPFEDKYQIP"
     gene            <383717..>385759
                     /locus_tag="HG536_0B02060"
                     /db_xref="GeneID:59324462"
     mRNA            <383717..>385759
                     /locus_tag="HG536_0B02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282123.1"
                     /db_xref="GeneID:59324462"
     CDS             383717..385759
                     /locus_tag="HG536_0B02060"
                     /inference="similar to AA sequence:RefSeq:NP_009675.3"
                     /note="ancestral locus Anc_3.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138018.1"
                     /db_xref="GeneID:59324462"
                     /translation="MVEYTDIDRLAISTIRLLAVDAVSKANSGHPGAPLGMAPAAHVL
                     LRHMRMNPKNPDWINRDRFVLSNGHACALLYSMLHLTGYDFSIEDLKQFRQLNSKTPG
                     HPEFELPGVEVTTGPLGQGISNAVGMAIAQANLAATYNKPGFTLSDSYTYSFLGDGCL
                     QEGVSSEACSLAGHLQLGNLIAIYDDNKITIDGDTDVSFTEDVLKRYEAYGWEVLTVE
                     NGNEDLDAISKAIEKAQQSKDKPTLIKMSTVIGFGSLHAGSHAVHGAPLKADDVKQLK
                     KKFGFDPEQSFVVPQEVYDFYQKNVAEPGAKLNAQWDKLFEEYQQKHQQLGQDLARRL
                     SGKLPENWCSKLPTYAPKDGAIATRKLSEITLENIYAELPELIGGSADLTPSNLTRWK
                     EAVDFQPPSSGLGDYSGRYIRYGIREHGMGAIMNGISAFGANYKPFGGTFLNFVSYAA
                     GAVRLAALSGHPVIWVATHDSIGLGEDGPTHQPIETLAHFRAIPNLGVWRPADGNEVS
                     AAYKSALESKHTPHIIALSRQNLPQLEGSSVEKALKGGYVLQDVANPDIVLVATGSEV
                     SLCVEAAKILKDKHVNARIVSLPDTLTFDKQSEEYKLSVLPDRIPILSVEVLSTAGWS
                     KYAHQSFGLNRFGASGKAADVFKMLDFVPEGVASRAEKTIAFYKGREVDSPLRTAF"
     gene            <386006..>386491
                     /locus_tag="HG536_0B02070"
                     /db_xref="GeneID:59324463"
     mRNA            <386006..>386491
                     /locus_tag="HG536_0B02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282124.1"
                     /db_xref="GeneID:59324463"
     CDS             386006..386491
                     /locus_tag="HG536_0B02070"
                     /inference="similar to AA sequence:RefSeq:NP_015398.1"
                     /note="ancestral locus Anc_3.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138019.1"
                     /db_xref="GeneID:59324463"
                     /translation="MTVDSEPKISLAFVCLGNICRSPMAEAVFKHVVTQKGLQDRFDV
                     IDSFGTGGWHVGSDPDPRSAACCRSHKVFINHKAQQIRGSHFDKFDYIICMDESNLRN
                     LQRLKPKNSKASVHLFGEWNTNGKFRKIVDDPYYGGDDGFEYNFKQISYFSEQFLEKE
                     L"
     gene            complement(<386580..>388304)
                     /locus_tag="HG536_0B02080"
                     /db_xref="GeneID:59324464"
     mRNA            complement(<386580..>388304)
                     /locus_tag="HG536_0B02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282125.1"
                     /db_xref="GeneID:59324464"
     CDS             complement(386580..388304)
                     /locus_tag="HG536_0B02080"
                     /inference="similar to AA sequence:RefSeq:NP_015397.1"
                     /note="ancestral locus Anc_3.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138020.1"
                     /db_xref="GeneID:59324464"
                     /translation="MSQRKLQQDIDKLLKKVKEGLIEFEEVYDKFQSTDPENSSHREK
                     LESDLKREIKKLQKHRDQIKTWLSKEDVKDKQDALKENRRAIENGMERFKSVEKLMKT
                     KQFSTEALTNPDIIKDPRELKKRDQFVFIQDCLDELQRQLESYEAQDQHEQVERHEFH
                     IHNLENVLKLLQNNEMEPETVEEYQDDIKYYIENNDEPDFIEYDTLYEDMGCESKPNQ
                     EDNKEVSSSIAISSSATAAGTVATTISTIPTTGNNNASLKQVKKTERSPKKKAQHQGV
                     TSTASTPTRGTPVPVSPQSPSPESAGLSHPNNGTSNSTKKSETDCAQSREELPFPPDK
                     SEQISQQIERDIKDNDAFKNPLFGEGLKYWLNSKRPLMQPYNDMPERMVSQLESSLLN
                     CPDSLDADSPHFYRKPLSLPHPTSIFFPNEPIRFVYPNDNGPFHAQNQSEEQLQNSKN
                     GESDQSGQSHSWKTEQNSGEDIYSRTSLAKIFTKFDLDTLFFIFYHYQGTYDQFLAAR
                     ELSKNRKWRFSKKDRCWYYKEVEKLPPGLPQSEEESWRYFDYQGSWLARRCNNDMVPK
                     EEDFEKIF"
     gene            <388948..>393117
                     /locus_tag="HG536_0B02090"
                     /db_xref="GeneID:59324465"
     mRNA            <388948..>393117
                     /locus_tag="HG536_0B02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282126.1"
                     /db_xref="GeneID:59324465"
     CDS             388948..393117
                     /locus_tag="HG536_0B02090"
                     /inference="similar to AA sequence:RefSeq:NP_009673.1"
                     /note="ancestral locus Anc_3.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138021.1"
                     /db_xref="GeneID:59324465"
                     /translation="MSAHKWIDKLDNPTLSVLPQDFITPQQEPFVEQASCSVPVPQLD
                     ALPSTLQNKYALALGIWTALLYRLTGDDDIVLYVAQNKVLRYTIQPNFTFQDLYNTVI
                     EELASLPDSNGISFDSLAEKVADDKDLDRPPRFFRLAFLQDQRDFKLDQFKHHLCDMA
                     FSLTGGQGGSILEIIYNSLLYSSERISILADQYVQFASAVLSNPLSCITKVSLMLPSS
                     TEVLFDPKAELGWCDFVGCIHDIFQDNAEKFPERTCVVETPSASSPVSRSFTYRDINC
                     ASNIVAHYLIDTGIKRGDVVMIYSSRGVDLMVCVMGVLKAGATFSVIDPAYPPARQTI
                     YLGVAKPRGLIVIRSAGELDQLVEDYISKELDVVSRIPSIAIQEDGSLQGSLDDSADI
                     LAPYEKLKDTRTGVVVGPDSNPTLSFTSGSEGIPKGVLGRHFSLAYYFNWMAKKFNLS
                     EKDKFTMLSGIAHDPIQRDMFTPLFLGAQLYVPAQDDIGTPGKLAEWMSKYGCTVTHL
                     TPAMGQLLAAQATTPFPKLHHAFFVGDILTKRDCLRLQTLAENCRIVNMYGTTETQRA
                     VSYFEIKSRAEDPTFLKKLKDVMPAGKGMLNVQLLIVNRNDRSQICGIGEIGEIYVRA
                     GGLAEGYRGLPELNKEKFVNNWFVEPNHWDYLNKDQGEPWRQFWFGPRDRLYRTGDLG
                     RYLPDGNCECCGRADDQVKIRGFRIELGEIDTHISQHPLVRENITLVRKNNENEPTLI
                     TFMVPRFDKPDELSPFQTDIPEEIKSDPTVSGLVGYHLLAKNIKEFLKKRLASYAIPS
                     LIVVLNKLPLNPNGKVDKPKLQFPSNKQLNLVAQSSMTDVDDSAFTEIERQVRDVWLN
                     VLPTKPAFISPEDSFFDLGGHSILATRMIFSLKKELQVDLPLGTIFKFPTIKAFAAEI
                     SRIKSSRESAHASQSAVAFDYANDAKELAETLPSSYPSRSPFIRPSEATGKSTINVFV
                     TGVTGFLGSYILADLLKRSTPHYDIKVYAHVRAKDESAGLERLQKAGVVYNTWSSDFE
                     NRIQIVLGDLSKPAFGLSDDKWSKLTEEIDVIIHNGALVHWVYPYTKLRDANVVSTVN
                     VMSLAATGKAKYFNFVSSTSTLDTDYYFSLSDKSEAEGKTGVQESDDLMGSAEGLGGG
                     YGQSKWAAEYIIRRAGERGLRGCIVRPGYVTGASRNGSCNTDDFLLRFLKGCLQLGKV
                     PKIDSTVNMVPVDHVARVVTATALNPPSENEFTVAQVNSHPRIALTDYVLELRKYGYD
                     VTVESYDEWKKTLEKSVIEEGQDNALYPLLHMVLENLPENTKAPNLDDKNAVTSLKKD
                     IEWSGEDVSNGKGATSEQIGIYISFLRKVGFLPAPTQEGTVKLPAVELSQQQLELVAS
                     GAGARGSSAAA"
     gene            complement(<393158..>395386)
                     /locus_tag="HG536_0B02100"
                     /db_xref="GeneID:59324466"
     mRNA            complement(<393158..>395386)
                     /locus_tag="HG536_0B02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282127.1"
                     /db_xref="GeneID:59324466"
     CDS             complement(393158..395386)
                     /locus_tag="HG536_0B02100"
                     /inference="similar to AA sequence:RefSeq:NP_009672.1"
                     /note="ancestral locus Anc_3.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138022.1"
                     /db_xref="GeneID:59324466"
                     /translation="MSQEGGFIRKRRTRASRKKVDYAEQSDGEVVEVKREDDKAVEGR
                     ESDGEDDDDDEPLSKKRKVAKRQQKVAERQRKPAPKKKARMTDEQKKIARFERSTQRM
                     FQHHPELAEVFQRLRETPRAKPVQARQPDGMCVRLLPFQLEGLHWLVQQENSKYRGGV
                     LSDEMGMGKTIQTIALLMHDVSKTPSLVVAPTVALMQWKNEIAQHTGGRLRTYLYHGA
                     ARTGQVEELEGVDVVLTTYSVLESVYRKQVYGFRRKSGLVKERSLLHNMRFHRVILDE
                     AHNIKDRTSNTAKAVNELNTEKRWCLTGTPLQNRIGEMYSLIRFLNVEPFSRYYCFAC
                     ECSSAQWKFTDNMHCDYCGHVFMQHRSFFNHFMLKNIQTFGAQGLGLDSLNNIQLLLK
                     DVMLRRTKVERADDLGLPPRIVTVRRDYFNEHEKDLYRSLYMDVKRKYNSYVEEGVVL
                     NNYANIFTLITRMRQLADHPDLVLKKMSSASNDSSVIVCQLCDDVAEEPIESKCHHRF
                     CRLCIKEYVESFMEENSRLICPVCHIGLSIDLSQAALEVDMESFQKQSIVSRLDMQGN
                     WRSSTKIEALVEELYHLRSDRRTIKSIVFSQFTSMLDLVEWRLKRAGFQTVKLQGSMS
                     PTQRDETIKYFMDNIHCEVFLVSLKAGGVALNLCEASQVFILDPWWNPSVEWQSGDRV
                     HRIGQHRPVKITRFCIEDSIESRIIELQEKKATMINATINQDEAAINRLTPDDLQFLF
                     NN"
     gene            <395999..>398902
                     /locus_tag="HG536_0B02110"
                     /db_xref="GeneID:59324467"
     mRNA            <395999..>398902
                     /locus_tag="HG536_0B02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282128.1"
                     /db_xref="GeneID:59324467"
     CDS             395999..398902
                     /locus_tag="HG536_0B02110"
                     /inference="similar to AA sequence:RefSeq:NP_009670.3"
                     /note="ancestral locus Anc_3.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138023.1"
                     /db_xref="GeneID:59324467"
                     /translation="MNVGIERMLVTPSQEQQQQQQQQQAAVAAVAAQEQAMDPLTQST
                     AETWLSIASLAETLGDADRAAMAYDATLQYNQSSTKALTSLAHLYRSRDMFQKAAELY
                     ERALAVNPELSDVWATLGHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYD
                     RYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWNQALECFRYILAQPPA
                     PLQEWDIWFQLGSVLENMGEWQGAREAYEHVLLQNEHHAKVLQQLGCLYGMNNVQFYD
                     PQKALNFLLKSLEVDPSDATTWYHLGRVYMLRSDYTAAYDAFQQAVNRDSRNPIFWCS
                     IGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAAR
                     LDPNNGHIRERLEALTQQLADSSHVIGSANQSAGPKGASAQSGAQNLASSSAPPPVML
                     QPTLQSTDQGNPLNVRPPTATLYANGPLAQQPQQQQQPQQQQIPIHVLAQAQPQISQY
                     AMAVPQQSPLTMLPPPPQHAQMKPLVGVQQAGSAYPQTQAIYHQPIIHANQPAPVSNA
                     DSQNQVSPVLPQKRHIDGSIHTLVDAAVSSNASENEKSAPVSSVSPSQVPTLPASQRN
                     PTEHQHKKLKTKTSPKATAAHLRIRSTTVKDKEKEKGKDKASTAKQRKNSVSNGKESK
                     DPNNGPKAKLSQEKKSVENNGLPELKKATTADSAATITAPASANVSILALGSEVPTGS
                     SIAESDAKDISRPVVESVQSSNGELASVEARESVKHSAIEAVAEAKASTTVETTEKSV
                     SAPSPVRIAETDVRQVDNTSDKTIFSKTSPSGESDIVAVPTGPAVSNLDGTIKQESGA
                     PSTAIDNKVKEANGQPNEVVNKSAISDSPKNTVEAAVEHVQLAAGTSGEPETVIKPSV
                     EAMEKLQEEARIREEEEKERLESQNNNKPQSDLTNIARENVVREIEEDENYDD"
     gene            complement(<398997..>399427)
                     /locus_tag="HG536_0B02120"
                     /db_xref="GeneID:59324468"
     mRNA            complement(join(<398997..399076,399140..399279,
                     399342..>399427))
                     /locus_tag="HG536_0B02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282129.1"
                     /db_xref="GeneID:59324468"
     CDS             complement(join(398997..399076,399140..399279,
                     399342..399427))
                     /locus_tag="HG536_0B02120"
                     /inference="similar to AA sequence:RefSeq:NP_878049.2"
                     /note="ancestral locus Anc_3.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138024.1"
                     /db_xref="GeneID:59324468"
                     /translation="MDGIADNGDSSRLKTEIQRYLVETGSYQTISNQLTERLLQDGWI
                     DAVRGLIASEMRSSNSSNYSEILAKVEPKALEMVSQPIKEQVLSQIETFLDEIVDKR"
     gene            <400018..>400725
                     /locus_tag="HG536_0B02130"
                     /db_xref="GeneID:59324469"
     mRNA            <400018..>400725
                     /locus_tag="HG536_0B02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282130.1"
                     /db_xref="GeneID:59324469"
     CDS             400018..400725
                     /locus_tag="HG536_0B02130"
                     /inference="similar to AA sequence:RefSeq:NP_009669.1"
                     /note="ancestral locus Anc_3.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138025.1"
                     /db_xref="GeneID:59324469"
                     /translation="MISRVKLVKQIVPSVRLSRILVRSMSASKGKPEQAKLLKARKAE
                     SDECKWIGLEKLTYLDPNGNEREWDSAVRLTRGKGEVDGIGILAILKYKDGTPDEILL
                     QKQFRPPVEGVCIEMPAGLIDEGESIATAALRELKEETGYVGKIVAQGPVAFNDPGFT
                     NTNLSLVTIEIDMSAEENLDPQPSLEDGEFIECFKVPLKDFADEMAALDKQGYKLDAR
                     VQNVAQGIQLAKIYNIF"
     gene            complement(400773..400854)
                     /locus_tag="HG536_0Btrna4S"
                     /db_xref="GeneID:59324977"
     tRNA            complement(400773..400854)
                     /locus_tag="HG536_0Btrna4S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCA"
                     /db_xref="GeneID:59324977"
     gene            complement(<400971..>402479)
                     /locus_tag="HG536_0B02140"
                     /db_xref="GeneID:59324470"
     mRNA            complement(<400971..>402479)
                     /locus_tag="HG536_0B02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282131.1"
                     /db_xref="GeneID:59324470"
     CDS             complement(400971..402479)
                     /locus_tag="HG536_0B02140"
                     /inference="similar to AA sequence:RefSeq:NP_015395.1"
                     /note="ancestral locus Anc_3.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138026.1"
                     /db_xref="GeneID:59324470"
                     /translation="MSSDSYDERLDEIIQLFQDYKSGSVKLDNITKLCQTLGLESFIE
                     DVESDVSRLSAASKIIVIDIDFAKEKGKVTDVKLVLASNFDNFNYYVDHENNESASGN
                     ILLNSLTQYHDLHEFHHNLKYLHLLDTFSNIDIDASNGSTNANGTNVTTAVETGGQGA
                     YSGKMDLFKYHTELAQFIRHYFEANSAPFRVHANLHNRFGIYVLGAQDNELLAKIYLS
                     RAKDPRQRLYEFTYKKDSQDWINESAENYTCGISLAMEILCDEVSCWFPQDFIPDDLI
                     QVINGGGGDGQRTSAKFDLNELIQSSKNNAAFNTKFELVNDFNGKLMNLRTFDISNDN
                     LNLILEILNWLQWSQKVLQPVLTLLFGPSEIANEVKAQDGQGVMSGARPRRSSASSGH
                     KRRRFSGNRRPSITEATMLRDEGFQQFTLNEILTNPKAVTSQQSADSNIPNIASQDKM
                     DVDQPVDDSEDPIQLVVSEDHVSLADIAHCSLYEASEKWESFIDTIQKYSLK"
     gene            <402937..>403824
                     /locus_tag="HG536_0B02150"
                     /db_xref="GeneID:59324471"
     mRNA            <402937..>403824
                     /locus_tag="HG536_0B02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282132.1"
                     /db_xref="GeneID:59324471"
     CDS             402937..403824
                     /locus_tag="HG536_0B02150"
                     /inference="similar to AA sequence:RefSeq:NP_015394.1"
                     /note="ancestral locus Anc_3.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138027.1"
                     /db_xref="GeneID:59324471"
                     /translation="MSGQEITHPTIVDGWFREISDTMWPGQAMTLKVDKVLHHEKSKY
                     QDVLVFKSTDYGNVLVLDNVIQATERDEFSYQEMISHLALNSHPNPKKVLVIGGGDGG
                     VLREIVKHELVEEAWLCDIDEAVINVSKKYLPEMSASYSHPKVKTYIGDGFQFLRDYQ
                     NTFDVIITDSSDPEGPAETLFQEEYFKLLNSALTEKGVITTQAESMWIHLPIIKDLKK
                     ACSAVFPVAEYAYTTIPTYPTGQIGFMVCSKDKEANVKKPLRQLSDEEESKLYRYYNK
                     RIHEASFVLPTWVAKELNN"
     gene            <403991..>405397
                     /locus_tag="HG536_0B02160"
                     /db_xref="GeneID:59324472"
     mRNA            <403991..>405397
                     /locus_tag="HG536_0B02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282133.1"
                     /db_xref="GeneID:59324472"
     CDS             403991..405397
                     /locus_tag="HG536_0B02160"
                     /inference="similar to AA sequence:RefSeq:NP_015393.1"
                     /note="ancestral locus Anc_3.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138028.1"
                     /db_xref="GeneID:59324472"
                     /translation="MVKTVISTSEFQAQVSDLLPCNKCRKSQLTHALIQSFSLLDGFD
                     KIIRYPICSKKDILQFHTAAYADAILNERLNRVLPSAEDESEWSQLPDLASCWNGRET
                     NRSAWFESRLKLYSKFKAAEKTAIVVSRKRSAWDALLEDDSHGEDYGEDKKIDPEDLK
                     KYNLEGDCPMFSYLPMYCQVVTGATLALADEAVRGEKSISINWDGGRHHAFKQKASGF
                     CYVNDIVLLIQKLRSQGFESISYVDFDLHHGDGVEKAFQYSKHVQTISLHMFEAGFFP
                     GTGSLQNNSRGSNVVNIPLLHGLDDMLLDQLVGKLVKPLLKKHRPEALIIQCGGDGLM
                     GDGFNEWQLSIRQLAKCIVNLASLFENVPVFLLGGGGYNETLMSRFYAYLTYKILRKF
                     SLKQIPNFDFDTDALIPDHEFVEAYAHEGYKFWAYEQEGGLRKKHLKNDNNPELLTLL
                     QNHYNVKLDSDDNISENS"
     gene            complement(<405421..>406770)
                     /locus_tag="HG536_0B02170"
                     /db_xref="GeneID:59324473"
     mRNA            complement(<405421..>406770)
                     /locus_tag="HG536_0B02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282134.1"
                     /db_xref="GeneID:59324473"
     CDS             complement(405421..406770)
                     /locus_tag="HG536_0B02170"
                     /inference="similar to AA sequence:RefSeq:NP_009668.3"
                     /note="ancestral locus Anc_3.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138029.1"
                     /db_xref="GeneID:59324473"
                     /translation="MIEESHLKWVSLLIAVYLTVPLLGYILIPYLLYGNRSTKKRVIL
                     YVLGDIGHSPRMCYHALSFSEHGWQVEFCGYVEDALPRSIVEDPNITVHAIPTYRGRN
                     GSKLLSMVRKVALQIFAITRQLWELRGSDYLLMQNPPTIPILPLAMLYRFTGCKLIID
                     WHNLGYSILQMKFGGSFWHPIIVIHYIVERLFAKFATYNLTVTKAMKNYLVNSFGLSS
                     KRIAVLYDRPAAQFQPLPETCDRDRMLKTESFIKDLLPSDFDIKKGDKLIVTSTSFTA
                     DEDIGVLLGALKIYENSYEKFDQELPRIMCFITGKGPLKQKYVDQVMAYEWHRCKVEF
                     LWLSAEDYPKLLRLCDYGVSLHTSSSGLDLPMKILDMLGSGLPVIASNYPVLDELLQH
                     NVNGLKFIDRRELHESLIFAVKDSEIYKTLRKGALIEAENRWNSSWESAIGELKIIQ"
     gene            <406991..>407434
                     /locus_tag="HG536_0B02180"
                     /db_xref="GeneID:59324474"
     mRNA            <406991..>407434
                     /locus_tag="HG536_0B02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282135.1"
                     /db_xref="GeneID:59324474"
     CDS             406991..407434
                     /locus_tag="HG536_0B02180"
                     /inference="similar to AA sequence:RefSeq:NP_009667.1"
                     /note="ancestral locus Anc_3.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138030.1"
                     /db_xref="GeneID:59324474"
                     /translation="MSSNLTEEQIAEFKEAFALFDKDNNGSISSSELATVMRSLGLSP
                     SEAEVADLMNEIDIDGNHKIEFSEFLALMSRQLKSNDSEQELLEAFKVFDKNGDGLIS
                     AAELKHVLTSIGEKLTDAEVDDMLREVSDGSGEINIQQFAALLSK"
     gene            complement(<407589..>409697)
                     /locus_tag="HG536_0B02190"
                     /db_xref="GeneID:59324475"
     mRNA            complement(<407589..>409697)
                     /locus_tag="HG536_0B02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282136.1"
                     /db_xref="GeneID:59324475"
     CDS             complement(407589..409697)
                     /locus_tag="HG536_0B02190"
                     /inference="similar to AA sequence:RefSeq:NP_009666.3"
                     /note="ancestral locus Anc_3.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138031.1"
                     /db_xref="GeneID:59324475"
                     /translation="MSDFWDKNKGSITSGLKSAGKYGYQGTKYIAKTGYKAGKKNFNS
                     SKKDGHGKKEGEEEDEDEGYAKHDNYRSHYRDPSTFPPPPVRGPSSQQYPSSYQQQPP
                     SQQQPPSQQQTLPQQLPAYQQQPQYQQPQYQQPQYQQTDQQPPQPPPRSISSQGAQGI
                     SVPGPAATTVSSGDSVVVPQNFDSQASQITTAAASHALAAPDMEHRPAHDLPPLADSA
                     RPAYDRAGFPSPPLAGREAQANFTSATSIGGRSGASVPEVTPFEYGSLEARTLASRLP
                     TTAVDLTALPPPPTHKDRSTPDLTSGTANTPKQTKYQIRECPSPGGVESVVKSGPPVE
                     IGTVGTEAQTARPSAGSPPTIPSRQAAQQSAMSSQANPSFMEDTSAKNTDKEARGITG
                     RFDYEVKVDYAPPPKPHRGPRDASSKPIARTPAPLTQKAESNEPSSVSSSPALPKRQL
                     TSTAVNSNGTSVTSGTTFQPPPKPFRRPQASQHSSYSSTSSFPTAIKSDDGQQSKDVS
                     SFPPPPVRARPSAQSVVPTHDEGCSGAPPINPRGRLPSEFLPTERQHPIDESTDSIAG
                     RKKAPPPAVKPKPRGLLSRSSTAIPHPGREDREQSNAPDVSAITDELAHVRLRKSGSS
                     LLHNDTVGDSKERDQPTRSTIRPAVPPKRSSLKHVPPVSTKTSSDKASTNGSGQTDPA
                     NPFELYLKDAVPSEENRFHK"
     gene            <409854..>410510
                     /locus_tag="HG536_0B02200"
                     /db_xref="GeneID:59324476"
     mRNA            <409854..>410510
                     /locus_tag="HG536_0B02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282137.1"
                     /db_xref="GeneID:59324476"
     CDS             409854..410510
                     /locus_tag="HG536_0B02200"
                     /inference="similar to AA sequence:RefSeq:NP_009665.3"
                     /note="ancestral locus Anc_3.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138032.1"
                     /db_xref="GeneID:59324476"
                     /translation="MPYVWSFYTLSDSLDVVKSHAGLEEALRSTLRLEIRDNNDVPWK
                     AQLIQELEESSNIFILLDDDELRIPAILAYSGESTAIDTFTEWLKSSLGLIVTSIVLD
                     ASTMLQVADALTGKSQTYDTRLFFDIVTEAKNLTKMEMEIDKASLRSLSNSSGCSYSE
                     GLVSFLYNETGMRLERLPLASISMAGNAKIWRNKITTIEADVQDGVLQVILKSAQYQF
                     "
     gene            complement(<410557..>411147)
                     /locus_tag="HG536_0B02210"
                     /db_xref="GeneID:59324477"
     mRNA            complement(<410557..>411147)
                     /locus_tag="HG536_0B02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282138.1"
                     /db_xref="GeneID:59324477"
     CDS             complement(410557..411147)
                     /locus_tag="HG536_0B02210"
                     /inference="similar to AA sequence:RefSeq:NP_015392.1"
                     /note="ancestral locus Anc_3.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138033.1"
                     /db_xref="GeneID:59324477"
                     /translation="MAIAGTMSWRLFNSVTRSFIKGSFAARGAHRCYSSGEQIVKPVR
                     IINQPPGSEMHISERAFKRLSEIYRESKEVLKIAVESGGCHGFQYNMSLIPDAEAEKR
                     IGELETGAPEPPTRLEGDGEKDEFDDDFKDNREVIFVLPEEGGKVLVDENSLKILNKT
                     TLTYSTELIGSTFKITGGNLKSSCGCGSSFDVDTEQ"
     gene            complement(<411248..>412165)
                     /locus_tag="HG536_0B02220"
                     /db_xref="GeneID:59324478"
     mRNA            complement(<411248..>412165)
                     /locus_tag="HG536_0B02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282139.1"
                     /db_xref="GeneID:59324478"
     CDS             complement(411248..412165)
                     /locus_tag="HG536_0B02220"
                     /inference="similar to AA sequence:RefSeq:NP_015391.1"
                     /note="ancestral locus Anc_3.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138034.1"
                     /db_xref="GeneID:59324478"
                     /translation="MDCKILVLGAGGLGCEVLKNLAMSNVREIHVVDIDTIELTNLNR
                     QFLFRDSDIGKPKAEVAASYINRWSKRRRARNPDAHEVLVVPHVQDLTLLPAEFFTQF
                     QFVVSGLDSIGPRRYANEMVVRIARDSKYETCIPLIDGGTEGLKGHVKTVIPGITACW
                     ECSLDTIPAQQDTYPLCTIANNPRNLEHVISYAVTVSFPEANLDDPQDIQRLFDLSLE
                     RARAFNIDAKELTIEYLLGVVKHIIPSCSSTNSIVAAACTSRIVSIYYDLVDFDTMPT
                     FTVFNGSNGFFTHSFQYQRNADCIVCKGL"
     gene            <412940..>413938
                     /locus_tag="HG536_0B02230"
                     /db_xref="GeneID:59324479"
     mRNA            <412940..>413938
                     /locus_tag="HG536_0B02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282140.1"
                     /db_xref="GeneID:59324479"
     CDS             412940..413938
                     /locus_tag="HG536_0B02230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138035.1"
                     /db_xref="GeneID:59324479"
                     /translation="MVRIAINGFGRIGRLVLRVALSRKKIEVVAINDPFISTEYAAYM
                     FKYDSTHGRYPGEVTHDESHIIVDGHKIAVYQERDPSSLPWGKLNVDIAVDSTGVFKE
                     LDTCQKHIDAGAKKVVITAPSSTAPMFVMGVNEDKYTPDLKIVSNASCTTNCLAPLAK
                     VINDAFGIREGLMSTVHSITASQTTVDGPSQKNWRGGRTASDNIIPFATGAAKAVGKV
                     LPELKGRLTGMSFRVPTVDVSVVDLTVNLKRETTYEEIKKVVKAAAEGPLKGIMGYTE
                     DSVVSSDFLGDSHSSTFDAAAGIQLTPTFVKLVSWYDNEYGYSTRVVDLVEHVASA"
     gene            complement(<414233..>414802)
                     /locus_tag="HG536_0B02240"
                     /db_xref="GeneID:59324480"
     mRNA            complement(<414233..>414802)
                     /locus_tag="HG536_0B02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282141.1"
                     /db_xref="GeneID:59324480"
     CDS             complement(414233..414802)
                     /locus_tag="HG536_0B02240"
                     /inference="similar to AA sequence:RefSeq:NP_009664.1"
                     /note="ancestral locus Anc_3.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138036.1"
                     /db_xref="GeneID:59324480"
                     /translation="MNPQISNLVIMLVMMQLARRIDMEDEKNIMYIRIAYGTSVGLAW
                     IVYQLVRRIIVSKNDLTTLKYVTPASPMSGEGEKLEVTTVRDYDLKEIDSSIKSIYTG
                     LAMMGFMHFYMHYTNPLFMQAISPIKSALESNEVKIHLFGKAASGDLKRPFAAPSLFG
                     GFGGNNGPKTDKKSIEEAERAGTGGVKAE"
     gene            complement(<415227..>416093)
                     /locus_tag="HG536_0B02250"
                     /db_xref="GeneID:59324481"
     mRNA            complement(<415227..>416093)
                     /locus_tag="HG536_0B02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282142.1"
                     /db_xref="GeneID:59324481"
     CDS             complement(415227..416093)
                     /locus_tag="HG536_0B02250"
                     /inference="similar to AA sequence:RefSeq:NP_015390.1"
                     /note="ancestral locus Anc_3.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138037.1"
                     /db_xref="GeneID:59324481"
                     /translation="MDDSPREMGRYGEKEKIPRPRNAFILFRQHNHKLLIDEWTTKGL
                     EIPHNSKISKLLGVKWKELSNEEKVHWKELAEKEKTDHEKKYPDYRYKPVRKQRKKKE
                     PVPLAAPPQQPPQQQYHPQHQHQHQHQHHPPIAHRPAPGLLPFNNYTRPQLNEQHHVE
                     AAYRGVYPAPYYWPPYYMQQAYPYNYYAKTPNAPANPQVYPAPIPFQTPMQMPVQQRK
                     PSHEIPVNRDQVPDFSYYSAYQHQQHRPWNAPQPANPKPHPIVSSTPVVHDYQNSINH
                     PSPSQSQDSNSH"
     gene            <417084..>418061
                     /locus_tag="HG536_0B02260"
                     /db_xref="GeneID:59324482"
     mRNA            <417084..>418061
                     /locus_tag="HG536_0B02260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282143.1"
                     /db_xref="GeneID:59324482"
     CDS             417084..418061
                     /locus_tag="HG536_0B02260"
                     /inference="similar to AA sequence:RefSeq:NP_009663.1"
                     /note="ancestral locus Anc_3.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138038.1"
                     /db_xref="GeneID:59324482"
                     /translation="MINEVTKSLPRDPCSKKEWTEAVVEETVVRDAGAGFGSLALEKQ
                     QYLLSNDLYKCASGDSLSSLQQLADKTASESPPRKKFILEDHSTYTCGGSVRSAWPSA
                     CSSSTTTNFLRPRMEFSGYQISGYKKYQIEVALKTVDLPLNRCSSLTPHLTGFLTICG
                     LTNQHPEITTYFEAFAVTHKELGFLSSSWPEDSPMSPYRADDQTDLEHWLNFPAFKQL
                     FLPALGDSPSSRPTLNDVIEGDYEFANYLEQRFIFMRWKEKFLVPDAQIDGIAGASYD
                     GFYYIVHDQVTGNMQGFYYHKDAEKFQQLELIPSYKSLSSCTDCTFEFA"
     gene            <418446..>418724
                     /locus_tag="HG536_0B02270"
                     /db_xref="GeneID:59324483"
     mRNA            <418446..>418724
                     /locus_tag="HG536_0B02270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282144.1"
                     /db_xref="GeneID:59324483"
     CDS             418446..418724
                     /locus_tag="HG536_0B02270"
                     /inference="similar to AA sequence:RefSeq:NP_015388.1"
                     /note="ancestral locus Anc_3.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138039.1"
                     /db_xref="GeneID:59324483"
                     /translation="MPMVAMFLRNKFIAWFALIQSVHYYFNTDPEEASAAAASNKGSM
                     DQPPLMKVLLSVVGLVVCYMNLVIPQPPMAPSKAAETTSAAPSEPTTA"
     gene            complement(<418741..>419208)
                     /locus_tag="HG536_0B02280"
                     /db_xref="GeneID:59324484"
     mRNA            complement(<418741..>419208)
                     /locus_tag="HG536_0B02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282145.1"
                     /db_xref="GeneID:59324484"
     CDS             complement(418741..419208)
                     /locus_tag="HG536_0B02280"
                     /inference="similar to AA sequence:RefSeq:NP_015387.1"
                     /note="ancestral locus Anc_3.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138040.1"
                     /db_xref="GeneID:59324484"
                     /translation="MSTVGKYDQIGMDIAYEEAAKGLAEGGVPIGGCLINDEDGTVLG
                     RGHNMRFQKGSATLHGEISTLENCGRLPGHVYKRTTLYTTLSPCDMCTGAIIMYGIPR
                     CVVGENVNFKSPGEEYLRSRGHEVVVVDDERCKKIMRKFISERPHDWFEDIGE"
     gene            <419741..>420688
                     /locus_tag="HG536_0B02290"
                     /db_xref="GeneID:59324485"
     mRNA            <419741..>420688
                     /locus_tag="HG536_0B02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282146.1"
                     /db_xref="GeneID:59324485"
     CDS             419741..420688
                     /locus_tag="HG536_0B02290"
                     /inference="similar to AA sequence:RefSeq:NP_015386.1"
                     /note="ancestral locus Anc_3.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138041.1"
                     /db_xref="GeneID:59324485"
                     /translation="MVTSCCENVAWRKLLTSSFVSFSADFCSVSNSSGRRSYATVSSQ
                     SEDNSDIYYDLKWPKNNFPTPYDLFGIDNNTDGRHIDPKVMKKRYHEYARLYHPDVSR
                     NIRIIRSPIDQMQLDKNLLTVDEKLHRFKVTTQAYQILTDPKKKRLYDFTQGGWPYGP
                     AGAASTTPAAQYPGSHGYRSDHVYAYWNAGTWEDASQMNSEKQPIDAWVLFMWLCGFV
                     ICIQATALLTRIEDSLTRKNYTHEETEHDLLQSYTNYGLDTDKISRWRRFLWFRAYGL
                     YRSNTDLDREARRNEEMVQDILKKSEQSVKPVSETTRPE"
     gene            <420916..>421692
                     /locus_tag="HG536_0B02300"
                     /db_xref="GeneID:59324486"
     mRNA            <420916..>421692
                     /locus_tag="HG536_0B02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282147.1"
                     /db_xref="GeneID:59324486"
     CDS             420916..421692
                     /locus_tag="HG536_0B02300"
                     /inference="similar to AA sequence:RefSeq:NP_015385.1"
                     /note="ancestral locus Anc_3.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138042.1"
                     /db_xref="GeneID:59324486"
                     /translation="MNFKEADTVLDLKNIRDELVRMEDTIIFNFIERSHFPSCPVVYA
                     KDHPGLPLPNFDGSFLDWALLHMEKVQSQLRRFESPDETPFFPEEILKPILPNINYPQ
                     VLASYAQQINYNAKIKHIYEEEIVPLISKYEGDQSENYGSIATTDIACLQSLSRRIHF
                     GKFVAEAKYQNDKELYRKLIRNKDVNGIMQNITNAAVEEKILERLTTKADVYGVDPTN
                     KEGDRRITPEYLVKIYKEIVIPLTKEVEVEYLLRRLGDDA"
     gene            complement(<421845..>422762)
                     /locus_tag="HG536_0B02310"
                     /db_xref="GeneID:59324487"
     mRNA            complement(<421845..>422762)
                     /locus_tag="HG536_0B02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282148.1"
                     /db_xref="GeneID:59324487"
     CDS             complement(421845..422762)
                     /locus_tag="HG536_0B02310"
                     /inference="similar to AA sequence:RefSeq:NP_009662.3"
                     /note="ancestral locus Anc_3.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138043.1"
                     /db_xref="GeneID:59324487"
                     /translation="MSEEAQAPQLIDDLELHPKQDKARVVKDILAGTAGGIAQVLVGQ
                     PFDTTKVRLQTSPNSTTATEVIRNLLKNEGILAFYKGTLTPLVGIGACVSIQFGVNEA
                     MKRFFHSNGSGPSSTLTLPQYYICGLVSGLTNSFLASPIEHVRIRLQTQTGSGANAEF
                     RGPLDCIRKLRSHNKLMRGLSPTLLREGHGCGTYFLVYEALIAHEIKSGVMRTEIPAW
                     KLCSFGALSGTALWLMVYPLDVVKSVIQTDSLTNPKSGNSIVQVAKTLYVKGGLASFF
                     KGFGPTMLRAAPANAATFASFEFAMRLLQ"
     gene            complement(<422976..>424040)
                     /locus_tag="HG536_0B02320"
                     /db_xref="GeneID:59324488"
     mRNA            complement(<422976..>424040)
                     /locus_tag="HG536_0B02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282149.1"
                     /db_xref="GeneID:59324488"
     CDS             complement(422976..424040)
                     /locus_tag="HG536_0B02320"
                     /inference="similar to AA sequence:RefSeq:NP_015382.1"
                     /note="ancestral locus Anc_3.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138044.1"
                     /db_xref="GeneID:59324488"
                     /translation="MNRKDDQSADSVFGQTPAFSLTDPGVDPAVIEYLSCVRQEALRT
                     NVIKRSELKRHTADIYDDDDEVIVKKPKAHKDLPVRLKYVDSHLLVGVQWFETVKRAV
                     LDSRTVYQNHTEESLNLLLHFLREYLSGKLEGDGQASHILDVLQELPPKVGDGNDDYE
                     LDEEWAESVVKKLRTKHINSITDIKAVIGEVNSSKPIGFKQWYQYLQRTEPTQSAFNA
                     TIDGRNIWVLVQYMAQEWIKNISKGKKPAQASRFSNWLLYILFNIPDKLTAEYISNLR
                     SLGKKCRRAIRESQEGRGTQSLDRKTPSIKAICPRELTELDVPSPPEDLDVVQLALSV
                     IAVIYGQRDLIEWAIEDDQL"
     gene            <424202..>424591
                     /locus_tag="HG536_0B02330"
                     /db_xref="GeneID:59324489"
     mRNA            <424202..>424591
                     /locus_tag="HG536_0B02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282150.1"
                     /db_xref="GeneID:59324489"
     CDS             424202..424591
                     /locus_tag="HG536_0B02330"
                     /note="ancestral locus Anc_3.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138045.1"
                     /db_xref="GeneID:59324489"
                     /translation="MKRSIGASGYDGRLDFTRKTADVGVTCQEHPCVNVYVPIELYQC
                     HVQQYHDNRCVQCGKNLVTENFLRLHLEEMHNPFNSGDGIRYRCFEEQCDEAFYSHQE
                     RVSHAVKSHQYPESFDFDIVQNGQLFS"
     gene            complement(<424593..>425570)
                     /locus_tag="HG536_0B02340"
                     /db_xref="GeneID:59324490"
     mRNA            complement(<424593..>425570)
                     /locus_tag="HG536_0B02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282151.1"
                     /db_xref="GeneID:59324490"
     CDS             complement(424593..425570)
                     /locus_tag="HG536_0B02340"
                     /inference="similar to AA sequence:RefSeq:NP_015381.1"
                     /note="ancestral locus Anc_3.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138046.1"
                     /db_xref="GeneID:59324490"
                     /translation="MDAISDPAFHSTKLKSQYAEETPSLLTLVIDTAPKLWAELDNEG
                     DQNANIISVLESIIVFLNAHLAFNSSNQVAVIAAHSQGIKYLYPKSNLNQNKVTTTSL
                     PGKDLSIINNDMYRQFRNVDETLVEELYKLFQEEKDQVEKATQKSTLAGGISAGLTYI
                     NRISRELARISFKSRLLVITCGSGGGRDEIFQYIPIMNCIFAATKLKCPIDVVKIGGH
                     KESTFLQQTTDATNGVYLHLNSTQGLVQYLSTAMFIDPSLRPIIVKPNQGSVDFRTSC
                     YLTGKVVAIGYVCSVCLCVLSILPPANKCPACDSEFDEKVIAKLKKSNK"
     gene            complement(<425736..>427280)
                     /locus_tag="HG536_0B02350"
                     /db_xref="GeneID:59324491"
     mRNA            complement(<425736..>427280)
                     /locus_tag="HG536_0B02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282152.1"
                     /db_xref="GeneID:59324491"
     CDS             complement(425736..427280)
                     /locus_tag="HG536_0B02350"
                     /inference="similar to AA sequence:RefSeq:NP_009661.1"
                     /note="ancestral locus Anc_3.344"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138047.1"
                     /db_xref="GeneID:59324491"
                     /translation="MSISSEELNYLIWRYLQENGKEVSALALQDETRVLDFDRKYSKD
                     IPFGTLVNLVQKGILYTECDLLVEYNGEMKKVDEEHFTQDFNLAQALQVEKEKGPDRL
                     INGRFALESDSMDEQPKEEDQRDLQRQEEGPKSVEEGIEAEGFIKTLKEFYKLGNIVS
                     TCWNPVEKSMLAVGEKHSQARIYSFDENSGALLNEIELKHPFAPTSPVGNANNELSCL
                     AWSPNGMQIVTAVENGELRLWNRDGSLQNVFNFHRSPIVCIKWNKDSAHFITADVDNV
                     TVVWNATTGTAIQHFELKASESSGDSLGVDLEWVEIDKFIIPGPQGSLVVHQIGESKP
                     VGRLVGHQGAISALQFNPGNKMLLSASDDHTVRVWRGGSSNPSYCFLGHSQSVVSVDW
                     VDDKRVLSASMDGSVRLWSLADNSLLAISVADGVPVFSARLSQDKNKYAVGFVDGQVI
                     VYDMKSLLASLDTRKRYPIPLSFPIYGTYQSPTNGDNVFDLSWAFKSDKVAVAFSTGQ
                     GSILCL"
     gene            <427521..>429686
                     /locus_tag="HG536_0B02360"
                     /db_xref="GeneID:59324492"
     mRNA            <427521..>429686
                     /locus_tag="HG536_0B02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282153.1"
                     /db_xref="GeneID:59324492"
     CDS             427521..429686
                     /locus_tag="HG536_0B02360"
                     /inference="similar to AA sequence:RefSeq:NP_009660.1"
                     /note="ancestral locus Anc_3.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138048.1"
                     /db_xref="GeneID:59324492"
                     /translation="MVDFSLKNRNHDKHPRRLSPKGKNPDSLTKTEVKPGKGSSNPYS
                     EMSITADYSQLPTINAKDKNKVASSMQRRLSVHNPNYVPPKLDYSLPLPSNVVSGVQF
                     DQPREEPKRFAVNGSTQGHLGASTVDGRKQVEPPAARPPLPATINSATLRKMLADPKF
                     NAKTFVRESLGDASAIEIDKFTSNLGELAVQIQEEAKDNVNKSYNEILTVNRDLGVAS
                     IELKQLRSSVSELSDMMQEFFVMAGKRLQMEEHKERFQRSSSSAELLPPVGADSLSNK
                     KRDRSSVAILEKIWDQQLTTLFRNVEGAQKYVGTSPGRHILTESSEWIELNIATLKPL
                     QSVHIFILSDMVLVASRPKEKQTDLVVAQCSHLRDVSVSFEGSSSKRLSFTFGPSTRC
                     IYETRDQQEAAHLLNTVRKAKDDFHDILHAEEENAKKIKESFNHLQYSQQTPVRDGTK
                     SPVKSVRRSMGSATPGKSGGEEMDNFLFQKLSMTMHSRSHSRNANPLAPKLKSLSNGV
                     EEIDIELGRLKFDKAVSALNALESQLKRLADLGEDDDMMLHGLITLKLDQRREAVASK
                     LSQTISSTSETAPLLHAVKNMIKLGLPEDGLDLFLQNRSNLIKSLILQTGSLDNPTNY
                     LIQIAVIRFQIIRKTVVNFRDVFQEDKDRFSSTLVNWCREEVDKHFELIEKSLPSDEA
                     ISPASIRSSRRQIDGLRSVGIDFVYKLDEFIKKNSHKIH"
     gene            <429978..>430847
                     /locus_tag="HG536_0B02370"
                     /db_xref="GeneID:59324493"
     mRNA            <429978..>430847
                     /locus_tag="HG536_0B02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282154.1"
                     /db_xref="GeneID:59324493"
     CDS             429978..430847
                     /locus_tag="HG536_0B02370"
                     /inference="similar to AA sequence:RefSeq:NP_009659.3"
                     /note="ancestral locus Anc_3.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138049.1"
                     /db_xref="GeneID:59324493"
                     /translation="MEKLLHWSIANAQGDKEAIEKAGQPDPKLLQQLFGGGGPDDPTL
                     MKEAIAVVTNPEAEMESKLIAMDNFEMLIENLDNANNIENLNLWTPLLETLSDPDEEL
                     RASVLSVIGTAAQNNLPTQNSFLKQENGLRRLIQLADSTSECLNVRCKAFYALSNLVR
                     NHPELAEEFVRLKGLDIIAPVLTDSELKSKLKTRALSLLTAYLTAVQISDGLVSTLRK
                     DNVLPSAISSLKSEDDVAILDRVLNFLSHLISAGVKFTEQETHELRTNMRRVKSFKDR
                     LNEEDYLAIERAI"
     gene            complement(<430935..>433049)
                     /locus_tag="HG536_0B02380"
                     /db_xref="GeneID:59324494"
     mRNA            complement(<430935..>433049)
                     /locus_tag="HG536_0B02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282155.1"
                     /db_xref="GeneID:59324494"
     CDS             complement(430935..433049)
                     /locus_tag="HG536_0B02380"
                     /inference="similar to AA sequence:RefSeq:NP_009656.2"
                     /note="ancestral locus Anc_3.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138050.1"
                     /db_xref="GeneID:59324494"
                     /translation="MRNHRQYRLPRTSLSPMNHVIELLDDAADDGAGLTGSSQKSKPE
                     IFTLTSDDSIQPPKGQSQTQYPSSPKEIEVITDTSIHPSIGSIEISAPFCQDLCTTVG
                     DESSIDGDFEPRPRSGKRILEEILNEDSSICYPRVDSSTTCEVKLKDGMKRLRGLEQE
                     HSQKHSPVREDLAYTHDDVSKNRKAGVLETGADILETYPISSPAADLAGSKRLKRGQS
                     RQLFVQNSDCSFNAEEVSESDVLSQGSVSESEIQRNSIPTSGKVKGVPILPVALPNRR
                     DKHTDAFNNSVKVKGVIDQAGLSQCRRSEILELNVRKFPSDKNCKDNPCLPDELSKPA
                     RSSESDSDERTSAREASNDMSKAREVIRLTPYIVHGRCYSDDEALRLMQTWLGNSRRA
                     FKESNQIYRSNEKARSCITVTMSSRLIKTFESSGCDLENGIKPATLQASIEEELPRIG
                     FLRTCESEYDFAHDIFFPCEKTAVEEALSILYYDAQVFFELYRTDKEYLFRRFRSFTR
                     SGKYLIVVLSNLKRLARALEALEDKKYKARVQDELTGSQATRGHNSKKKTSVLEDLSM
                     KKFDIEQRLRFIDRLWGVRIHVVSSHAEFTESLPNLVSLIAKQRMDPAIRYMRYSHIN
                     ARSGKDKTDVLRQTLQQINKMPELKANSVIAAYSTFQALFTDFKKGELKSGLDGQYLM
                     TEAMEARLYKLFTCEDPNESIQ"
     gene            complement(<433247..>436285)
                     /locus_tag="HG536_0B02390"
                     /db_xref="GeneID:59324495"
     mRNA            complement(<433247..>436285)
                     /locus_tag="HG536_0B02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282156.1"
                     /db_xref="GeneID:59324495"
     CDS             complement(433247..436285)
                     /locus_tag="HG536_0B02390"
                     /inference="similar to AA sequence:RefSeq:NP_015380.1"
                     /note="ancestral locus Anc_3.340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138051.1"
                     /db_xref="GeneID:59324495"
                     /translation="MMHLKPVQGRRRGLSVNSVSDAQQQAMNNSLDNLQGDLTHVETQ
                     WNRILNEQSNPLELALSFLDDTSVGLGHRYHDFKQLKTRIGFDLQEAVNEHFQVLNTN
                     VASYGIAVDSITAAQDNIKQLKGQVSESVSNITIGKGSLKELNDNAKKQNDMIDALSS
                     IEYLVQLPEKIEDSIRSQDYKEAQTLLARGFLCAANHDLWSLGPLQVLKQQLELQEHA
                     LFNNLVEEIHNIIYTKKGPFSSNRDILKDIGLNQDGFTNLENYLYNVANVDLLRDSMT
                     MNNQLSVFMQKISEASFSLEAMTSSSGQGNEFQRVFFLLSIINDINKLPTALSILTNR
                     AREELHNIVLKCTEEVRTNRPSLLNVAASPNIDDDLGMSVKDVLAVPMKECFWKIFVR
                     FLIAAQGHRVVFESVKKILQSTAINSYKFGQIWSKILNEIETLLLKYLENPQVTSVQA
                     GSNRTSSTVIKPSRSNAPLFTLQHNIEDSSAAKRHANELKALLKDLFPGITISATAEL
                     GSIYIEEESFEQEEPLVPPTIFNVKMLLEPYLFFCQATSDLIPTEFEGKYVTSMTFLT
                     TFMSEQFFPKLDKTLAYLFELRVGSNNPYALESIEGSKYIFKAAADFRILLKKLLFIM
                     NTTHKFRSRVFNSLLGLLRKFYRYHLSLFERLFGTAASNVQKRIISVWLTDGDIMKHE
                     KEFLNSGGTDSNAEANLMLRHCADYPNKGGLNKDDILNTVTLNAVIHFLGTANWILSW
                     LPSLRKVVRTPEDMSKKDNIEMLKIEWCFFESNDWTAIDKLGNLKISMDSQAAARFDE
                     ILEGFSTLQSNLLTAIRFDTRARCIYHIGFMFHRPETWSSDAGSSELNEHIAALITDL
                     ETIENKVRQQQLLEGNTDNVFIGIDSMINKAFLLGMRSVPVINKSGVKRMLRNAKVLQ
                     NACQNLVSTPSMVDMTASMQFFSLCGATESDLFRQLDEGKLLISSKNDLKNILRLQFS
                     EDIQRQTRRSSGNPKRVNSMPLIKRYDESVKRLESFGRRP"
     gene            complement(<436418..>440665)
                     /locus_tag="HG536_0B02400"
                     /db_xref="GeneID:59324496"
     mRNA            complement(<436418..>440665)
                     /locus_tag="HG536_0B02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282157.1"
                     /db_xref="GeneID:59324496"
     CDS             complement(436418..440665)
                     /locus_tag="HG536_0B02400"
                     /inference="similar to AA sequence:RefSeq:NP_009655.2"
                     /note="ancestral locus Anc_3.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138052.1"
                     /db_xref="GeneID:59324496"
                     /translation="MGAQLSLSAQTSPSIAIFSYIDVLNEVHYVSQLNSSRFLKTCRA
                     LDPNGKIIIKVFIKPNEEYDLKEKKKQIDAEALSLAPLPTTLNYSKVVESNRAGYLIR
                     QHLMSNLYDRLSYRPYLSEIEMKFVTFQLLQAVNDIHNLNICHGDIKTENVLVMSWDW
                     IVLTDFSNKIKPTYLPEDNPGEFSFYFDTSNRRTCYLAPERFNTRLHEKTKDATGNVT
                     KEMDIFSLGCCIAEIYAEGRPLFNLSQLFKYKNNEYDVTSFLEEEIKGDALRSLICDM
                     VHQNPKKRLSCRKLLEKYRGSFFPEHFYTYTYEFFRTMATMRTSIPIAGATCARSTLE
                     DQINLADDCCIKMYHDLGKICQELDYALKSKQDTDKSRSLEDFGNDLISSLKIPDLGE
                     LELKNYASKELKDESALLFISFLSHNVRNVTSSSTKLRCLEMLVLFSQYISDENKIDR
                     VIPYLVSCFEDDFPNVQATAIQALTQVLGMVEKLSPINENVFMDYLLPRIKRLLIQSK
                     QNPYVRAVIANCLGHLVPIAYRFQELLNFFNSSKLMEAVETGNLEVSNKHNKRLAQQV
                     EELAVALLTDNETSVKTTLLSNVLPLCRFFGREKTNDVILSHLITYLNDKDASLRIKL
                     IQTICGIAILLGPITLEQYILPLLMQTTGDSEELVVVSVLQGLKNLCQIGLVQKRFFY
                     DICNSVCSLLLHPNVWIRQVCLLLIVEIAMRLSKAEVYCVLYPIVKPFFEFDVEFTHD
                     LILTSCKQPVSRTVYNLLCTWSLRASKSLFWQQIPNKHVDAFGNNNISFITKEFSKKN
                     YGFNGVKASKSVVLSFSNEEIPLTTEDKNWIDKFKAVGLSEGDLWKIAALRGYVLRTA
                     KMISRKDDILKITETSTSRRRNQSDHSLAHVMPKNVFFDIEFTDDIDKIQRSVPDAGK
                     VKVNHTNEITSNQLSSVKDMDGSLLLASKATATTTSNLENVYVQLDFLRQASSPTDDV
                     QREEDNGAKFFVRSSYEGDVSSIKTFLQGIKIIPPLRDYKEFGGLLGFAQGNRAIGNL
                     KGTLLTTLTENEPNPITSLAVSSGTVPYVISGSVRGQVKLWNFSDVAAGEVFASSLNY
                     DFASTITGITMLDRYDCFGVSTKNGNINVLRTLYQSIEGNLVFSTLHCIRKAKIKQKS
                     TDEIYAISLKSVISDNTSLLVTLTNTSQILVYDVRNMECIQKIDNPPSHGAVSSFCVD
                     EQGSVLILGTTKGVIDVWDLRIQILINSWWFGDHTPITHLEKCDAMGNNFIAVAGGYS
                     KAILTIWNYCKMACQQALINSDEQPSIENFLPKRKSFEELSFSDTDVSQKVTSLHISG
                     SKIVLSTETLSEVLVVDVKDLVCSAALSRPKSFHVVPVLVTANLTYLLLRETSDSSGQ
                     KRPSYFNDNINALASANLEGRSLLVTADNSGIINVFN"
     gene            complement(<440884..>442200)
                     /locus_tag="HG536_0B02410"
                     /db_xref="GeneID:59324497"
     mRNA            complement(<440884..>442200)
                     /locus_tag="HG536_0B02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282158.1"
                     /db_xref="GeneID:59324497"
     CDS             complement(440884..442200)
                     /locus_tag="HG536_0B02410"
                     /inference="similar to AA sequence:RefSeq:NP_015379.1"
                     /note="ancestral locus Anc_3.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138053.1"
                     /db_xref="GeneID:59324497"
                     /translation="MSMPNVLNNNDDTTNRQQKISKQDWRYYRYKPSSDRIKHLLNTQ
                     MDNPRKQKESEPRTIFEPAKFSLPSRYEVVQILGKGSYGTVCSVNDKINPDNVYPIAV
                     KKITNIFYREILLKRAIRELKFMTFFKGHKNIVSLIDCEIVSEKPYDGLYCYQELIDY
                     DLAKVIHSSVQLSNFHIKHLFYQILCGLKYIHSAEVIHRDLKPGNILCTLNGCLKICD
                     FGLARGLAPQFFTSKDNYHDITNYVATRWYRAPELILSENTYGKSIDMWSIGCILGEF
                     YGRKPLFMGKDSIHQIHEIMKVLGPPSKEVLLDYGSLKAWNSCHSASGSISAMADWTE
                     LYPSATLEALDLIEGLLKWDPKKRLTIEQALEHPFLTSVRNLDDEPVCPWGAFDFSYE
                     YQLYSMPRLREFLINEVAMFRGDRVKCNASKPHFPQNIKIVEEARR"
     gene            complement(<442390..>443079)
                     /locus_tag="HG536_0B02420"
                     /db_xref="GeneID:59324498"
     mRNA            complement(<442390..>443079)
                     /locus_tag="HG536_0B02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282159.1"
                     /db_xref="GeneID:59324498"
     CDS             complement(442390..443079)
                     /locus_tag="HG536_0B02420"
                     /inference="similar to AA sequence:RefSeq:NP_009654.3"
                     /note="ancestral locus Anc_3.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138054.1"
                     /db_xref="GeneID:59324498"
                     /translation="MSWLAPLKWAVALYLLSSYKSLPGAYFVRFYATIIPNIVFPYVT
                     GLKTKNLEKLAANRRACFGTFTVATYASPFECDFYLHKSNSTYFEELDIYRSGLMTKV
                     FQKLFLKSQRWPYIPVANVFTNFLKEIKPFEKYDVSSRILCWDEKWIYVMSRFTKNNG
                     KTLCSLSLTKYVLKDGRKTIPPKEALEFCGLYNEEVAEISAQNLKLLTEDSGFHETHQ
                     LEALDEQYLQL"
     gene            <443295..>444350
                     /locus_tag="HG536_0B02430"
                     /db_xref="GeneID:59324499"
     mRNA            <443295..>444350
                     /locus_tag="HG536_0B02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282160.1"
                     /db_xref="GeneID:59324499"
     CDS             443295..444350
                     /locus_tag="HG536_0B02430"
                     /inference="similar to AA sequence:RefSeq:NP_009653.2"
                     /note="ancestral locus Anc_3.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138055.1"
                     /db_xref="GeneID:59324499"
                     /translation="MALDNLLQPEDEACYIQAFCRHVIKEKSGNYPALKKSADGTQVY
                     PGAAGITSNRGNKLLQKAELVTRQVMNSSKPLNEESVYYNGSEHSLLKRRKKIKSSVD
                     EDDDGDEEVDLSKLVDVRKILTPISSLADVTRHDAIRRTFESGMLRDLSLQTSILIEK
                     EQNSVMRYAKLLELFLGEHPEPLREDVLKLPMYDHNLKLPDEDNADDDEKDEAEQQQD
                     TTERDNDGEDPFFALPRVGGPEALLSLLPSVNSPEVAEEAEATRQLAQIALQRNQEFI
                     RNLQTVRSALVKANRVRERILSWSREYTGYAEDDVTVPNALRAVKRGLISATTNMSMG
                     GGVRRSEEILEDDMEGG"
     gene            complement(<444412..>446601)
                     /locus_tag="HG536_0B02440"
                     /db_xref="GeneID:59324500"
     mRNA            complement(<444412..>446601)
                     /locus_tag="HG536_0B02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282161.1"
                     /db_xref="GeneID:59324500"
     CDS             complement(444412..446601)
                     /locus_tag="HG536_0B02440"
                     /inference="similar to AA sequence:RefSeq:NP_009652.2"
                     /note="ancestral locus Anc_3.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138056.1"
                     /db_xref="GeneID:59324500"
                     /translation="MRVLLTNDDGPLNDQFSGYIRPFVQVLKRLYPHWELTVCVPHVQ
                     KSWIGKAHLAGKKLSAQFLYSKMDSDDNSYLGPFIQPQTAASNSKLPRTVINTEVSHD
                     DIEWILIDGTPASCVNLGLHHLSTEKFDLVVSGPNVGRNTSAAYITSSGTVGAAMEAV
                     IAGNVKSVAVSWAYFDGVKNVSSSLMEMASKRSLQIIDHLYHNWDPRTDFYSINVPLV
                     ENLSYETKAVYTSIWDNRWGPIFSGPHIECGPTNDEIEDGSENQMISFEWAPNFKSHT
                     SSKHHTNDDVVDRDIVEDGKISVTGIRSTYLHSVHLNGELPLRAPDKDVSDVSFVITI
                     DPNDYIHGPLKNAITKWIPNAQIVTTLPAKSGGSQRLFHYGDYEDLDMERLASGAESY
                     FANSYIYRKALIRKHYLTQTINHFVAKNPKSILSRAYLESFIIDLDYAEFLDDALDEN
                     WELRQELESEQYWWIVKPSMSDKGQGIRVFKTIEDLQAIFDSFDEDDIDDEANVVDSN
                     RIIISQLRHFVIQRYLEKPLLLPSMNNRKFHIRCYISCRGALKVYVYDRMLALFAPSK
                     FETLDHDRYSPTSVDDLACHLTNTCLQSKRAQKELSVVEFDSLNDLTLDDKLRIKQQI
                     HQVAHDIFLAAVQVNSFNFQPLPNAFETFGVDFLVDENLDIKLLEINAYPDFKQTGND
                     LKDLIDGLFDHAVEKLVLPLLQREESANKTSHSDFVQVLDYSPNDWR"
     gene            <446749..>447069
                     /locus_tag="HG536_0B02450"
                     /db_xref="GeneID:59324501"
     mRNA            <446749..>447069
                     /locus_tag="HG536_0B02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282162.1"
                     /db_xref="GeneID:59324501"
     CDS             446749..447069
                     /locus_tag="HG536_0B02450"
                     /inference="similar to AA sequence:RefSeq:NP_009649.1"
                     /note="ancestral locus Anc_3.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138057.1"
                     /db_xref="GeneID:59324501"
                     /translation="MSLFVNPYNAQEVRQEKIDIAEVQFNAMNVTFNNILHTCLEKCI
                     PHDVYSESDLNKGEMCCIDRCVAKMHYSNRLIGALVQARGFAPDAHLAHYDKFKQPQL
                     DIGS"
     gene            <447863..>448144
                     /locus_tag="HG536_0B02460"
                     /db_xref="GeneID:59324502"
     mRNA            <447863..>448144
                     /locus_tag="HG536_0B02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282163.1"
                     /db_xref="GeneID:59324502"
     CDS             447863..448144
                     /locus_tag="HG536_0B02460"
                     /inference="similar to AA sequence:RefSeq:NP_015377.1"
                     /note="ancestral locus Anc_3.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138058.1"
                     /db_xref="GeneID:59324502"
                     /translation="MAAPRETKKRTTRRKKDPNAPKRALSAYMFFANENRDIVRAENP
                     DVTFGQVGRILGEKWKALTPDEKSPYEAKAEADKKRYESEKELYNATRA"
     gene            <448559..>449335
                     /locus_tag="HG536_0B02470"
                     /db_xref="GeneID:59324503"
     mRNA            <448559..>449335
                     /locus_tag="HG536_0B02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282164.1"
                     /db_xref="GeneID:59324503"
     CDS             448559..449335
                     /locus_tag="HG536_0B02470"
                     /inference="similar to AA sequence:RefSeq:NP_009645.1"
                     /note="ancestral locus Anc_3.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138059.1"
                     /db_xref="GeneID:59324503"
                     /translation="MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSR
                     VLLVSLEIGIEAFQSYRCDHPVTLGIDLTSLSKILRCGNNSDNLTLIADDTPDSVLLL
                     FEDTKKDRIAEYSLKLMDIDAEFLKIEDLAYDCSLKMPSPEFSKIVRDLSQLSDSINI
                     MITKETIKFVADGDIGSGSVILKPFVNMDKPEDSIKLEMEQPVDLTFGSKYLLDIVKG
                     SALSDNVGVRLSSEAPALFQFDLKSGYLQFFLAPKFNDEE"
     gene            complement(<449404..>449934)
                     /locus_tag="HG536_0B02480"
                     /db_xref="GeneID:59324504"
     mRNA            complement(<449404..>449934)
                     /locus_tag="HG536_0B02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282165.1"
                     /db_xref="GeneID:59324504"
     CDS             complement(449404..449934)
                     /locus_tag="HG536_0B02480"
                     /inference="similar to AA sequence:RefSeq:NP_015376.1"
                     /note="ancestral locus Anc_3.331"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138060.1"
                     /db_xref="GeneID:59324504"
                     /translation="MIVYEPLVKNLSHFQSLKKLIDADLSEPYSVYVYRYFLNRWPEL
                     TFLAFDSDSQTCDEPIGCVICKSELHRGRRMRGYIGMLAVQSDYRGRGIAKTLVKKAI
                     EKMQRDGCDEIMLETEVENVAALNLYENMGFIRMKRMFRYYLNEGDAFKLILPLTQRS
                     CIRSTFLDDVNGGDLL"
     gene            <450182..>453565
                     /locus_tag="HG536_0B02490"
                     /db_xref="GeneID:59324505"
     mRNA            <450182..>453565
                     /locus_tag="HG536_0B02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282166.1"
                     /db_xref="GeneID:59324505"
     CDS             450182..453565
                     /locus_tag="HG536_0B02490"
                     /inference="similar to AA sequence:RefSeq:NP_015374.1"
                     /note="ancestral locus Anc_3.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138061.1"
                     /db_xref="GeneID:59324505"
                     /translation="MSDNAYLINAITGEKITTDVKYFMSLDEFRDFISQKWNISQEQL
                     LILLPFGNKLKNSAFKECLRTSTLSEAEFYIYDRRLFSIMNEPIDGQPTGSLEKTRAE
                     LADRSALLVSDLVNNGTPKEETSLLKPINSPLADADMKVENLTSRVITSLLTTNLGWL
                     SALEIDVHYFRVLIAEYIEQISEILKCLSICEQYLKLYCYDVEKLYNSNVEFLNQLSQ
                     NSQSCKWRSCYNDVLTKLKGSEGPLSQYVDLQRLEENEKELKSLDKTVNAKLKKVKTE
                     LDSNADFRMKVSGAIQSIQKDYDPEGLKDRLEKTMLEKFEELVEDVRTRSREILDQDL
                     SDSPEAFVEEIRQFLLKVKNETSSRLFTIAQALFAQIERVLERRSALQAKAVLLYGQI
                     AYVQMETIGIKRNLLTECGKDLNRYQEKELQFAQVEDIPLIYGLFLIERYRRECWSFQ
                     LFSQTQATAHELKQAKEKEINYQAEWVHNFGNTASLFCSDLGNISEIGNLDALRVIDE
                     FDGQIISEKQLSAVQTALSETLKIIDGYVSQLPHLGVSKNVSEIILQTLSETKNYQSS
                     IFRTQELPEKSAFVKDQVNGYRARIKILESLLHEARFSNPGHWPSGILNPVHVTPFHN
                     NVATVGPKGSPGSSSLIEANNFSNVVKFLEMDNNYQSLQEKVNKLQAALEAKETLLID
                     AGRKTSDLELEIMAFKESMSHLNQGLARLSEKEEKTLQDARVQRNDFKTQLTNIAEEN
                     ASLLKELNNMKDELSHKEAQEKAACDRIAELQQLLEEERVHSREKIVLIENDLSAMKT
                     HTEELEKKNEELTIKLQEQDSEKLEKKEKVRIEASAEQANDEVSRTFKELQVYSTDVE
                     HLMFNVFASDVFILENIGLLLSLDDNNGTVIRRVKGLRRVQSQGLLDDSIQIPQAEIV
                     VKSTVYKEVKEIYESLGKTQDIDKHRMLVSKLKVLYANKLYESAVIRRFKDIETLAKK
                     LTKENKKKRSLLDSYQNERVTLRNFQVGDLALFLPTRENKSLNESSISSLNSSFSSVD
                     LSTPPPFDVTSTHPPHASKEKAKKVRKHRPWAAFTAFDNNTRYFLKDDEEFTRGKDWF
                     VGKILTMESFLAEDGNNPYKLTKGSQWFEVTAKIVSCPV"
     gene            complement(<453979..>455847)
                     /locus_tag="HG536_0B02500"
                     /db_xref="GeneID:59324506"
     mRNA            complement(<453979..>455847)
                     /locus_tag="HG536_0B02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282167.1"
                     /db_xref="GeneID:59324506"
     CDS             complement(453979..455847)
                     /locus_tag="HG536_0B02500"
                     /inference="similar to AA sequence:RefSeq:NP_015373.1"
                     /note="ancestral locus Anc_3.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138062.1"
                     /db_xref="GeneID:59324506"
                     /translation="MVKARISKRIAILYGSETGNAQDFAFILSHKLHRLHFAHTLSSL
                     GDYNTLDILDCRHLFIICSTTGQGELPRNALEASHGNNRSSTLWSFLRRKDLPSDLLN
                     HVSVSFLGLGDSSYPKFNYAIRKLHERIVNQLGAKEPYKRLEADEQCMLGSNKNTGAG
                     IESVYFEFEKKALDNLCATYPTRKVNGEIIKREELPADVYLRPDSSLLIERDDNIQSN
                     SVSFKGDEFVRVGSVERNQRITHAEHFQDVRQFIFKGAEAHEYGPGDTVSIFPCNTDQ
                     SVQQFLELQPHWKPVADKPLIFSDRAPSIEGGLVQPLTLRNLLKYHCDIMSIPRASFF
                     KKVWTFATDMSRLERGLEQMNQQREKLQQFGADEDMQDLFDYCNRPRRSLLEVLQDFM
                     SLRLPWEFALDFLPAIKPRYFSISSGPNCSSIELTVAIVRYKTILRKIRKGLCTDFIA
                     NLSPGDQLRYKIQNNHLFENEQLRDRPMILISPGVGIAPMMSLIRAEISNQIMLFFGN
                     RFMEKDFLYKDLLQKWEETNRITLFSCFSRDRENSPEFKYVQDRLWAIGNTIARLLVE
                     KDAIIYLCGSSGKMPTQVRITLLEILKKWGNFETDTAACDYLKLLEKNDRYLQETW"
     gene            complement(<456112..>457515)
                     /locus_tag="HG536_0B02510"
                     /db_xref="GeneID:59324507"
     mRNA            complement(<456112..>457515)
                     /locus_tag="HG536_0B02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282168.1"
                     /db_xref="GeneID:59324507"
     CDS             complement(456112..457515)
                     /locus_tag="HG536_0B02510"
                     /inference="similar to AA sequence:RefSeq:NP_015372.2"
                     /note="ancestral locus Anc_3.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138063.1"
                     /db_xref="GeneID:59324507"
                     /translation="MAMNRALTVRLCGTFRLYSQAARTVEINGQKYVADSSYTNVTPS
                     IIGLTDRALHLKESHPVGILREAIEKKLNSTDSAFTVYNQFKPVVTRFENFDSLGFPA
                     DHPGRSKSDTYYVNENYLLRTHTSAHEMECFNKIKSGKSERPGFLISADVYRRDEIDR
                     THYPVFHQMEGCRVWKREPSNAPGQEPAHITRLRAELANLEEQLLNQATKVVVEDDTC
                     LEDNPKQEYMTDIEVDLCSRHLKRSIELVMTEVFQRKIESMKKAENDTSEIPSELKVR
                     WIKAYFPWTAPSWEIEVWWQGDWLELCGCGLVREEVLQRAGFEPESTISWAFGLGLDR
                     IAMLLFEIPDIRLFWTKDNRFHDQFQKEVISTFKPYSKYPGTLRDVAFWLTKDKQLHT
                     IHENDVMEIVRNVAGDLIESVKLVDQFEHPKTGRTSLCYRINYQSMDRNITNSEINKL
                     QEQVRSQLAETYGVELR"
     gene            <457996..>459669
                     /locus_tag="HG536_0B02520"
                     /db_xref="GeneID:59324508"
     mRNA            <457996..>459669
                     /locus_tag="HG536_0B02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282169.1"
                     /db_xref="GeneID:59324508"
     CDS             457996..459669
                     /locus_tag="HG536_0B02520"
                     /inference="similar to AA sequence:RefSeq:NP_014305.1"
                     /note="ancestral locus Anc_2.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138064.1"
                     /db_xref="GeneID:59324508"
                     /translation="MYGHSINSTSVESGNEGSAAMNKRQRLFNLVRNTKNSYIQGWTS
                     NLSQRTAGSDENQAYSNLPLDMEILFYPTYTTKIKNGYETIVRLAVCAPGNPAGRRNR
                     FLLSLCKQFLKPMNSEDYDSGLASKFDSLNRDDQSSLGQTTSSSNSSVSSVSSRSRPG
                     QDEIEVLKSRISGFMLRKVPNLPIIVDLLPQQKDAQYETAFANTDNLGNLSLRMVSSF
                     LPRELRITLDTPSDFPKVITQQFPCDYIEPTGYGVISDIDDTIKHTGVTGDKRSMFRS
                     VFLNDIDSWLISEVSRWYNALKEIFEADFFYVSNSPVQTYPALKEYVTRHFPKGPLFL
                     KQYSGNLLASIMTSSSNRKIGAITQIFNDFPHKKFILIGDSGELDFETYVSVSLQYPE
                     QVTAIYIRCCKDSMSDLGLREAEVMQELNDIINEEYLMTPAVQETGNSDSRRSGPPVP
                     SRKPKLTPEQEREIFESRQISQAAPALPPRPTNAQDSDTLFYYTPSTQNDYGTYSSFF
                     DKRGDNWRNRVKSGVRKLKDLQKETAIRVMFFKDPELPLEDYVRHVKHE"
     gene            complement(<459750..>460763)
                     /locus_tag="HG536_0B02530"
                     /db_xref="GeneID:59324509"
     mRNA            complement(<459750..>460763)
                     /locus_tag="HG536_0B02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282170.1"
                     /db_xref="GeneID:59324509"
     CDS             complement(459750..460763)
                     /locus_tag="HG536_0B02530"
                     /inference="similar to AA sequence:RefSeq:NP_014734.2"
                     /note="ancestral locus Anc_2.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138065.1"
                     /db_xref="GeneID:59324509"
                     /translation="MPPKKKQQQPAKKKDNVDKTFGMKNKNRSTKVQKYIKQVQSQSD
                     PGKEDLRRQKLEEKKRREAEEAERRALFNPTVDQRVRAGVDPKTVLCAMFKIGNCNKG
                     AKCKFSHDLNVGRKVEKRDLYTDVRKEKEEDTMDQWDEAKLRTVILSKHGNPKTTTDK
                     VCKYFIEAVENGKYGWFWTCPNGGDKCMYRHSLPEGFVLKTNEQKRLEREALDNQPKI
                     TLEEFIETERERLDKSKLTPITVENFAKWKQNHLIDKQNAERKENGKKKPTGREVLLK
                     LYVENKKFDENDLNDASQGSEWDLSEFTKALDETDNIKDYGDGSNPTFEIKVQKETNT
                     ASA"
     gene            <461235..>462929
                     /locus_tag="HG536_0B02540"
                     /db_xref="GeneID:59324510"
     mRNA            <461235..>462929
                     /locus_tag="HG536_0B02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282171.1"
                     /db_xref="GeneID:59324510"
     CDS             461235..462929
                     /locus_tag="HG536_0B02540"
                     /inference="similar to AA sequence:RefSeq:NP_014733.1"
                     /note="ancestral locus Anc_2.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138066.1"
                     /db_xref="GeneID:59324510"
                     /translation="MSLIVRSAPLRRTSRTLLKCLSKKNFERLIYRTYFVGRSDGKVS
                     GSPLKRSSPLSHGRDLNFALLGGGVLVLTYSYFSSKSVVSLDTVKGLRYYSNGANGEN
                     LVQKAGAAEEESSQSGSGHGDSIVLLTEQQIDAKLRGGEKSFLVNRGKGIVRYDVSQL
                     ASNHPIEDNHVEQVISVPVSGEADRQEELYFFGIFDGHSGSFTSAKLSQELVPYVARK
                     LSQFYREGTDALASSSKMDEALIQTFEQLDNDIVYGSLGKLLREPTKDNMVGCLPAIS
                     GSCALLTAYNSLDSTVKVAVSGDSRALIAGVDGKGQWVVKSLSTDQTGDNPDEARRIR
                     SEHPGEPNVVRNGRVLGSLQPSRAFGDCRYKVGEVDGQSLANLPDHLRIYFRSKPRNF
                     LTPPYVTARPEITTTRIEPNTKFMVLGSDGLFELLTNEEIAGLVIRWLQSNGRGDSSA
                     AASEGKLPHVTDLSAHKEFLRPAFRYQSTKEGSEGYLMEDKNVATHLIRNALSAGGSK
                     EYVSTLVSIPSPMSRKYRDDLTVTVVFFGDTTDKTQPNNGTIEPNLEATALPKPRL"
     gene            <463084..>463719
                     /locus_tag="HG536_0B02550"
                     /db_xref="GeneID:59324511"
     mRNA            <463084..>463719
                     /locus_tag="HG536_0B02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282172.1"
                     /db_xref="GeneID:59324511"
     CDS             463084..463719
                     /locus_tag="HG536_0B02550"
                     /inference="similar to AA sequence:RefSeq:NP_014306.3"
                     /note="ancestral locus Anc_2.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138067.1"
                     /db_xref="GeneID:59324511"
                     /translation="MNSSVISIKLVLLGEAAVGKSSIVLRFVSDDFTENKEPTIGAAF
                     LTQRVNIGDETVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWV
                     KELHEQASKGIIIALVGNKIDVLESGEERKVAREEAERLAEEESLLYFETSAKSGENV
                     NEVFLAIGEKIPLKKAQESANQSNGVRIADDQRIDLTSSVNGPVKAAGCNC"
     gene            complement(<464138..>466180)
                     /locus_tag="HG536_0B02560"
                     /db_xref="GeneID:59324512"
     mRNA            complement(<464138..>466180)
                     /locus_tag="HG536_0B02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282173.1"
                     /db_xref="GeneID:59324512"
     CDS             complement(464138..466180)
                     /locus_tag="HG536_0B02560"
                     /inference="similar to AA sequence:RefSeq:NP_014730.2"
                     /note="ancestral locus Anc_2.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138068.1"
                     /db_xref="GeneID:59324512"
                     /translation="MTRGAATLPMFQEQCLAGHGDPTLGLTPPSPRQILKIASNLKYL
                     VDKVIPTVYDVEEVTCPHSRIINQDVIKLVREACGGNPKDKKSLQKYRSVLLFALLKV
                     SSWYMELAAQELYSAPLYELRSVAAQHLCKVVIEHEEKVDLQFLFMQMLLRRYVINEN
                     DEDSEPASVLELAADMHATVVIGSSGFQRCLKWLWRGWIIQSRDDATIFVKDESIASI
                     SLKDHFDPERIKTPMYQNILQIIFSFLFLFLYTMVVNDKDSARVQSLDSKEIIFYLFT
                     LGYVIDEAFKLYYVGTAYFSFWNAFNDTLYTIIGMSMILRFISLGPIKTEKPAEYWDM
                     ISYRILSCAAPFVWSRLLLFLESVQFVGLMLIIIKHMMAESLVFFVLLFLMMFGFLQG
                     FIGLDSSDGNSDITKDILTNLVITVLGDGSFETFQDFAPPYAAILYYGYRFIVTVILL
                     NILIALYANAYQRVVDNSGDEYMALMCQKTLRFIRAPDEEVYVPPLNIIEVFVHPILS
                     SMSAKSGKKWNRIIMSILYSPVLFVVAVKEVRIARRIQYNRMRHLQDDANESDQAWDL
                     TDGFVETRHDIFFQNSNSGVHATRKKNEESLKKQREAESADPHFSVSKEWYGKVKKSV
                     QPVQEGFQTGIGWESYKLYNEVQSRYEKSEQKIEELSNTLRELVESLKELKLEKQE"
     gene            <466785..>470681
                     /locus_tag="HG536_0B02570"
                     /db_xref="GeneID:59324513"
     mRNA            <466785..>470681
                     /locus_tag="HG536_0B02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282174.1"
                     /db_xref="GeneID:59324513"
     CDS             466785..470681
                     /locus_tag="HG536_0B02570"
                     /inference="similar to AA sequence:RefSeq:NP_014308.1"
                     /note="ancestral locus Anc_2.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138069.1"
                     /db_xref="GeneID:59324513"
                     /translation="MPPNSKKGKKKSKSKQHSKKNPSSIMQAKLYHESEEYPSSRIIK
                     RAPNGDVIVESLANEGAADEINTSAGAVASPMAFTLDSHWESLSAEEKKRILRIEKDE
                     VFDIIRNYQNSHNCNCSVCGRRHMAMDQEMERIYNTLYDIDKERDPEINPVKFHLSII
                     KELQTSKSLEQEGSALPDAAGPASRDAGEAENVRDDVVKYFLSPSAVGSLKEEVMHVK
                     QSKQQQQQQLHYMQEEMVANGEVSTSAGEHTAETNVVRSPLEDRECIDETFVESDQVP
                     DMEADDEGLQAKYLKFAKTFVSSHPKIAQEYVNRMMRYPDMRALTDDLMNNNGQGFVK
                     AIENFVAQKQKPLSKDYADGSRNLPTVLNCQADAGSINLRNLGGAKEFTTMLHNGQPL
                     TSEEYANLQRHVADRMTNSYDAQKKEFKEVSQLERELFTRFMFGEDRKRFGDMIMQSF
                     REKFDDQYSTAAIGASLAAAAVTTVSPVEMPGHDEISEEYDMDFAGNEVDKAEFHDNE
                     FEESYDEYSDYDGDEDEEDEIGADADFRSQLDEEEDDSTSINDANHHTCPHATHVEDH
                     HGCYEHKDSMQSDSHGHHNGHYHSHHGHEDEYNDENDGYENSVDEADRLEEGRKLIQI
                     AITKLLQGRIMESYHEKQAENNRLKLLQELEAEEVKKKAKEEKKLKKREKEKEKKKAQ
                     QLAKEEERRKREEEAEMMKKEAEEREKQRREAQRQKVEETKRKKDEERRRKLEEQRRR
                     EEEQERHRKLKEEQKRKREEEKRLKEEEKRRREEERRKREELKAQKAFEQNEEEKMRI
                     NSAKEIGQLNNTQDVFLEQPLKAPERNASSFTPIQYPSMSPNVPYGNSDTLPLHRSSI
                     NDDILVSSATASKPAPNSAGIHKLLEMNNKVPQGANQVMPNDVSMFSSSNFMQPNTAG
                     DGLSFNNIPCMLPPASSSQNSVSNGLGGQHFGLPSWNSFGSNSSLLKSFQTNSLDIPR
                     EQCQHSASSYGINNTQPPDEEYLAKEMNNIASMLSSAGLDDSSSVPRTDLFGPDAVWG
                     PRRDIVNNVAAGIAHGHVNDMRLGSNRSSVHLSTSDSPALRGSQQHSSIWDNDNDSLI
                     QSNGAKTTNLTTNESANSNKLSRNIWGHSIHSSASFLAEANNPSNLLLSNVKAENEMI
                     NNGPDAEDEAYMDSIYRAYLPLRPPGSKDFVLTSLIHQNGLCHNMSYASFISYLVKMH
                     HNYGCELLTDATGSITHARMAGPTSGPKNNQSRKLSKDVSNGGFFTEATGPMVSPLSD
                     RPTSAVTTENVPNFSRQFFGVTQPATHSSLAGNIWG"
     gene            <471786..>472361
                     /locus_tag="HG536_0B02580"
                     /db_xref="GeneID:59324514"
     mRNA            <471786..>472361
                     /locus_tag="HG536_0B02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282175.1"
                     /db_xref="GeneID:59324514"
     CDS             471786..472361
                     /locus_tag="HG536_0B02580"
                     /inference="similar to AA sequence:RefSeq:NP_014309.3"
                     /note="ancestral locus Anc_2.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138070.1"
                     /db_xref="GeneID:59324514"
                     /translation="MSENSVRRKLVIIGDGACGKTSLLYVFTLGKFPKEYHPTVFENY
                     VTDCRVDGIKVSLTLWDTAGQEEYERLRPFSYSKADIILIGFAVNDPESLLNARTKWA
                     EEALRYCPDVPIILVGLKKDLRNASEDNSKAEEFVRPEDAQQMAKQIGAKKYLECSAL
                     TGEGVDDVFELATRTSLLVNKEPGRQCCLIA"
     gene            complement(472494..472567)
                     /locus_tag="HG536_0Btrna1N"
                     /db_xref="GeneID:59324965"
     tRNA            complement(472494..472567)
                     /locus_tag="HG536_0Btrna1N"
                     /product="tRNA-Asn"
                     /note="codon recognized: AAC"
                     /db_xref="GeneID:59324965"
     gene            <473209..>477381
                     /locus_tag="HG536_0B02590"
                     /db_xref="GeneID:59324515"
     mRNA            <473209..>477381
                     /locus_tag="HG536_0B02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282176.1"
                     /db_xref="GeneID:59324515"
     CDS             473209..477381
                     /locus_tag="HG536_0B02590"
                     /inference="similar to AA sequence:RefSeq:NP_014311.3"
                     /note="ancestral locus Anc_2.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138071.1"
                     /db_xref="GeneID:59324515"
                     /translation="MTVEVKSASERYQKISQLEHILKRPDTYIGSVESQEQQQWVHDE
                     EADQMIEKTVQIVPGLYKIFDEILVNAADNKVRDPSMKKIEVNIQQEENFIEIKNDGK
                     GIPIEIHEKEKIYIPELIFGHLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSTEFILET
                     ADPVIGKKYAQKWENNMGTCNPPKITSYKKGPSYTKVSFRPDLKRFGMERLDDDIIGV
                     LRRRVYDINGSVRDISVYLNGKCLKIRNFKNYVELYIKSLEKRRLAKTSESSDEQMKM
                     PTILYERVNNCWEIAFAVSDISFQQISFVNSIATTSGGTHINYITDQIIKKVSELLKK
                     QKKSIKPFQIKNHLFLFVNCLIENPAFTSQTKEQLTTRVRDFGSRCEVSDDYIKKIMR
                     TDLQARILEIATENENNALKKSDGSRKNRITDYPKLEDANKAGTKDGHKCTLVLTEGD
                     SALSLAVAGLSVVGRDYYGCYPLKGKILNVREATADQILKNAEIQAIKKIMGLQHRKR
                     YENTSSLRYGHLMIMTDQDHDGSHIKGLIINFLDSSFPGLLDIPGFLVEFITPIVKVT
                     ITRPRKEVISFYNMPDYEKWRAEESHRYTWKQKYYKGLGTSSSQEVRAYFSDLDRHLK
                     KFHALESGDKELIELAFAKKKADDRKEWLRQYEPGTVLDPQLTEIPISDFINKELILF
                     SLADNIRSIPNVLDGFKPGQRKVLFGVFKRKMQTDIKVAQLAAYVAEQTAYHHGEPAL
                     AQTIVGLAQNFVGSNNINLLKPNGAFGTRATGGKDAAAARYLYTELSKITKKIFHPSD
                     DPLYQYVQEDEATVEPVWYLPIIPMVLVNGAEGIGTGWSTNIPPFNPVDIVKNLKHLM
                     NKEPLEEMHPWYKGWGGTLEKLDSQRYRMYGKIEQIGETTLQITELPARTWTSTIKEY
                     LLLGLSGNQKTKPWIKDMEEQHGDTIKFIIELTQEEMEKTRKIGFYERFKLTSSISLS
                     NMVAFSPQNKIKKYESVAEILEEFFHVRLEYYQKRKDFMANRLQWEVEKFSHQVRFIK
                     MIIEKELTVTNKPHKLIISELESLGFPRINKEGKPSYGKPDEQIKEIADDELTEEADD
                     EAVAAGSDINNGPEEVYGSYEYLLGMRIWSLTKERYEKLLKQKQEKQVELEILLKLSA
                     QQLWENDLDEFAAAYDEFLALDEEMRRGDVAPASGKTKGKRKRNAAKDDDDYNPGKKP
                     KKAKKPISKVKEDTAFQKIVLEPKVIQKPKQVKVKAEGKSQSPTPSFDKTNQIEANGK
                     QPTIFDAIVKSETKSKDSQISAFSSKFKELSDSFDAVTDTTPSEGAPRKQKATQSKSK
                     SPKSAATSHESDSAHSDSDEPIPIKRSPRAARSRRAPKVAAPDLIELSDDSFVEANDD
                     EGSDESFHDEDE"
     gene            <477675..>481205
                     /locus_tag="HG536_0B02600"
                     /db_xref="GeneID:59324516"
     mRNA            <477675..>481205
                     /locus_tag="HG536_0B02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282177.1"
                     /db_xref="GeneID:59324516"
     CDS             477675..481205
                     /locus_tag="HG536_0B02600"
                     /inference="similar to AA sequence:RefSeq:NP_014312.1"
                     /note="ancestral locus Anc_2.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138072.1"
                     /db_xref="GeneID:59324516"
                     /translation="MSGQLTGGEVIEEPKKDQTATQDGIDKLAPINLKADEEHRASKD
                     ISPEKAAHVDSGESSRKPVNPSYIGWKQIGGWQEDDALTEADEMLDLSKDTYLNNVIP
                     DQFYGDWYHQLGLIVITGILSFGIGHFKFSFAPVFFIGLVSALLYRTSAIKYRSRIRD
                     QLQRELTVQKIEDDYESLEWLNTFLDKYWPRLEPAVSQMIVQQVNEMLATNPSIPPFI
                     KALWIDQFTLGVKPPRIDTVKTFQNTESDIVVMDWGVSFTPHVLCDMNAKQLRNYVNQ
                     KVVVKAKLFGLTIPLHVSNFSLRANVRIRFKLMTPFPHVETINIQLLDVPNIDFIARP
                     LGDFIFNWEVMSLPGLFPTIRKLAQVYAGPMLLPPFSLQLNIPQLLSGAAVAAGVLEI
                     TVKNVKGLSRSTGLLAKSIDPYLAFEVGGKVVAKTRTVRDSLNPVWDESLYILVNAFT
                     DPFTITILDKRERMKDKVLGRIEHNLTSLHEKSHQKNLKANFLRNSKPIGTLTFDLQF
                     FPTIEPKKLPDGTVEEQPEFNTGITKITIEELVGPGFAKEKLTGFVELYLNAKLVLTT
                     SKASGKDSLIWNQGYEAVISDRRKARCRLVVKDSKGEVVTKTVQSLNDLIDRTQIDKK
                     AIPLRDKQAELKVAAIWKPVDLDVGTNAIGYTPPVGVVRILLNKAEDLKNLEKVGKID
                     PYARVLVNGIPRARTEAKSQTLNPIWNRAVYVAISSTNQKLSIEVMDVETVKKDRSVG
                     SFDIKLDNMFQKGPDDRYVEKVDNEPRTGRLVFKKGTKGTVTYYVSFYPALPVLSLEE
                     VQEFDQLKERKAILAKRKTEELSKEEKEQLKQEQMDIEDIETMCSNKMKLDFNELLQY
                     NAGIFSLSVFSGELPQVGLYVQAFFDGSGEPRFVSPKIPTRSITTGWTGDVMIKELEY
                     SVATFRVTKNKNANKAEDCICEVVIPTIELIKNCYFKPSILTLSGANSAKLMIQASWF
                     PIAVSELPQADLITNSGDLTVTAKSAEHLISADLNGYSDPFLKFYLNDDKDPIFKTHH
                     QRKTLDPVWNQSATIVIHNRVNDYLRIKVMDWDAANADDLIGRAVVPLSKIDPESTTE
                     LDVPVVAEDGSDGGVLHLSFQFSPRYTLNVKKTEKKVGDIAQKGLGTGLKVGTTVVGA
                     GFGTIGKLGRTMFGGKKNHYVAQGVYNAAV"
     gene            <481379..>481693
                     /locus_tag="HG536_0B02610"
                     /db_xref="GeneID:59324517"
     mRNA            <481379..>481693
                     /locus_tag="HG536_0B02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282178.1"
                     /db_xref="GeneID:59324517"
     CDS             481379..481693
                     /locus_tag="HG536_0B02610"
                     /inference="similar to AA sequence:RefSeq:NP_014313.1"
                     /note="ancestral locus Anc_2.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138073.1"
                     /db_xref="GeneID:59324517"
                     /translation="MQSNPEDTEGSGIHAVELCVYSILSTDLDGIYQSINQLRESQAL
                     LVLLLRRCRNSLKCESELLYDKEDIAKSALKVRELEKRLNKVTKRLNEIKLRGERLVN
                     RY"
     gene            complement(<481789..>482826)
                     /locus_tag="HG536_0B02620"
                     /db_xref="GeneID:59324518"
     mRNA            complement(<481789..>482826)
                     /locus_tag="HG536_0B02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282179.1"
                     /db_xref="GeneID:59324518"
     CDS             complement(481789..482826)
                     /locus_tag="HG536_0B02620"
                     /inference="similar to AA sequence:RefSeq:NP_014728.1"
                     /note="ancestral locus Anc_2.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138074.1"
                     /db_xref="GeneID:59324518"
                     /translation="MKIQLLLAFATLFQWFCMALRYDKLLEESRKNFGNVIELTDTNY
                     KRILGTPRDSYILVFLTASAPQVGCSICLEAADEFKMIANSWFKDHPDAVSKKGREAK
                     SLFFAKSDLKDPQHIPQIFQFYSLQHVPRLFLFAPGGDMQSYQIIDLAGNAGKDRALQ
                     LISSLKAETKIEDFVLHLPVDWSLSIAVAFVTFTVVYLFKRHSELMSRLFSLRPLWAV
                     SWTFFVILMLGGYMYNNIRNAQLAGVGSKGEIMYFLPGQSQHQFKIETQVVGVIYASL
                     TASLLALIVGIPKLRDHYQGSSSMTLLEVASNILLAAIVYAFFAGLTSVFSIKQPGYP
                     FQLMKLSSLFK"
     gene            <483304..>485763
                     /locus_tag="HG536_0B02630"
                     /db_xref="GeneID:59324519"
     mRNA            <483304..>485763
                     /locus_tag="HG536_0B02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282180.1"
                     /db_xref="GeneID:59324519"
     CDS             483304..485763
                     /locus_tag="HG536_0B02630"
                     /inference="similar to AA sequence:RefSeq:NP_014314.3"
                     /note="ancestral locus Anc_2.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138075.1"
                     /db_xref="GeneID:59324519"
                     /translation="MAIKSLESYLFERGLVGSYPIEALKNAALGVDVNHYVSRLLTSK
                     REQYLDAIGGFPTSLKMYLESDLKIFKEYNITPVFVFNGSMVSNQLENSDYLNGYAAE
                     AAAVAMSSPGSKASTSSSTAMYSANSAVSANKEAIFIQRHRGWTQWNNLRSSNQTSYI
                     DQPIQPQEPFRYNTMIESKRFYSDLIAYFIDNDIIYQVAPYTSWSQLSYLMNSGYIDA
                     IYGPTDCLMLSDVDKFILGMEFPNKEFRFIDKTRILREFNCSHEEFVDIAMAVGNDLQ
                     PVTLPPLQIYPASQVFEIALEMVVTTGTNFYAYQFSNPIKTESVEFVDKYQKGVSALR
                     YMPVLKDSGKVELYVEAENIRDYLETDQGDGESHATSDKGMASKPSKAASLTRKPVPS
                     DVHAFIAQQLPSEYYFYKSLGLVSGKLFDAITTGVYPEEPPLVGGSTNSYRNLVKKSV
                     DLFKNKEINLLTQPINRYYQIKPIKQVNWFAPEDATVLVNRVMPSIFDKLNRLIVKTD
                     DIERQFSMKSFITLINNSDDLGNDFISDNVIFPNSVPAEKKLLAPFDLLSTSFLRFLY
                     QLDFFDLDLEKKILKPTEWGSVFLKLNEMSVDPKFHESILILLVFLKLDVLSLSQDTV
                     PSAQSALSQATLRSYPQESLYVLLLTRLLTLYQIEQKPSNYHGPVDKKTLIFRDHLHY
                     VKANMNEMYEAVIVSSLTSGEFDRVSLEGEAWQKKIVRNMPFKLTTPNTVMAMMWQFF
                     LQKYLHNGNAKADALTLIATEFSTYKSTPNLEQQFSSSHEFLQHCSRVLTALASHNLI
                     KNDDALLFEKAVKFSGEAFAS"
     gene            <486238..>487821
                     /locus_tag="HG536_0B02640"
                     /db_xref="GeneID:59324520"
     mRNA            <486238..>487821
                     /locus_tag="HG536_0B02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282181.1"
                     /db_xref="GeneID:59324520"
     CDS             486238..487821
                     /locus_tag="HG536_0B02640"
                     /inference="similar to AA sequence:RefSeq:NP_012124.1"
                     /note="ancestral locus Anc_2.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138076.1"
                     /db_xref="GeneID:59324520"
                     /translation="MSVQIFGDQVTEERAENARMAAFVGAIAVGDLVKSTLGPKGMDK
                     LLQSASSDSSMVTNDGATILKSIPLDNPAAKVLVNISKVQDDEVGDGTTSVTVLSAEL
                     LREAEKLIDQYKIHPQTIIEGFRIASQAALTGLERAAVDNSEDIVKFHDDLVHIAKTT
                     LSSKILSQDKDYFAKLATDAILRLKGSTELEHIQIIKILGGKLSESFLDEGFILAKKF
                     GNNQPTRVENAKILIANTSLDTDKVKVFGTKFKVDSTSKLAQLEKAEREKMKNKIAKI
                     SKFNINTFINRQLIYDYPEQLFTDLGINSIEHADFEGVERLALVTGGEVVSTFDEPDK
                     CKLGECDLIEEIMIGEESFLKFSGCKAGEACTIVLRGATDQVLDEAERSLHDALSVLS
                     QTTKETRTVLGGGCAEMIMSKAVDTAAQNVDGKKALAVEAFARALRQLPAILADNAGF
                     DSSELVAKLRSSIYNGMSTSGLDLTNGVIADMRDLGTVESYKLKKAVVSSASEAAEVL
                     LRVDNIIRAKPRTANRQHM"
     gene            complement(<487900..>489009)
                     /locus_tag="HG536_0B02650"
                     /db_xref="GeneID:59324521"
     mRNA            complement(<487900..>489009)
                     /locus_tag="HG536_0B02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282182.1"
                     /db_xref="GeneID:59324521"
     CDS             complement(487900..489009)
                     /locus_tag="HG536_0B02650"
                     /inference="similar to AA sequence:RefSeq:NP_014315.1"
                     /note="ancestral locus Anc_2.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138077.1"
                     /db_xref="GeneID:59324521"
                     /translation="MPKLEQFEIKKYWQIFSGLKPADNKVNHDQVLPILYNSKLDSSV
                     LNQIWFLADIDDDDNLDFEEFVICMRLIFDMVNKNIDKVPDELPDWLVPGSKASLIKE
                     RKQRKQQENADLPKQETPEVDWYMSPEDVTQYEKMLGTCERSRDGTVTFPSLSWMVKS
                     KFFNIGPSDMDKVWNLVNPRNLSSIDKDPAFYFIHCLRQCNDVGARIPSELPKALADI
                     CNKERVSYDLKSAQADVKKIVKNDETKADTTPRNDTSALDAPVDTITDVDALEKELAL
                     LDAELSRAKANNESTAAQNTARQLREQFEGLLKYRQHQTLEHSKKGHISIPINSRAVA
                     EDLDNIEEQVNALESYLRNKQSELQSLEREIASFR"
     gene            <489870..>492323
                     /locus_tag="HG536_0B02660"
                     /db_xref="GeneID:59324522"
     mRNA            <489870..>492323
                     /locus_tag="HG536_0B02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282183.1"
                     /db_xref="GeneID:59324522"
     CDS             489870..492323
                     /locus_tag="HG536_0B02660"
                     /inference="similar to AA sequence:RefSeq:NP_012126.1"
                     /note="ancestral locus Anc_2.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138078.1"
                     /db_xref="GeneID:59324522"
                     /translation="MTAMLRTVSMLTFLPWILLLGPWTVVLGKPYEAYPLDEQYPPVA
                     RIDEAFSFRISNDTFKSSVSQGSQISYSATNLPQWLSFDSSARTFSGTPDSSTLKDGA
                     ETLYFDITLEGTDPADSESFSKSYQLVLTAQSSIKIADNFNLLALLKNYGSTNGKDGL
                     ILTPNEIFNVTFDRSTFTSDQPIIAYYGQSLENNAPLPNWLTFDPNNLEFSGTAPVVN
                     SNIAPQISYGFVLTATDIKGFSGVSIPFHLVIGAHELTTSIQNSMIINVTSSGDFSYK
                     LPLNYVYLDEQAVQTKDLGAIQLVGAPSWVKLSNDTLSGTMPMGELSSNSTNFSVAVH
                     DIYDDVIYLNFMIESTDKLFAISALSNLNATRGEWFQYNFLPSQFTDYSQTTVSVNYT
                     NSTQSHDWINFESSNMTLHGQVPDDFDRLAMKLIASRGSQTQGLDFQIIGMDDRFNHT
                     NHTSSLTSSSSSSSSTSLPSSSTSFASSTMTATTLSSASASSEPPLKKNSNKTTAIAC
                     GVAIPLGLIALIAIVLLVFWRRRNNRKESSDNEKGPNISGPDVNNPANRPNQQAITPL
                     NPFRDDQTSATSGAKRLAALNAMKLDESSSSDSDVSTVDEKGNSVASEDLRHDTRSTD
                     NLLKPDAEFFDPQNRSSSVYIDSEPANRKSWRYKLSSPLRINEGGRDSCISTSTVSTV
                     DLLNTVIKDGENINKDPRKSTLGMRDSVFCNDHSKSQSSNSVASRSAMKFTPENDVLP
                     ILDEHSNTSPNSKSATSPSTSSSDDFVPVKDGQNYNWIHRAKPDRRPSNKRLVQTENQ
                     SKVDIGQAEEIEGHFPEKI"
     gene            complement(<492542..>494140)
                     /locus_tag="HG536_0B02670"
                     /db_xref="GeneID:59324523"
     mRNA            complement(<492542..>494140)
                     /locus_tag="HG536_0B02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282184.1"
                     /db_xref="GeneID:59324523"
     CDS             complement(492542..494140)
                     /locus_tag="HG536_0B02670"
                     /note="ancestral locus Anc_2.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138079.1"
                     /db_xref="GeneID:59324523"
                     /translation="MLKANSAIISRTNGRVASKLTAIASSRYYRCTPFFQNKQTHPND
                     PTSVEDLASRPDANATTRTDYYEYERLVKGSGKDFKATWLNALAERKAQLAQGKIIDS
                     YVYSHIKSTDVIDKTRKDSFAYIVLPFRDDPTVADFYVNAAGRLRMGQLFQDLDSLAG
                     KIAYKHTAPVEPMIVTASVDRIYLLKPVDSIADVNIILSGAVIYTGRSSMEISITARA
                     LKSDIPKEIDENSLSDEDIFMTASFTFVARNPETHKSLAINRLLPLNEQEWMDFKRAE
                     SRMAAKKMRAINMNLEKYPPTKDESVLIHQLWTASKKLASLKEKPSNIIFMKDTNVKS
                     TMFMQPQYRNRHSYMIFGGYLMRQTFELAYCCAASFSHSLPRFVSLDSLTFNTPVPVG
                     SVLHMDATVVYTEHLHESSKPEAQSAVDGSVDDKNNFHFQPTPVNELSLRENDFLSKP
                     GTLIQIKVDTKVQELASEKIQKSGSFIYSFFTPRDADEDHVAKPGYCTVIPESYSEMI
                     EYVEGRRRAKDTAMYAKSLKANSQ"
     gene            <495112..>496707
                     /locus_tag="HG536_0B02680"
                     /db_xref="GeneID:59324524"
     mRNA            <495112..>496707
                     /locus_tag="HG536_0B02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282185.1"
                     /db_xref="GeneID:59324524"
     CDS             495112..496707
                     /locus_tag="HG536_0B02680"
                     /inference="similar to AA sequence:RefSeq:NP_014316.3"
                     /note="ancestral locus Anc_2.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138080.1"
                     /db_xref="GeneID:59324524"
                     /translation="MDDPRRDPTQNSDKRYDRYEQLFRKLDVNGTGKLDIQSLQKALE
                     KDGHPLRDSNEAIMVLFNAMDCDKDSIVDLEDFSKYASIAESQIEKGFKRLDSDHDGK
                     VKLSEVSEYLSKLDKDCSKPRRLAQLENNLDVEKKASRFNTFLKWAFLKKPKGEDKTR
                     YITYDQWRDFLLLMPRKEGSRLHTAYAYYCYFNADVDLSSEGDMTLINDFINGFGYFI
                     AGGLSGVTSRTCTAPLDRLKVFLIARTDLSSTLLNSKESLLAKNPNANLAKIRSPIVK
                     AITTLYRQGGLRAFYVGNGLNVIKVFPESSMKFGSFELTKKLMTKLEGCRETSELSKF
                     STYIAGGMAGVVAQFSVYPIDTLKFRIQCAPLDNQVKGNKLLLQTAKDMYHAGGLKLF
                     YRGVTVGVVGIFPYAALDLGTFSALKKWYIARKAKQLSIPESEVSLSNLVVLPMGAFS
                     GTVGATAVYPINLLRTRLQAQGTFAHPATYTGFRDVLMKTIQREGYPGLFKGLVPNLA
                     KVCPAVSISYLCYENLKSLMKLG"
     gene            complement(<496847..>497572)
                     /locus_tag="HG536_0B02690"
                     /db_xref="GeneID:59324525"
     mRNA            complement(<496847..>497572)
                     /locus_tag="HG536_0B02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282186.1"
                     /db_xref="GeneID:59324525"
     CDS             complement(496847..497572)
                     /locus_tag="HG536_0B02690"
                     /inference="similar to AA sequence:RefSeq:NP_012127.1"
                     /note="ancestral locus Anc_2.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138081.1"
                     /db_xref="GeneID:59324525"
                     /translation="MNIWIEKWMKIYLKCFLSSILYHRNVYPAASFDITTYQAFNLPQ
                     FTPMNRHPEVQDYIEELVLDVLSKLVHIYGLSLCVMTKEDNMCIERYVLSFDEFRHVD
                     DVGTLTESEVFDEFRSSFNSLTAHLEKLDPIRDDTVVFEVVINTMEMELGHLPQGRER
                     LKDKEDKLEFERETNWTKCDEDEGLPENIGVFKPKIKMSSLVGCDVGPLIIRNHCEKL
                     LVSDNSLDNVYLTSQGSNVLGSL"
     gene            <497738..>500404
                     /locus_tag="HG536_0B02700"
                     /db_xref="GeneID:59324526"
     mRNA            <497738..>500404
                     /locus_tag="HG536_0B02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282187.1"
                     /db_xref="GeneID:59324526"
     CDS             497738..500404
                     /locus_tag="HG536_0B02700"
                     /inference="similar to AA sequence:RefSeq:NP_014317.4"
                     /note="ancestral locus Anc_2.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138082.1"
                     /db_xref="GeneID:59324526"
                     /translation="MTRISAIAGDDIHKITSSQVIVDLITCVKELVDNSIDAGAHNIE
                     VVFKNYGMESIECSDDGEGISSENFESLALKHFTSKIRSFQDVSSVTTLGFRGEALSS
                     ICSVARMSVVTTTKPPRADKLEYDTNGVLISKTTVSRNKGTTVLISDLFYNLPVRRKE
                     LEKSHKRQFSKCLSLLQAYALIQDDVQFSVWNVTSNRRKRLILSTARCQDMPKKILSI
                     FGSSSMRGLAPIELELDLNPYKKMMNRYKIDMPAYRDLDYIIKVRGYISKSSFGCGRS
                     AKDRQCISVNKRPVEYPALLQCCNEVYHNFNNVQFPTVFLDLSLSPQLLDVNVTPDKR
                     TIMLHNERYIIEVFRENLINYYDSQELVLPKSGLSQFDDPKVKKRKLASQVLESHYCE
                     DDSSDDESFQSSLSVPAKEEPGNSSTPMARKHVTPSERSSVSTPSESNASPSPAASTQ
                     TLPSKFVNIKELQKSDSCLYDASSEEFAPESSEDAAKIPKSQSLKDTLERYKKSSQGD
                     SPSNDKDAKSSHKTESIVVEVEGKKLDYQAKYSKSEGLAFICDAASSPTKPCCDDHAK
                     SEMKGDDSEEDPEDDSFYASMEPREVNMRSDVPWRVTHNVPRSTYRSLTGRNDSRRFE
                     GDGLVVKQNIDSSFRMVHVMASRMSGRRQSGKHVNSFKRNEDLENFDEGERYLTLTVK
                     KSDFEEMEVVGQFNLGFIIVTRHARGKYDLFIIDQHASDEKYNFEMLQKSTTFKSQKL
                     IAPLPVELSVIDELLVMEHLDIFEKNGFKLIINEQETQGCKIEITNLPVSKRTLFNVD
                     DFYELVYLIKENSGLHRNNIRCSKIRSMFAMRACRSSIMIGKPLAKATMTKVVRHLSE
                     LDKPWNCPHGRPTMRHLMEINDWDSFSSDYEI"
     gene            complement(<500475..>500903)
                     /locus_tag="HG536_0B02710"
                     /db_xref="GeneID:59324527"
     mRNA            complement(<500475..>500903)
                     /locus_tag="HG536_0B02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282188.1"
                     /db_xref="GeneID:59324527"
     CDS             complement(500475..500903)
                     /locus_tag="HG536_0B02710"
                     /inference="similar to AA sequence:RefSeq:NP_014318.3"
                     /note="ancestral locus Anc_2.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138083.1"
                     /db_xref="GeneID:59324527"
                     /translation="MVVHILGKGFKGKEVIKIALASKFYGIGEKTAERVCSKLGFYPW
                     MRMHQLTEAQIMSITSELSTMTIEGDARAVVKENIALKRRIGCYEGMRHAMNLPVRGQ
                     RTRNNAKTARKLNKVDRRGYHTMSAAASPLEIWKRAFHLE"
     gene            complement(<501170..>502315)
                     /locus_tag="HG536_0B02720"
                     /db_xref="GeneID:59324528"
     mRNA            complement(<501170..>502315)
                     /locus_tag="HG536_0B02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282189.1"
                     /db_xref="GeneID:59324528"
     CDS             complement(501170..502315)
                     /locus_tag="HG536_0B02720"
                     /inference="similar to AA sequence:RefSeq:NP_014319.1"
                     /note="ancestral locus Anc_2.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138084.1"
                     /db_xref="GeneID:59324528"
                     /translation="MEFRSRRTAAVGDAPAATNTVHHHHHHHYLLCESGSTGSRRRLL
                     ASSNSSNSIETPVTELRSGGGNQHAKRQPSPPLSQAHASIKTLSLSKLTAKQHLLMAI
                     CRDVSLLPPLVYIFTSLQQAWKISFRAKLKLYEPQSLKDTVKNLLESCITNTTVSQPQ
                     DQTSTGSSLLLSTLTTARASEYLLCALWCVVSLYLTYSILDSLMVRWIVKYSTLAAIL
                     RMFSMSLIIITTELLLLASLSPDGDYYLHTWILLSCIMTTAYIWQSYLTSNLNYVSQG
                     DYDTEDEEDCDLKSCEDVPSSNNSSASLASSCSLPRRKNKRKLRKSFRFTKKRTIDLY
                     NIIVFCVVPVGLASFITMIGLLRNLVIQRLDVEQLGRMLQSTSYILD"
     gene            complement(<502636..>503121)
                     /locus_tag="HG536_0B02730"
                     /db_xref="GeneID:59324529"
     mRNA            complement(<502636..>503121)
                     /locus_tag="HG536_0B02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282190.1"
                     /db_xref="GeneID:59324529"
     CDS             complement(502636..503121)
                     /locus_tag="HG536_0B02730"
                     /inference="similar to AA sequence:RefSeq:NP_012128.3"
                     /note="ancestral locus Anc_2.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138085.1"
                     /db_xref="GeneID:59324529"
                     /translation="MEKIREKLSNLKLEAESWQEKYEELKEQYKQLEQDNVEKENQIK
                     SLTTKNQQLEEEVEKLETSLADSKQLADDSHHLRSNNENFSKKNQQLEEELEESDAKL
                     KETTEKLRETDLKAEQLERKVVALEEERDEWERKHEELSAKYDEAKKELDEIAASLEN
                     L"
     gene            <503765..>504763
                     /locus_tag="HG536_0B02740"
                     /db_xref="GeneID:59324530"
     mRNA            <503765..>504763
                     /locus_tag="HG536_0B02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282191.1"
                     /db_xref="GeneID:59324530"
     CDS             503765..504763
                     /locus_tag="HG536_0B02740"
                     /inference="similar to AA sequence:RefSeq:NP_014321.3"
                     /note="ancestral locus Anc_2.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138086.1"
                     /db_xref="GeneID:59324530"
                     /translation="MTMGDMIRVWDLSSDLPHRPTMSSSSPPHSSSQSRSLPACSLPQ
                     ELNEILTPVINRLTSPPTTPKIHETVPVASGAEFTFTAAQKMRKSQESLLGEFIHWDQ
                     YRQSSECIPQAEPATGMAIHSSVRRTDFTSRGELKKQARKGRIVFHRGFFGRRSGGRR
                     YSTRSRRLRSKAELEATLAYTDLRSFRPDDVLSSKNVIIYRHRSIIRRCPGVKIATEV
                     PIKKYVNDLTTKKSTGGPKIRKLAKSTIKRSNTCPAAVRNIRRRSYSPEVRAIHNLWA
                     EYLFLVIAQRIELRFSLSRRNYEISDKRLSSVRSFSSTTSSLLSLDKRFASLRMNC"
     gene            complement(<504836..>506935)
                     /locus_tag="HG536_0B02750"
                     /db_xref="GeneID:59324531"
     mRNA            complement(<504836..>506935)
                     /locus_tag="HG536_0B02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282192.1"
                     /db_xref="GeneID:59324531"
     CDS             complement(504836..506935)
                     /locus_tag="HG536_0B02750"
                     /inference="similar to AA sequence:RefSeq:NP_012129.1"
                     /note="ancestral locus Anc_2.217"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138087.1"
                     /db_xref="GeneID:59324531"
                     /translation="MARGELLHLGSPIIPTHYEIQLDIDPVKINFKGNETITFKKNGN
                     KDIALVERFRLHCKDLVILHAAFDEGKRVSVEYDKAGEMATFIPDEPINITESEPLHF
                     KLQYIGKVRSVRTRQDETRGIFKTNFMNQGTGSSDNFIIATHCQPSFARSVFPCVDEP
                     SVKTTFRLGVRTLGRFKVISNMGQSSSVEDENGPHKTVSFKMTPLMTTSVFGFAIGDF
                     EHSASVAILPRSSRKLPIGIYSPMNVNDGSYCLDIVQKYLPLLEDYTSADYPLDKLDF
                     VLLPFLTDMAMENFGMISVQMDHLLLPESLLADRNTRMQVEQLVVHELVHQWMGNYIS
                     FESWEFLWFNEAFATWCACSLLEANGDLMGYWISDDYLSNQVEKAMRVDAEVGTPSIA
                     KISKEASVNKPSQTHDLFDPHSYMKGITILRSLELCIGDKLFKSALGTLFQDRRFHEK
                     CVKPIDIFVSMGAILKSENVARFFTSLTQTPGLPVVSVQMTRKDEEVMTYLVQHRLLT
                     SEDPDLEDVPYHIPLFIQLPDGQLDKKHVLMTDRTVTLDYPIVVCNHLSQGYYRVSYE
                     SADCYEEVARQIAAGKLAPIDLLKIFRDLSFFIDNSAKEIHFVGLFLLLKHLASNRVD
                     LVKNPQYWPALGEGLQILQNGKLKGLKYAAADSEILDYRADVLKPLANKINRTRSKAC
                     EPHQSQVLSILQQLKKA"
     gene            <507305..>508690
                     /locus_tag="HG536_0B02760"
                     /db_xref="GeneID:59324532"
     mRNA            <507305..>508690
                     /locus_tag="HG536_0B02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282193.1"
                     /db_xref="GeneID:59324532"
     CDS             507305..508690
                     /locus_tag="HG536_0B02760"
                     /inference="similar to AA sequence:RefSeq:NP_014322.1"
                     /note="ancestral locus Anc_2.218"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138088.1"
                     /db_xref="GeneID:59324532"
                     /translation="MVKDSRLYDILEVSPDASNGEIRKAYRLLALRHHPDKNNHSEES
                     KSKFLEVCEAYEILSDAKKRALYDEHGTADEAAIYEMKQQQNPMSSSFFGSASPMGMS
                     AGDLFAQFFDSSAHSFGNKRSAPSMGRGPDIRHDLKCSLSELYDGKTTKLGLNRRRLC
                     QKCQGHGGLRHRTCKSCRGQGQRSQTRKMGPMVQTWTQTCADCGGTGSYMKNSDICNE
                     CGGDGCIKERKIFDVEVKPGMCHGQKIILPGEADEVIKTSFGNETVIPGDVIITISQV
                     RDPKFQRVNRGGCDLVLRSFKIPLVTSLCGGDIYIEGHPSGKLLKVAILPGELIKPNH
                     FKSIENMGMPKYDEKSNPTGHGNLYIQFQVVFPETLAPETVEKLKETLLADHSVTQQI
                     ATEENEICSRMDDCVETEEHVLSSFVPDFDEIMENEARTKNKNSGYKKRKHYEDPDTP
                     IGDESSNCTIH"
     gene            <508959..>510488
                     /locus_tag="HG536_0B02770"
                     /db_xref="GeneID:59324533"
     mRNA            <508959..>510488
                     /locus_tag="HG536_0B02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282194.1"
                     /db_xref="GeneID:59324533"
     CDS             508959..510488
                     /locus_tag="HG536_0B02770"
                     /inference="similar to AA sequence:RefSeq:NP_012130.1"
                     /note="ancestral locus Anc_2.219"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138089.1"
                     /db_xref="GeneID:59324533"
                     /translation="MSSRLIIGGAAAAAAAYVIYEYQQQNERQKQALHPAGSVRPTTT
                     LQEQPQVVRDLQQTRDDSAKWLKDRKELGQVKATEMTNDLQRNLADELSRQRRNANEI
                     VEDTSQELSKGWNRIKEGVSEDSQSFKEALLGVAQKPQSRDSAVGAAKQKGHEIAEGA
                     KDKTKSIFNYGFNEAERAKAIAIGEYDKANKEYNTLLERFNESKKGLFDAGDSVLKEQ
                     LDDYKKIVQEKKRELQRASDEYARYAKDNFNEISDKLDEQDEKIRKEGGFFRWLKGGS
                     APGDEKSIDIDRVANSKSLAGFGENAQFFSEEEIEDQLRNKQIGPSEAQQRLNELKKF
                     KQEGWFKPHKSPETEEQVDQRVAQGLAGWGESAARFAQDELDETKRALHNTTTRSREE
                     ASKAVDDAWNKLQEAKKTVQSTGSKWWNASKDKTNEAADEAQKAYNEAVKNYESAKKT
                     LDQWSDETSAKFWSSADDAVRVSQNVASKAQSAANKARAKTQKKVGDSDEIEQQQLLE
                     E"
     gene            <510935..>512554
                     /locus_tag="HG536_0B02780"
                     /db_xref="GeneID:59324534"
     mRNA            <510935..>512554
                     /locus_tag="HG536_0B02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282195.1"
                     /db_xref="GeneID:59324534"
     CDS             510935..512554
                     /locus_tag="HG536_0B02780"
                     /inference="similar to AA sequence:RefSeq:NP_014323.1"
                     /note="ancestral locus Anc_2.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138090.1"
                     /db_xref="GeneID:59324534"
                     /translation="MSKGHREEDNLMNKRGREEDCEKFLKVTPNLFTPGRLHLFDSLD
                     LYTSLIKCSKSIEQGERLHNLSWRIVNKALLKDNDINKSKKRDGLKNLYYVLNPIANR
                     RPLGQPQSQAASESSTPGLRSPSGAAKPAVPRMEPLAKRETTGASSKLSHSGKDSLFA
                     NVKQHKSTSALSHIQRTASHSSRKEEPQVIVRGFDPSTVITSRKAKEEATGKRPGERA
                     RNTFYIEATPPPEPDRNSTSTLASRKALPSRQESLFGKPKTSENAAPSSRRNSLFFSS
                     EEEEEEDSDWDEDSPFYDEEEEAYDHDDDEEDQYYRRQWDKLLFAKNTSSKPSSNATP
                     NSASSNDPIKRSLLSGLFLNEQVNGNNRSAAASPAAPTITTANGAASTPYRVVSTGTH
                     AGNRAVFGTSNVNAVGSVTPPDKRLPEALYEEAKRSSRGSFSSIVSEQTRERYTGESN
                     APPAAQTILPTALSTHMFLPNNVHQQRLAMAAAAGTHSRPSSAYGPTRKTTRRESIDI
                     PSKNKNNSFIKTRMEISKEEDLVRAYSRRNL"
     gene            <512738..>513601
                     /locus_tag="HG536_0B02790"
                     /db_xref="GeneID:59324535"
     mRNA            <512738..>513601
                     /locus_tag="HG536_0B02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282196.1"
                     /db_xref="GeneID:59324535"
     CDS             512738..513601
                     /locus_tag="HG536_0B02790"
                     /inference="similar to AA sequence:RefSeq:NP_014324.3"
                     /note="ancestral locus Anc_2.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138091.1"
                     /db_xref="GeneID:59324535"
                     /translation="MLRRQARERREYLYRKAQELQESQLQQKRDVIKNALAQGKPLPK
                     ELAEDEQLQKDFRYDQTMKDVTADSVDDEYAATSGLADPRIIVTTSRDPSTRLSQFAK
                     EIKLLFPTAVRLNRGNYIMSNLVSACVKSGTSDLVVLHEHRGVPTSLTISHFPHGPTA
                     YFTLHNVVLRHDILNRGNQSEVNPHLIFENFTTTLGKRVECILKHLFPPGPKKDSPRV
                     ITFVNKGDFISVRQHVYVRTREGVELAEVGPRFEMRLFELRLGTLDNKDADVEWQLRR
                     FVRTAARKDYL"
     gene            complement(<513763..>515127)
                     /locus_tag="HG536_0B02800"
                     /db_xref="GeneID:59324536"
     mRNA            complement(<513763..>515127)
                     /locus_tag="HG536_0B02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282197.1"
                     /db_xref="GeneID:59324536"
     CDS             complement(513763..515127)
                     /locus_tag="HG536_0B02800"
                     /inference="similar to AA sequence:RefSeq:NP_012131.1"
                     /note="ancestral locus Anc_2.222"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138092.1"
                     /db_xref="GeneID:59324536"
                     /translation="MTEASLSRSSTRSTNYSTCPPSRTLSDSNNSLIFERDVEDPGLM
                     TSNSPSNSLSKHGSTASLLSRQYSNQCVGPRSRDGSTTLPHSPPLEGHSPEYVKPSLD
                     HRRTLENFVAPALDAGCSVVTDDNANLDEMDIVYMRRPSTIGLDMALGRTKSNSSATI
                     TSSNNNNNNNNENGGFGSPSSPSVPPLSLSRSYSNSNCTQPENPRTLRFYSYVDMLSD
                     EMAHNSQSYMRKPALSYSFSSSHIRSGPQRPAVTANFSNPFVKRRDSSAGSGALARRY
                     SNTLLTRSPTTPASSYSRPQQPRSKSSANVSSVSVGKTAGKGLPRSGKSNFHIESSGS
                     DELSTDDDEEMPHHSSLPPPASHTLIDPRISRTSTHSSINNGNGSGCSSPLFATRTYS
                     NTGISNTLGGPSIIRRRESAGMFPQPSINNVLMYDDTLQTEKVGEALKRRINSRKDSV
                     STNN"
     gene            <515938..>517563
                     /locus_tag="HG536_0B02810"
                     /db_xref="GeneID:59324537"
     mRNA            <515938..>517563
                     /locus_tag="HG536_0B02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282198.1"
                     /db_xref="GeneID:59324537"
     CDS             515938..517563
                     /locus_tag="HG536_0B02810"
                     /inference="similar to AA sequence:RefSeq:NP_014326.1"
                     /note="ancestral locus Anc_2.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138093.1"
                     /db_xref="GeneID:59324537"
                     /translation="MAMGAAMRRRLMSRGLWRPLALRWNHRGSSIDASRLEFSKRNHV
                     IEKQLATYYPSVSTLASDRVVTIEQFHERYAAIEGDEAAMVCQVNGRIKNIRFSGKRI
                     CFIDLCNTRSSKSLQLIVNASKVDASLQERFEADLRFLKVGDYIQGSGYPGLSQRQRT
                     VSLKCTELPRILSCAQMPLPPRLSDASKVKQNRVVDYQVNRRAIETLMLRQTIVNSIR
                     SWLNERQFVEVETPILSSQSNGAAAEPFITRSNSLPKESAQLELRVAPELWLKRLIIG
                     GFDKVYEIGKVFRNEGIDAIHNPEFTTLEFYQTFLSMHQLISLSESLFKRIVLDLHKH
                     HSNETLESLVKELESANWKFRRLEFLPTLSQELAVDLTKLDLSDTEMLYNVVPPELKL
                     ARGLSPQQILNKLSSVFIEQRHCNSLLPTVLYHHPTVMSPLAKTNTLDPAVTKRFEVF
                     VKGKEYINAYEEENCPQMQLAKFEQQSQSNKLYKDKESLNVDYRYVEAMKWGMPPIGG
                     FGLGIDRLCMLLLDKSRIEDVLAFGCLDDVNRQ"
     gene            <517895..>518797
                     /locus_tag="HG536_0B02820"
                     /db_xref="GeneID:59324538"
     mRNA            <517895..>518797
                     /locus_tag="HG536_0B02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282199.1"
                     /db_xref="GeneID:59324538"
     CDS             517895..518797
                     /locus_tag="HG536_0B02820"
                     /inference="similar to AA sequence:RefSeq:NP_014327.1"
                     /note="ancestral locus Anc_2.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138094.1"
                     /db_xref="GeneID:59324538"
                     /translation="MPSFPPTVESALDSLHTTTSSSPVPQDVAKASSPVIMGVDEAGR
                     GPVLGPMVYGICYCTKEYQDTVLIPKYGFDDSKKLTDEVRRELFARIYQGEISGVGYA
                     TTCITPADISSGMLRFPPSMNYNLNEQAHDVTMSLIQGVIDNGVKLHHVYIDTVGPPA
                     SYQKKLEQRFPNIKFTVAKKADSLYCVVSVASVVAKVTRDIIVEQSRRHPDELIGSGY
                     PSDPRTTAWLRGSQTPLFGWPKEMARFSWQTCQTLMNNPGTGSIPIEWEEQYIGSKKN
                     MAQQWAAKASPNKDAIKTLDNWFN"
     gene            <519147..>520538
                     /locus_tag="HG536_0B02830"
                     /db_xref="GeneID:59324539"
     mRNA            <519147..>520538
                     /locus_tag="HG536_0B02830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282200.1"
                     /db_xref="GeneID:59324539"
     CDS             519147..520538
                     /locus_tag="HG536_0B02830"
                     /inference="similar to AA sequence:RefSeq:NP_014328.3"
                     /note="ancestral locus Anc_2.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138095.1"
                     /db_xref="GeneID:59324539"
                     /translation="MSSLLRVIPRATRASLLSVARSQLQLRCYASYPPHTVIGMPALS
                     PTMTQGNLAVWIKKEGDKLSPGEVIAEVETDKAQMDFEFQEEGYLAKILVPEGTKDIP
                     VNKPIAVYVEEESDVAAFKDFKVEESSAKATSEPVKKKETKDSKEKKPAKSSEDEKKS
                     STSTRASAPTERIIASPLAKTIALEKGIALKNVTGSGPHGRITKSDVEAYLEKAPAAS
                     SGAGVVAPSAAASYEDVEISNMRSIIGKRLLESTQSIPSYIVSSEISVSKLLKLRKSL
                     NATANGKYKLSINDILIKAITVAARRVPDANAYWLEEQGIIRKFKNVDVSVAVATPTG
                     LLTPIVKNADSKGLTTISSEVKELVSRAKINKLLPEEFQGGTICISNMGMNDAVSLFT
                     SIINPPQSTILAVGTVRRVAVEDAGAENGISFDDKINITGTFDHRTIDGAKGGEFMKE
                     LKSVIENPLELLL"
     gene            <520816..>520998
                     /locus_tag="HG536_0B02840"
                     /db_xref="GeneID:59324540"
     mRNA            <520816..>520998
                     /locus_tag="HG536_0B02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282201.1"
                     /db_xref="GeneID:59324540"
     CDS             520816..520998
                     /locus_tag="HG536_0B02840"
                     /inference="similar to AA sequence:RefSeq:NP_014329.1"
                     /note="ancestral locus Anc_2.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138096.1"
                     /db_xref="GeneID:59324540"
                     /translation="MALFPSFILSDESKENISKIINLTHTVAHYGWIPFILYLGWAHT
                     SNRPNVLNLLSPLPSV"
     gene            <521257..>522192
                     /locus_tag="HG536_0B02850"
                     /db_xref="GeneID:59324541"
     mRNA            <521257..>522192
                     /locus_tag="HG536_0B02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282202.1"
                     /db_xref="GeneID:59324541"
     CDS             521257..522192
                     /locus_tag="HG536_0B02850"
                     /inference="similar to AA sequence:RefSeq:NP_012132.3"
                     /note="ancestral locus Anc_2.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138097.1"
                     /db_xref="GeneID:59324541"
                     /translation="MDLQLTPFGKEIVAGLTTGSITTVVTHPLDLVKIRLQLLATNSG
                     HLGYGYVISSLKQNAKGNIRQLIKEAYRGLGINWFGNATAWALYFGLYRASKDLVYEL
                     QAQENSRHDDRLRRDAELSSWMYLSAGAISGVITSIATNPIWVIKTRMMSTSGQETNS
                     YTSAADGIRRLVRDEGIGGLWRGLMPSLFGVSQGAIYFMIYDTLKHRFSSLSRDTEDP
                     DRRKTLKNSETFVISSISKVVSVTAVYPFQLLKSNLQSFDAEKKQYTFRNLVRSISQA
                     EGLPGFYKGLSANLLRAIPSTCITFLLYENVKSFI"
     gene            complement(<522391..>522732)
                     /locus_tag="HG536_0B02860"
                     /db_xref="GeneID:59324542"
     mRNA            complement(<522391..>522732)
                     /locus_tag="HG536_0B02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282203.1"
                     /db_xref="GeneID:59324542"
     CDS             complement(522391..522732)
                     /locus_tag="HG536_0B02860"
                     /inference="similar to AA sequence:RefSeq:NP_012133.1"
                     /note="ancestral locus Anc_2.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138098.1"
                     /db_xref="GeneID:59324542"
                     /translation="MVSHKTARGKAAMERLKVFEGVPPPYDKKKRVVVPQALRVLRLK
                     PGRKYTTLGKLSSSVGWKYEDVVSKLEEKRKVRSAEFYAKKKAFNKKVAAATAAASES
                     EAAKKLATLGY"
     gene            complement(<523676..>524314)
                     /locus_tag="HG536_0B02870"
                     /db_xref="GeneID:59324543"
     mRNA            complement(<523676..>524314)
                     /locus_tag="HG536_0B02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282204.1"
                     /db_xref="GeneID:59324543"
     CDS             complement(523676..524314)
                     /locus_tag="HG536_0B02870"
                     /inference="similar to AA sequence:RefSeq:NP_012134.1"
                     /note="ancestral locus Anc_2.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138099.1"
                     /db_xref="GeneID:59324543"
                     /translation="MITAQYNDLKLLSVWTSPARSDLAHFIYQTVANNGNSTVYYIDA
                     TNRFPLKEFQQITSPNNKEVYDRIRIITCLDLAELAVTVNKVVQVLNMDKIHRQQRQS
                     DKDETSAAENRTEILLVLQGLELMFRNTQLNCSPSESHLALRDLLLRLRAIANNTTSD
                     SLILRTILTFPREELLKFMSRAANDSKRLKSSLINGNTLGEYVAKYYADIVI"
     gene            complement(<524474..>526732)
                     /locus_tag="HG536_0B02880"
                     /db_xref="GeneID:59324544"
     mRNA            complement(<524474..>526732)
                     /locus_tag="HG536_0B02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282205.1"
                     /db_xref="GeneID:59324544"
     CDS             complement(524474..526732)
                     /locus_tag="HG536_0B02880"
                     /inference="similar to AA sequence:RefSeq:NP_012135.1"
                     /note="ancestral locus Anc_2.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138100.1"
                     /db_xref="GeneID:59324544"
                     /translation="MSRESAIDKNLNRGGEYLNVVNANGYSAQQQQSLVNAVISVLQG
                     PDQATMVSKQYSNERNLATEVQAYAKISGKDWTYYVKGLEISIGRNTDTVAVAIPNVD
                     VKDGPQAIDIDLGPAKVVSRKHAIIKFNMQHGGWELLVLGRNGAKVNFKRVQVGPAAP
                     PVLLTSGTILDIGGTQMMFILPEQEPFISQTCISHLIPKLVARYGSAVNDGYRSSDPN
                     ALLYDILKESDYMKRQPLRQPQQQIRTFKMYGNGTSSHAEYGPSMQLNADSHFMNGVS
                     KMDNSGVMLPSGTSNGQMNQTDLNLSYSNPSQSLTQIGFPQSLDFASDLSRDENKNVK
                     PPHSYATMITQAILSTKEGVISLADIYKYISSNYAYYRFAKTGWQNSIRHNLSLNKAF
                     EKVPRRPNEPGKGMKWRISEDYQRDFLSKWNAGKIGKVRRGSSVARQLQLHLSKYNSL
                     PSQSDYPPEQTVIKLQTMHSRSKMTNQPNMLSQPQSQSQLDSSSISASPAEAVSVPPS
                     QNMLRSDQQTSSSQQLQSTRLMPPPTSGPHISQNPTNNALVSFTNASASTASAVPSAG
                     SYSNTPKNVPPIITNTSSSASHLSPSHTSILRSPTKAFHITAMEAYTPERGSAQQRRS
                     PVTDQNNDPNLLTAEDADRNVKKSSNNDGAQDVSNGATGEKLTNRSSPGVWNLLQFSS
                     VNNTPAVINNNDTKNSSAEGPSRTVLNREAAAESDTKDVASSPLKRQQNQEEGKELML
                     DTDGAKITLVNE"
     gene            <527859..>530432
                     /locus_tag="HG536_0B02890"
                     /db_xref="GeneID:59324545"
     mRNA            <527859..>530432
                     /locus_tag="HG536_0B02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282206.1"
                     /db_xref="GeneID:59324545"
     CDS             527859..530432
                     /locus_tag="HG536_0B02890"
                     /inference="similar to AA sequence:RefSeq:NP_012136.1"
                     /note="ancestral locus Anc_2.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138101.1"
                     /db_xref="GeneID:59324545"
                     /translation="MADLQRQQLLQSKRRRVTRACDECRKKKVKCDGQQPCIHCTVYS
                     YECTYNQPTKRNGSSLPTSTQQSQSVKWAKPTGSFNPNISATINVSAPSSVSVGSIKK
                     QNSRESKLQAQVNKYKALFHEILPDLPDIDSLDLPTFIQIFRNFSSNSQYASSILQDT
                     ITEYHLIASDATPCSSKTTTPDGSSTGSNSLISTDVVESVDGSIQSHMGREIKIILPP
                     KPIALQFLTNVWEHCCVLLSFYHRPSFIKQFDELYETDPQNYSHDQMQFLPLCYSTMA
                     VGALFSKSMDEPKNPIGQNSDTELENGDENQNEEGSYSRGKFLEDEGYKYFIAARKLI
                     DITNARDLNSIQTILMLIVFLQCSARLSTCYAYIGVAMRSALREGLHRSLTLESGFNP
                     IEIEMRKRLFYSVHKLDIYVNAMLGLPRSLSPEDFDQTLPIELLDENITEEGYFPENE
                     NNVLSSAGIANQHTKLVMILDVIVRKLYPTKKTNNLISHDVVTDLEMKLREWLDGLPP
                     ELIPGREDVPKEYETANRLLHLSFFHVQLILYRPFIHYLSRKSVANNRDSLSIQRARN
                     SISVARSAVNLAQEMLKKNLLTGSYWYGCYTIFYSVAGLLFYVHEAQPSDKESALEYE
                     QILKDAEIGRNVLLQLKNTSMAADRTYNLLNKIFEKLNSKTIKLSEIHGNSEQQSATK
                     DEKRDMSLQPTTIAPRQISDTSNSGRYFGPELSATFQSQGLRPMANEHAASPNKFNKT
                     ISGVNTVNTAATSNIPTNESDIFTKTDTTPMDGFSILDTINNDLFGSANMSDNSFKGL
                     GEMTAPEGSENLGSDGVKREGVDSESYIPGAFDQLDIQLFGRYLPPYMSQQGDASEPG
                     K"
     gene            complement(<530554..>538044)
                     /locus_tag="HG536_0B02900"
                     /db_xref="GeneID:59324546"
     mRNA            complement(<530554..>538044)
                     /locus_tag="HG536_0B02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282207.1"
                     /db_xref="GeneID:59324546"
     CDS             complement(530554..538044)
                     /locus_tag="HG536_0B02900"
                     /inference="similar to AA sequence:RefSeq:NP_012137.3"
                     /note="ancestral locus Anc_2.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138102.1"
                     /db_xref="GeneID:59324546"
                     /translation="MNSAFTFPAQSEALESFKFPIKEENDITTSQSASQIPNGAQSRS
                     HNGGYMLESNQDVLPPTIDIPPPVESIEEIAQVSSKTNPNANIEEIVLADDFIPVPGA
                     SPEQISAITPTETTSRSLAEEYVSNLRQQLATDWKSPSEYALHVLFTKFVRHAESKLN
                     LCLQHPLISEPPIVDILGEGVDPVFDKIIESLGHIAKRKPKPVIDAMMFWRKTKSEIA
                     RVATELVEKLLREYENEQTRTNPRNNHMVQTAVPMAHSKSLSNGSRFTHKRNSSSKSS
                     AGSRSGIEGSRFRELESQIESAKATALKADRKSLISIYILCRVLIEIVKQSSGEGDED
                     LSDKLEEIVFTQLKTTDPLSISSSIIKSSNWNSFAELLGWMSEKKFLSVSDRFVADLE
                     KIPTYINRNLEPAVHLLILGMRYLRLKNYPLERFEETADFIKSIAKFFSRAENISVSL
                     AYAEVISQLLLPLAGTLTAEVNHPIWVEAMTTLLAAGSKLLSDSKYWASGFKLTISVL
                     CASPSELFSLNWISLIEKNAKKSRNKQLAARVLFAVGLSRLVWVYLYRCPETLNNTTR
                     TLHKVIGLYVNSKRKENWITTDLELINPLSDVLVTIGHAYPNFVVEHAMIPLVRQSFN
                     GSNLDGINYEKLILAINTYRGLLMTNKKPEFPENDSRFYELGLNDISIKKSEALLLNH
                     EEICSHFYKLFLILDSKIGCEVWSPENQHNREPPTPFEKFSFSFTHDNNTNNNRNLNV
                     ALFATLIETIPSCLCISAQMPFKSAIEVLSRNAVHADLLIATSCENALKALASKRNPY
                     TVITWFAKYSFDFDEKTQSSYNMSYLSSSEYRKLLMLYVELLECWLEEFQSGSEDVKR
                     REATQDAVNLGPDLPDTAEPSEMEMLELKNTATVIEEVEGNGLFFLCSQDPAIRKLSI
                     QILRITSRFDRATIGKATKMSNGHSRSSSRFAADSGTRLVDLLNDSDYNSLVDPKKVF
                     LSDVEKSRISKLTSKYKKGMLIKLAESEYGVDAALWQRVFPKLLSVIFESCPVTMALC
                     RSIVCIRLVQVHEIILQIANKVDGRVSDVSPEAVTNQWKLYLIVACTSLTSTNDQKLH
                     IPTASPQHGRKKSQQIFTVQHQKIKSATSIFKMVLPLLNAKCGIVRDAIIAGLSSMNV
                     NIYRAYIENVDKFLTSWKISSTTNKIRVEMFHVLTILSRFLHNPTVLEDEWALSKISA
                     FLKHVKRFLEEETIQSSYTYQPLRSFFAEFLKNYCIATKAKGVFKKSLPFAARASCFN
                     YLKEWCGYGEYAYVAEERYATMIRNVSNSRDRTTITAGIEFQKSRLEKVALECMVVLC
                     SDPITEKLNSGSDLPIIVSFDIGGLLSWIEALFNASDEAVRLIGVRALENLLGKNKEN
                     SKLFRDVALQCVSYHKQPIVSTLYYTTFCKIVLEMDDLILDEDELVSLGLYGLVSDKE
                     ETRTYAVDLLCVVESQLHNSSYTKVFKERLASTSKSVYKSTAKEISSIFAELLSQDLC
                     LKIFSNLVRILGLFAFDIKKDLLILMVPWVNKFILKSFDEPDTFMALNNLFYITIDLN
                     DKLPLEVEQLWISLGKGNSLQNIHVSLEYIITLSINHRNPAFVQHAKDVVLYLANVPG
                     GIGLIDTLLQNLEPKYMVPVNTVSTIAPADNGKFSFVADIWGRLDYHGKSITFSKAHL
                     SIIFLVNLASTPSESLKGSIPTLLHISICLLDHYMPLIQESASKVICDLIFSMAPGHE
                     KSDATVKMLRDKHSLWSYDNLMKDKNGARSPKAMDALTRNILSIFSQIDGFHAEWQRI
                     SLKWATTCSVRHIACRSFQVFRPLLTFVDQGMLRDMLHRLSNTISDVSPDIQGFAMQI
                     LMTLNAVTAELDPADLINFPQLFWSITACLNSIHEQEFIEVLSCFTKFLSKIDLDAPD
                     TVQCLVATFPSNWEGRFEGLQQIVMTGLRSANSLDITWKFLDKLNLLKDSRIVANSES
                     RLLFALIANLPRFLHAMSQRDFTSIQPAIDALTNLSEAYKQPSLSRLIDSLSRNKFRS
                     KKDFMSQVVSFISRNYFPEFSGQTLVFLLRLLLNKIGWVKVETMEILKYIFPLVDLKR
                     PEFTGVGADLISPLLRLLLTEYETQALEVLDCVTNVSGSKLDKDVLRISMGNKDIKAS
                     GTITTTLFGIPEESGWSVPMPTMTAATTRHNVHAVFMTCAVETHGEASMEQPPAMDDI
                     VEFHADTDYGFGRTETNDSVSLVEEKDASLSHMWAELDNLDSFFTKTTVSASVAPHSG
                     LGILHDRTNSVETTQTEQTSTFESAPQLYDKKVSALLNGSLTKINSNVSFKKSLADSF
                     TVSTPNEKLVSEPALRTAYHSPHLYGEDTMAPRSRNSNVLKSPGNAVLGAVSSSRSKA
                     IESPQDTLFRFEGFLKSSQRSSRRKWQYHQQHQQLLSQTIHEQNPQSPYEGDSITPPL
                     RASSASPVLPLNATSVLGNNVDNLKGKQGIYKQNSGKSGTSKSNKHQKLYHLPHFSSS
                     KTQTWINGSNWDSEQK"
     gene            <539329..>542373
                     /locus_tag="HG536_0B02910"
                     /db_xref="GeneID:59324547"
     mRNA            <539329..>542373
                     /locus_tag="HG536_0B02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282208.1"
                     /db_xref="GeneID:59324547"
     CDS             539329..542373
                     /locus_tag="HG536_0B02910"
                     /inference="similar to AA sequence:RefSeq:NP_012138.1"
                     /note="ancestral locus Anc_2.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138103.1"
                     /db_xref="GeneID:59324547"
                     /translation="MIEDPAASIIPFIANVGINDEKAQEIAIGLSEGVVQRRFKLLDL
                     VVALKEELLSNEASQRQKALHCLSSVLAELPEDQLSKNEVSVVFSFYLSKYEDSNLIK
                     ETLHGLSSLAKMRYMSRENTESLMDLLTSKYQSGSFLAPVRYFAFETIKNIYMRNETK
                     LVADNDFADVFVKCYIHVVSGEKDPRNLLISFKLSRQMTSTLKNISKFKEELFDILFC
                     YFPITFKPPKDDPYKISNADLKLALRSAMSANAEFSEDAFGNLIDKLTASSPVVKNDT
                     LLTLKTCVDNFGGEALVDNWLPLWNALKFEIIHGNDESSPIVPVGQSEPSGDNVNNYQ
                     EALNVMKSLSYGLITFDGIAFEKFFGHIYEELKPNFTHDKDLKQSCCILASIGSANVD
                     TFNKVIESSLPLFLSNTSATAKLKLIIMNLSFFFKAYAEVFNTMDSSDEKIRSNKLLS
                     FKDEILMILSKALTGTSKVETTLRTLAVIQFTKMTTMKDFLDKDEVALIIQYLTETIL
                     TDDNKNIYCACLEGLKTIGDTHEETILHVSLTRMLDLLPVSEKAISMNSEPIERESVL
                     RVLLDFTTSKHSLVNESLIKISSKSNSTARCGDDSEYCFLLASALFTLMVNNIDSMSE
                     SDAILLKENVEPLLLQLLTEDSNVFIKDHTRMLLSNVLFFISLKLPVAQHQQNLETYK
                     ELFNSKLKIFEKPAHHVFPFVQLLAAASNNCKFEDADSIFEKAIRLITSKHPISEFEK
                     LGYLELLMVLSNKWVPEDTIERLCDWDDLSFSNLETLIWIGKGLIMRNCDMGLTFQER
                     LADKLSREDVGSFVAKKFEVLVTDLVLMGKYKGVPLSNNVRLLYKQKYFSEVFPKLLD
                     QHKRTSNLLVKANYLTALALTAKHIPPKVMEPYMPEFTPILLQALNLPMAEVKVSALK
                     TLKDTVKKHNQLATEYAQSLYPVLLKLVLPGPFNDVQVRLLSLELLETLSAVVPINYS
                     QPHKNDIIRGLEPVLDDTKRIVRKQCVATRQAFFELGQVPFD"
     gene            complement(<542406..>543014)
                     /locus_tag="HG536_0B02920"
                     /db_xref="GeneID:59324548"
     mRNA            complement(<542406..>543014)
                     /locus_tag="HG536_0B02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282209.1"
                     /db_xref="GeneID:59324548"
     CDS             complement(542406..543014)
                     /locus_tag="HG536_0B02920"
                     /inference="similar to AA sequence:RefSeq:NP_012139.1"
                     /note="ancestral locus Anc_2.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138104.1"
                     /db_xref="GeneID:59324548"
                     /translation="MSENAQLQATAAVNELLGTLLPGAKKISVSDGGRSQGRGSHRGS
                     KAKLIDRNLKRMVELRERDEVALKKRQKKKKIRAIKCSRASREEIEQAAKLRVLEEHR
                     KRGNLSAKERKYLNKLAERNARNVDAWELEDEEKEELRELQQRIIGQISADRPTRGQA
                     RRKKIKTFKEEIKPVADRRYPGLTPGLAPVGLSDEEESSDED"
     gene            <543492..>547442
                     /locus_tag="HG536_0B02930"
                     /db_xref="GeneID:59324549"
     mRNA            <543492..>547442
                     /locus_tag="HG536_0B02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282210.1"
                     /db_xref="GeneID:59324549"
     CDS             543492..547442
                     /locus_tag="HG536_0B02930"
                     /inference="similar to AA sequence:RefSeq:NP_012140.1"
                     /note="ancestral locus Anc_2.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138105.1"
                     /db_xref="GeneID:59324549"
                     /translation="MSTVSASAAAVPATKVGTADVASKRNEVDSVIMIPRPSSKTQLE
                     QLIYRYRAILESKRENKLEIEAIERVLGEVSADHDVYLERLEQLRSNAKQEVCYDDGL
                     LGRQLLALQLLDSDMGFPEGLLLGDANEQPAGQEVFAGAEGVKPIEISLDFEKNVENL
                     GLADSFSNCSPTELGNPAVESKVSFRIAKRISELERLPANLASYSLEDSLDFVTKDDI
                     PSRVDEAKIRALIELKGLKLLTKQKSLRQKLITSVTSQAHHTIPYLRDSPFTVAAQRS
                     VQVRSKVIVPQTVRLAEELERQQLLEKRKKERNLHLKKVNRIVDLVKERQLETWSHWD
                     RCLQFGRLGQVAHNQIEKEEQKRMERTAKQRLAALKSNDEEAYLKLLDQTKDTRITQL
                     LRQTNSFLDSLAQAVKVQQNEAKILRGEEVQPMTDEEREKVDYYEVAHRVKEKVTKQP
                     SILVGGTLKEYQLRGLEWMVSLYNNHLNGILADEMGLGKTIQSISLITYLHEVKKEQG
                     PFLVIVPLSTITNWTLEFEKWAPSLNTIIYKGTPNQRRSLQFQVRSGNFDVLLTTYEY
                     IIKDRSVLAKPDWAHMIIDEGHRMKNAQSKLSHTITHYYHTRNRLILTGTPLQNNLPE
                     LWALLNFVLPKIFNSAKTFEDWFNTPFANTGTQEKLELTEEETLLIIRRLHKVLRPFL
                     LRRLKKEVEKDLPDKVEKVIKCKLSGLQHQLYQQMLKHNALFVGAGTEGATKGGIKGL
                     NNKIMQLRKICNHPFVFDEVEGVINPTRGNSPLLYRVAGKFELLDRVLPKFRATGHRV
                     LMFFQMTQVMDIMEDFLRMKNLKYMRLDGATKTEDRTDMLKKFNAPNSEYFCFLLSTR
                     AGGLGLNLQSADTVIIFDTDWNPHQDLQAQDRAHRIGQKNEVRILRLITTDTVEEVIL
                     ERAMQKLDIDGKVIQAGKFDNKSTAEEQEAFLRRLIESESSKDDEDKAELDDDELNEI
                     LARSEDEKKLFDQMDQERIQLEKKEAKAAGHKTPLPRLIELPELPEVFTEDISTHLQP
                     EPVAVGRIRERKKVYYDDGLTEEQFLQAVEDESSTLEEAIQRRRDARVKRQRIPTSGD
                     EIDTLETTPEPDVKEPLDGELPAAEPSDATAEPKRRSRNKRKRNSPAIDGDGHIEDAY
                     MEDKIDAEPNQREKKKPKLKIKLTLKNEDQPPPDEAGVDGPASKKTSKSKSSKAKKAK
                     KPQNNLLPLIEDLLGQMREQIEESDGHPLTTIFEKLPSKRDYPDYFTLIKQPIALDII
                     MRNAKKGQYAALEDVKKDLQVMYDNARFYNEEGSWVYNDADKLNEFTDQWFKDK"
     gene            <547664..>548239
                     /locus_tag="HG536_0B02940"
                     /db_xref="GeneID:59324550"
     mRNA            <547664..>548239
                     /locus_tag="HG536_0B02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282211.1"
                     /db_xref="GeneID:59324550"
     CDS             547664..548239
                     /locus_tag="HG536_0B02940"
                     /inference="similar to AA sequence:RefSeq:NP_014332.1"
                     /note="ancestral locus Anc_2.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138106.1"
                     /db_xref="GeneID:59324550"
                     /translation="MKYVQTEQFIEVPQGVTVNIRSRVVKVTGPRGTLVKNLKHIDVT
                     FTKVNERQIKVTVHNGDRKHVAALRTVKSLVDNLITGVTKGYKYKMRYVYAHFPINVN
                     VIDKDGKKFIEIRNFLGDKKVRLVPVREGVSVEFSTNQKDEMVLSGNSVEDVSQNAAD
                     VQQICRVRNKDIRKFLDGIYVSEKGVIEQEA"
     gene            <549138..>552203
                     /locus_tag="HG536_0B02950"
                     /db_xref="GeneID:59324551"
     mRNA            <549138..>552203
                     /locus_tag="HG536_0B02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282212.1"
                     /db_xref="GeneID:59324551"
     CDS             549138..552203
                     /locus_tag="HG536_0B02950"
                     /inference="similar to AA sequence:RefSeq:NP_012141.1"
                     /note="ancestral locus Anc_2.237"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138107.1"
                     /db_xref="GeneID:59324551"
                     /translation="MLRSIPSSCNGSSRFLKNCLVRRISIPRSTARVVVSTGFSKKRC
                     FATSTDNFLSTSNANYIDEMYEAWKADPSSVHASWNAYFKNMGNKNIPASNAFQAPPN
                     LVGGPTGAENLPLDSPGTSVDENVMVHLKVQLLCRAYQVRGHLKAHIDPLQISFGDDK
                     SKPIPKELTLEYYGFTERDLDKEINLGPGILPRFARDGRTKMTLREIINAMEKLYCRS
                     YGIQYTHIPSKEKCEWLRERIEIPTPYQYTIDQKRQILDRLTWATSFESFLSTKFPND
                     KRFGLEGLEAVVPGIKTLVDRSVELGVEDVVLGMAHRGRLNVLSNVVRKPNESIFSEF
                     KGSCAQDEAEGSGDVKYHLGMNYKRPTTSGRYVNLSLVANPSHLEAQVPVVLGRTRSI
                     LQSKNDLEQKTKALAVLLHGDAAFAGQGVVYETMGFVNLPEYSTGGTIHVITNNQIGF
                     TTDPRFARSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRQTFHTDAIIDVV
                     GWRKHGHNETDQPSFTQPLMYQKIAKQKSVIDVYTEKLVVEGSFTKADIEEHKKWIWN
                     LFEEAFEKRKDYKPTSREWLTAAWEDFKSPKELATEILPHEPTNVKAEILKDIGKAIS
                     SWPENFEVHRNLKRILTNRGKSVETGTGIDWSTGEALAFGTLALEGYNVRVSGEDVER
                     GTFSQRHAVLHDQSSEKIYTPLKNLSDKQGDFTISNSSLSEYGVMGFEYGFSLTDPDY
                     FVMWEAQFGDFANTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLER
                     FLQLANEDQRFFPSEEKLQRQHQDCNFQVAYPTTPANLFHILRRQQHRQFRKPLALFF
                     SKQLLRHPLARSDLSEFTEGSFQWIIEDQEHGKAIGSKEETKRLVLLTGQVYAALHKK
                     RADLDDKTTAFLKIEQPHPFPFAQLRDTINSYPNLEDIVWCQEEPLNMGSWSYVAPRL
                     TTVLKETEKYKNHVVRYCGRNPSGAVAAGSKALHVAEEEAFLKDVFTSS"
     gene            <552486..>553361
                     /locus_tag="HG536_0B02960"
                     /db_xref="GeneID:59324552"
     mRNA            <552486..>553361
                     /locus_tag="HG536_0B02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282213.1"
                     /db_xref="GeneID:59324552"
     CDS             552486..553361
                     /locus_tag="HG536_0B02960"
                     /inference="similar to AA sequence:RefSeq:NP_012142.3"
                     /note="ancestral locus Anc_2.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138108.1"
                     /db_xref="GeneID:59324552"
                     /translation="MTEETTRKVAVVTGASSGIGYAITSELARNGYKVYACARRTGPM
                     ETLAKEFESGVIVPYCLDVTKEAEILELKRTLASELPYRKLDLLYNNAGQSCTFPALD
                     VTNDMIEQCFKVNVFGHANMCRELAQFVINAKGTIVFTGSIAGIGVFPFSSIYAASKA
                     AIHQYARDLHLELKPLGVRVINAVTGGVSTDIADKRPLPATSIYNFKEGIEVFQNRQL
                     MAKKNSPMSAETYAAKMVQDILSDRDPVDVYRGSFASTMSWVILLVPYWILEFFVSKK
                     FKLDKVYNILKQRKE"
     gene            <554233..>555516
                     /locus_tag="HG536_0B02970"
                     /db_xref="GeneID:59324553"
     mRNA            <554233..>555516
                     /locus_tag="HG536_0B02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282214.1"
                     /db_xref="GeneID:59324553"
     CDS             554233..555516
                     /locus_tag="HG536_0B02970"
                     /inference="similar to AA sequence:RefSeq:NP_012143.2"
                     /note="ancestral locus Anc_2.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138109.1"
                     /db_xref="GeneID:59324553"
                     /translation="MRISSAALAATLIGSVSALPHLQVKRDEDCVTTVADAHQHKRAV
                     AVEYVYQTITVDGHGQTVGRISDVTTPTSTLSPAAPSSVAVTTSSQAAAATTLSSEAQ
                     TTTLSQTPSSSSPAVATSSAETSSSAVAASSAVATSSAGPSAGPSSSTSSTGGISGDL
                     GAFSGPSEKFQDGTIPCSQFPAGQGVISLDWVGLGGWSGVENADTSTGGNCKDGSYCS
                     YACQAGMSKTQWPSSQPADGRSIGGLYCKGGFLYRSNTNSDYLCEWGVPSASVVSKLN
                     QDVAICRTDYPGTENMVIPTLVGAGQSQPLTVVDQDSYYTWRGMKTSAQYYVNNAGVS
                     VEDGCVWGDAGSGIGNWAPLNFGAGQTGGITYLSLIPNPNNKAPLNFNVKIVAADSSS
                     VVQGECYYENGKYNGNGADGCTVAVTSGSAHFVLY"
     gene            <556579..>557658
                     /locus_tag="HG536_0B02980"
                     /db_xref="GeneID:59324554"
     mRNA            <556579..>557658
                     /locus_tag="HG536_0B02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282215.1"
                     /db_xref="GeneID:59324554"
     CDS             556579..557658
                     /locus_tag="HG536_0B02980"
                     /inference="similar to AA sequence:RefSeq:NP_012144.1"
                     /note="ancestral locus Anc_2.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138110.1"
                     /db_xref="GeneID:59324554"
                     /translation="MQETTAEQQKQKKSSVRSREPSDELEKRGVEASSNIPNSDSAAG
                     RYSDLKRQFMNELGLGQYYEIQVRDNATFNRLLESRIEQQRKEVEEQRDRNLTTLSVV
                     LDKCIKSDKITGDLIERILDLVGIPRHGDKPVEPCSKRRRLTSPMTSPKGRSRILSDA
                     TALASKDAQGFVAPVQNVQGTYPMLYHGGAGPAPWLPQQFNKPLPPQNQYQSSFPAGL
                     GMSVTRSREPSMAQNNENQPGVRPGSYSPVHIAPVSNPGSSALPSTGPTGRASLMTMH
                     PESPQKAPANFLLPSHQAQSQYRMKTEPVSQRKTAGHRRSQSATVLPNASGSGSVRSP
                     VRELQASPQRPVNFLIHTPKHPPPT"
     gene            <558310..>559938
                     /locus_tag="HG536_0B02990"
                     /db_xref="GeneID:59324555"
     mRNA            <558310..>559938
                     /locus_tag="HG536_0B02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282216.1"
                     /db_xref="GeneID:59324555"
     CDS             558310..559938
                     /locus_tag="HG536_0B02990"
                     /inference="similar to AA sequence:RefSeq:NP_012145.1"
                     /note="ancestral locus Anc_2.241"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138111.1"
                     /db_xref="GeneID:59324555"
                     /translation="MSSQDIMSLRNSKENPPPEDEYKSDHHEYDRGRLSAVEAARSKG
                     SEDAVPYSRFQRPEKFMLVVQCAFTGFFSTIAGAIYYPVLTVIEHKFNVSEEQVNITV
                     VVYYIFQGLSPTLMGGFADHLGRRPIVNLSILLYCAACIGLACSNTYAQIVGLRCLQA
                     AGISPVIAINSGIVGDVTTRKERGGYVGYISGFQVVGTAFGALIGAGLSSRWGWRSIF
                     WFLAIGSGICLLFSLFLLPETKRTIAGNGSVTPKSPLNWSPVLRLPIVRRRLHLDDPD
                     LDTVAPASKLNLLAPFSIIKIPEISLVLLVAGLQFSTWTTHQTALTTSLSKDYHLSVA
                     KIGLCFLPSGICTLISIVSSGRYLNYNYRRKMIQHRAWVAQREQALLKEHEGDELLVK
                     QIIESDYHYTFNIFRARMQPALFTVMLSSMGFISFGWCISVKAPLAAVLCTSGFASLF
                     SNCILAMSVTLIVDLFPSRASTATGCLNLFRCALSAIFIACLTKMTQHMKSGGVFTFL
                     GSITLLSTGFLVVVMAHGKKLSYRRRQQERKGQI"
     gene            <560460..>562154
                     /locus_tag="HG536_0B03000"
                     /db_xref="GeneID:59324556"
     mRNA            <560460..>562154
                     /locus_tag="HG536_0B03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282217.1"
                     /db_xref="GeneID:59324556"
     CDS             560460..562154
                     /locus_tag="HG536_0B03000"
                     /inference="similar to AA sequence:RefSeq:NP_014334.3"
                     /note="ancestral locus Anc_2.242"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138112.1"
                     /db_xref="GeneID:59324556"
                     /translation="MSVPRNSTASEASEEITLEEEDVRCLNDEDTDKSGEKGSRCSEL
                     KNKPNDDALSTTTTRKLSGLHPESESSSIFEPEKDAKGESPYTLLSYAQKWGMVALLT
                     MCTFWSSLGSPIYYPALKQLEKQFNIDENMVNVTVVVYLLFQGIAPTVSGGLADIYGR
                     RPIIVIGMVIYVVASIGLACCNSYGVIVFLRCIQSACISPTIAISSGVVGDFTLKFER
                     GTFVGATSGFALLGQAFGSLIGAALAAAWNWRAIFWFLVIGCGSSLVVVFTLLPETKR
                     TLVGNLSIKPKNILNRAPVLLLKPVRRRFRYDNPDYDTLDKNIPKLDLTSALKITAQP
                     EIFLSLLPGGLQFAMWTLMLSAISSELLASPYDYKLTIVGVCYLPAGIGGLIGSFVTG
                     RIIDIYYRRLIKKFEKGKEEGTISPDAQFNVIKARLTAALPQNFISVASFLLFGWSVD
                     KGWPVAAVLITSCVSSFCTMSTLSTSSTMLVDLYPSKSSTATSSFNFIRCTLSAIFMG
                     CFAKMKASMTVGGTFSFLCGLVFIGNFLLLIPMNQGMKWREQRALKAQLACEKALS"
     gene            complement(<562344..>563573)
                     /locus_tag="HG536_0B03010"
                     /db_xref="GeneID:59324557"
     mRNA            complement(<562344..>563573)
                     /locus_tag="HG536_0B03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282218.1"
                     /db_xref="GeneID:59324557"
     CDS             complement(562344..563573)
                     /locus_tag="HG536_0B03010"
                     /inference="similar to AA sequence:RefSeq:NP_014335.1"
                     /note="ancestral locus Anc_2.243"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138113.1"
                     /db_xref="GeneID:59324557"
                     /translation="MVKDSKFYDLLGVSSTATDSEIKKAYRKAALKYHPDKNPSEEAA
                     EKFKEVSSAYEVLSDPQKREVYDQFGEEGLSGGGAGAGGFGGFGGFGDDIFSQFFGGA
                     GSARPRGPQRGRDIKHEIAVTLEELYKGRTAKLALNKQILCKSCNGRGGKEGAVRKCT
                     GCSGTGYKFVTRQMGPMIQRFQTECDQCSGTGDIIDPKDRCKACHGKKVANERKILEV
                     HVDPGMKDGQKIVFRGEADQAPDVIPGDVIFVVSEKPHKKFQRVGDDLVYEAEIDLLT
                     AIAGGEFALEHVSGDWLKVAIVPGEVVSPGMRKVIEGKGMPIAKYGGYGNLLVNFKIK
                     FPPSHFTSEENLKKLEEILPPRAKVVIPAKAHVDECVLSEFDAAKYSRQNGRGAQSYD
                     EDDEETGGAEGVQCASQ"
     gene            complement(<563993..>564985)
                     /locus_tag="HG536_0B03020"
                     /db_xref="GeneID:59324558"
     mRNA            complement(<563993..>564985)
                     /locus_tag="HG536_0B03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282219.1"
                     /db_xref="GeneID:59324558"
     CDS             complement(563993..564985)
                     /locus_tag="HG536_0B03020"
                     /inference="similar to AA sequence:RefSeq:NP_012147.3"
                     /note="ancestral locus Anc_2.244"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138114.1"
                     /db_xref="GeneID:59324558"
                     /translation="MADGPKTEQDSGNETLENYLDGIFSSALADQVESEEAVDREVDR
                     HEDEKAEAAPRTVELRRQNSSSSVSSSGSSSTYSIEISRTSPLISFSSNAKKTRNKWK
                     ASEDFALLGMVLNYSHLLTFVEYFKPMKKFWGKISQALNEQYGFERNARQCHDRFKVL
                     YAKALKIQDDIDEDDTYSGTLNSESKQLLLQIRNTFTFCKGNITLKSQPAVAGGHPAE
                     AAASASNSSTDNPDLRQQPHDGTTETERNERETMHSYIFHVLSNLQEQIDLLRSHLRA
                     TDRKTQELASTLQDLISATQYSLPETVSFANASTSRPDDRDDNPHSHLPQPPRG"
     gene            <565472..>566359
                     /locus_tag="HG536_0B03030"
                     /db_xref="GeneID:59324559"
     mRNA            <565472..>566359
                     /locus_tag="HG536_0B03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282220.1"
                     /db_xref="GeneID:59324559"
     CDS             565472..566359
                     /locus_tag="HG536_0B03030"
                     /inference="similar to AA sequence:RefSeq:NP_014336.1"
                     /note="ancestral locus Anc_2.245"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138115.1"
                     /db_xref="GeneID:59324559"
                     /translation="MPRVSPAMVRKVASHDPLLGMLLPVCRTAEAARQELRWIRTELN
                     HAGPSVRRACALRARSVPLQYVLGSQPFGELQILCERNVLIPRWETEEWASELAARWR
                     RATSSRVTAPTVVDLCTGTGCVALLLKRALPRAEITAVDCSRFAVALVTKNLHHNDVG
                     HVTVLQRDILRDERPAISADLVVCNPPYIPRDAFVRDATTSVKVYEPRLALVADKEFY
                     TNLCDVWLPHTRSFVYEIGDEGQARFVADRISARADGRRWAIGLRRDSNGKPRVVYGF
                     RTDDARLHRVYDGFGYLVT"
     gene            complement(<566352..>567776)
                     /locus_tag="HG536_0B03040"
                     /db_xref="GeneID:59324560"
     mRNA            complement(<566352..>567776)
                     /locus_tag="HG536_0B03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282221.1"
                     /db_xref="GeneID:59324560"
     CDS             complement(566352..567776)
                     /locus_tag="HG536_0B03040"
                     /inference="similar to AA sequence:RefSeq:NP_014337.3"
                     /note="ancestral locus Anc_2.246"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138116.1"
                     /db_xref="GeneID:59324560"
                     /translation="MKSFRIFKLLQSHRIAKRTQDSHCSCEGTLPSGNMDPLKQLAFD
                     QHVILRLPSGNRKIVQLKPNSSISLGKFGAFQVNDIVGYPLGTTFEIYYDGTHEPDLK
                     NKNRTPIGKIRLMPRSENENAERNQSPLPAELANVLSSANNQQLVNLGNDVQGLSTAQ
                     IEALKNQTASGEEIIAKMIENHGTFDKKTVYSQEKYLKRKKQKFSKFFTAEYLSSSAM
                     LQFLLEKGDVQRVMDMSQESLGMLLNLANIRSNGTYLCVDETGGLLVYFLLERMFGGA
                     NDTKAAGTIVVVHENEHPNLDLLKFSNYSDAFIKDHVKTVSLLDFFEPPSPREVEAAF
                     TPLPKDQVWSLKAGKKNAYYRRLKWYNNQRQIISLAAETEYDALVVASTLHLPQLVQR
                     LSASVHGSRPVVCYSQFKETLLELAHALYDDLRFLAPSILEIRCRPYQTVRGKLHPLM
                     TMHGGGGYLLWAHRVIPAAEPAAT"
     gene            <567911..>569764
                     /locus_tag="HG536_0B03050"
                     /db_xref="GeneID:59324561"
     mRNA            <567911..>569764
                     /locus_tag="HG536_0B03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282222.1"
                     /db_xref="GeneID:59324561"
     CDS             567911..569764
                     /locus_tag="HG536_0B03050"
                     /inference="similar to AA sequence:RefSeq:NP_014338.3"
                     /note="ancestral locus Anc_2.247"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138117.1"
                     /db_xref="GeneID:59324561"
                     /translation="MGSRRVKNKQQAPPSLEEFQARKEKKLNKKAKRVKPDGEERGES
                     RKAKKPKKAKSRGRDEDDEEKRHLEQLKNEEQSLPEVDLNELSKAKKSLFDEDEGEEE
                     AEDEELQDEFDLEQEYEYDDDEEANDEHPVFSDDEDVDLEELNAANMEEMSRKLDEEN
                     AMEAEEAEKELVEAGQTQPRAEVLPTQEEEELMAQQPPDLTSIRTRMIEIVKVLEDFK
                     NMAAEGRSRAEYTDRLLKDICQYFGYTPFLAEKLFDLFSPAEAMEFFEANEIARPITI
                     RTNTLKTRRRDLAQALVNRGVNLQPIGSWTKVGLQIFDSQVPIGATPEYLAGNYILQA
                     ASSFLPVIALDPQENERILDMAAAPGGKTTYISALMKNTGCVFANDANKARTKSLIAN
                     IHRLGCTNTIVCNYDAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEKDFIQ
                     IPHLQKQLLLSAIDSVDSNSKTGGVIVYSTCSVAVEEDEMVVDYALRKRPNVKLVDAG
                     LAIGKEGFTSFRGKKFHPSLKLTRRYYPHTYNVDGFFVAKFQKIGPSPNDNNQATPRE
                     KELAARQEAAEEGIIHSDFANFDDPEDEKYIKKSQKNSLLKKGIDPRAQKK"
     gene            complement(<569890..>572139)
                     /locus_tag="HG536_0B03060"
                     /db_xref="GeneID:59324562"
     mRNA            complement(<569890..>572139)
                     /locus_tag="HG536_0B03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282223.1"
                     /db_xref="GeneID:59324562"
     CDS             complement(569890..572139)
                     /locus_tag="HG536_0B03060"
                     /inference="similar to AA sequence:RefSeq:NP_014339.1"
                     /note="ancestral locus Anc_2.248"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138118.1"
                     /db_xref="GeneID:59324562"
                     /translation="MSRDSSLPPLKVRVIDEPPLLEQPEKFDDPNDYSPDTPIAIDFG
                     SHEVRAGFVNQAVPSHVFTNRLTRFRDRKLSRTMTFIGNDVNLDQAVRAQSKSPFDGP
                     MITNWDYVEEIMEYTFHHLGVNSNGGIPNPLLITERLATPLSQRSNWYQVLFECFDAP
                     GVAFGIDDLFAFHYNTHRDCTGLVIGCGNEDTNVIPVINGQGILTEAKRINWGGNQAT
                     EFLTNLLTLKYPYFPTKLSSFQYRTMYEDYCYVSHDYERELEGFLDINTLESRNVVVE
                     VPFVEIIQPQKTEEELRIQAEKRKESGKRLQEQAKQKRIERLIQKEEELEYYTQVKEQ
                     LKDQPKKKVLQVLQNSGFDDERDFKKYLYNLERSLKKSHAANEEGDDVDDEQDMSQNK
                     FELLEIPDENLSEDQVKEKRKQRILKASLEARRKAKEEKEKALQEEEERMIKERQWRE
                     TDLEGWIKDKRKRLNHLITKRKENIKMRDEMKDRKSQMSQNRMKNLATLAEDSGRGTK
                     RTRQQATIDNDPNDTFGANDEDWGVYNDITQNPEALEELIEEEYKEIVDLEGQLLEHD
                     PHFTEEDTMDAQYDWRNSLLHLFLRGPRPHDSENSHEQHQMHLNVERIRVPEVLFQPS
                     MGGEDQAGIAELCERALLGKFDASPRQLSPITSEMSKNVWVTGGNAKVSGLRERIVKE
                     FTGFLPVGTPFSINLSTNPSLDAWKGMAKFAQNEQEFKKGFITKREYEEYGPEYIKEH
                     KLGNMNYFE"
     gene            complement(<572366..>577600)
                     /locus_tag="HG536_0B03070"
                     /db_xref="GeneID:59324563"
     mRNA            complement(<572366..>577600)
                     /locus_tag="HG536_0B03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282224.1"
                     /db_xref="GeneID:59324563"
     CDS             complement(572366..577600)
                     /locus_tag="HG536_0B03070"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138119.1"
                     /db_xref="GeneID:59324563"
                     /translation="MVKEEYKAELATTLLTELLAYQFAFPVRWIETQDHFINEFKAER
                     IIEVGPSPILANMATRTIKANESHELACGRNMKRQVYCTSNHLDKIYYGTEPAAQATA
                     LERKKQELDALAQERPHEQPANIVSVATSSTQSTSGTFRFANQVTLCSKHMLTALVSN
                     KLPGCKYADLNLEKSLKELSHGKSTLQNEIKSDLIKEFECLKDDSFEDIPLIQLSSDI
                     EQDTLGPLTLARVIKFVSQSFSGKYQSLNGVRNYLMTKWSVIDPNPVLLFIAYQDSSF
                     KQRFSTETDTEQFINDCCETFARIEKVGVIKADGCLSNSRESFDGSEEQKLISREEYD
                     AFSGGLMILHQQQRNVLDNHLTITKQANDYTRMIRELQVMKQRYSDLEAEFGEYYLNQ
                     SIKRLFSPRKVRIYDSAWNWSRQDILLLLHSVPLAGTRKIGVDTFPNIRDILNRVDQT
                     SLKMLQYFIDRKCPNGPWKTYLSKLYKLCQESLNLQPICTDDVGTTLTINRSNGDLTD
                     LHEKEFNSEHYIKNMSLGNHSEAIKCDSSVVSTKLEMDSSSYYKIEGELFRVYSKIIQ
                     YALAASSSNPDDLWCQFESLYEQLLIFIKNSDQIASYFRNIVSDALSSINKSLYEKGN
                     DVVIHDYSIECSSDEESDVDILSDESKNEQYHAQTARGLPETTKSSGNDRCAIPVGVI
                     PFLHIKRHSNINEEWIYDKHFTQVFLNNLLKIGSSGLSLTGKTALLLISDVSSKLVSQ
                     IIRVLLQAGATVLAAVNEFSYNITQKLQSIYHNFGSKTSKLVVLPLNQASKVDVKEFC
                     GYITSIYEDIDFLLPLNVHESENNITSLSSKEEVTLRSVSVNLLRLFGHLVEAKQSKK
                     MQTRPTFVILPLSPLSGSRGTSGILSESYAFLNKVLEKWQVEGWKESLSFCGCMYGWT
                     DEDKSDPFLTEGLEKLGIRTFSPTETAFNLLGLLTYEIVTQAQSTPLVADLNGGLHNL
                     PNIQPVLQALKSDLIEKGNLEKLLKDEEEQDKYTLLEDEEVFTTEVKPKGNIDLQYPN
                     LLDYSILKEEYNGSQIEGLLDPANLVVVTGFAEVGPWGNSRTRWQIESTGVFSLEGCI
                     EMAWIMGFIKYKQTSEMCGWVDAATFEPVDGIKIKERFEAKILEHSGIRIIEPELFGG
                     YDPSRKQMLQEVIINHDLQPIQTSAEIAEQYKLEQGDKVDVFALNDGQCSVRFLKGAS
                     LFVPKALNIERMVAGQIPTGWSPEAYGIPADIVSQVDPTTLFALVSTAEALIASGIVD
                     PYEMYQYVHVSEVGNCIGSGIGGMKSHEAMQVFRMRDEPVQNDIMCETYINVIAAWIN
                     MLLISSSGPIKTPVGACATAVESLEMGYETIALGKAKICLVGGVDDFQGTISHEFANM
                     GATSNSTNEAADGREPREMCRPATSTRNGFMESQGAGVQILMRGDLALKMGVPIYGIV
                     GLTATASDKIGKSLPAPGKGILTTAREIQKKPRFGSSKLNLAYRKRQLRRRIQEIECW
                     TESELSIGADPELTHKLASSQLARAKMHWGTDFYKDDPNIAPIRGALSVFGLSIDDLA
                     VASCHGTSTKANEKNESQILDKMMDHLGRAEGNPLIAVFQKHLTGHPKGAAGAWMLNG
                     CLQIMNTGVIPGNKNADNVDNQFETYKHLVYPSRPISMDSVKACCITSFGFGQKGAMA
                     LVINPNYLFACLSQEEYQEYALKRAQRERDANSHYNNGLAKGNIVQVKSAPPFSEELE
                     KQFYLDPLARINTSSKYK"
     gene            <578577..>579296
                     /locus_tag="HG536_0B03080"
                     /db_xref="GeneID:59324564"
     mRNA            <578577..>579296
                     /locus_tag="HG536_0B03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282225.1"
                     /db_xref="GeneID:59324564"
     CDS             578577..579296
                     /locus_tag="HG536_0B03080"
                     /inference="similar to AA sequence:RefSeq:NP_012148.1"
                     /note="ancestral locus Anc_2.249"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138120.1"
                     /db_xref="GeneID:59324564"
                     /translation="MGLLCGSSSTSKKPIEKKIVILGDGACGKTSLLNVFTRGYFPKV
                     YEPTVFENYIHDIFVDNKHITLSLWDTAGQEEFDRLRSLSYSDTDTIMLCFSVDSRDS
                     LANVQHKWVGEIADHCEGVKLVLVALKCDLRNTNSETNAITPGIINQQRSHQSATDLE
                     SSNRNVGGANNEGSSDNYITYQEGLAMAKKIGALRYLECSAKLNKGVNEAFTEAARVV
                     LTEDPKGKDAAKDDGSSCTIM"
     gene            complement(<579388..>580371)
                     /locus_tag="HG536_0B03090"
                     /db_xref="GeneID:59324565"
     mRNA            complement(<579388..>580371)
                     /locus_tag="HG536_0B03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282226.1"
                     /db_xref="GeneID:59324565"
     CDS             complement(579388..580371)
                     /locus_tag="HG536_0B03090"
                     /inference="similar to AA sequence:RefSeq:NP_012149.1"
                     /note="ancestral locus Anc_2.250"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138121.1"
                     /db_xref="GeneID:59324565"
                     /translation="MMNTLDMAVVSSGNWDMSEIEGVVKALPELTTTSTSASASASAT
                     GSETASTTTQYSVTVTPPSAAGNPNVWHNHKPDGTVFIVVGSIVGATILGMILWSVIT
                     SHLSRRNAKKSFREDQYRRHNRGGSALYDSGDDKELTPGLYGSEYGETGEKSRRSRLS
                     LLGNGSRLRESNSSESVPGYEPEWLEPVGQETFNPIQDPFTRYNRNSLFISPTIEVAQ
                     KPNLLPSQRSRLLEKPYHQSSLSATSLLSSDEINSTLNKPERAASPERKGKKGVSGHH
                     KRNKSSIGLTPANSSSSSSNDNTNDRRPRGGHHKQTPSMYLEDMLNVSNAA"
     gene            <580846..>581364
                     /locus_tag="HG536_0B03100"
                     /db_xref="GeneID:59324566"
     mRNA            <580846..>581364
                     /locus_tag="HG536_0B03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282227.1"
                     /db_xref="GeneID:59324566"
     CDS             580846..581364
                     /locus_tag="HG536_0B03100"
                     /inference="similar to AA sequence:RefSeq:NP_014342.3"
                     /note="ancestral locus Anc_2.251"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138122.1"
                     /db_xref="GeneID:59324566"
                     /translation="MGNSCNYIPPLSFSPVVGTDVSLYRSGYPMPLNYAFIRDQLHLK
                     TIIYVGDKEELSPEYDEFLRQEKIQFRRIHMVSCRDPDIHERMNEVLRLVVDVDNYPI
                     LIHSNKGKHRAGVVVGIIRKLLQGWSLAGIYQEYGIFSGGLKGEADLEFITMFETKLA
                     VPRKKMPDFAIF"
     gene            <581530..>582690
                     /locus_tag="HG536_0B03110"
                     /db_xref="GeneID:59324567"
     mRNA            <581530..>582690
                     /locus_tag="HG536_0B03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282228.1"
                     /db_xref="GeneID:59324567"
     CDS             581530..582690
                     /locus_tag="HG536_0B03110"
                     /inference="similar to AA sequence:RefSeq:NP_012150.1"
                     /note="ancestral locus Anc_2.252"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138123.1"
                     /db_xref="GeneID:59324567"
                     /translation="MVFALSEIVRPKIYNLEPYRCARDDFKEGVLLDANENASGPIPQ
                     DIADSGLHRYPDPHQIEFKSAMAKYRNDTSSFADLPEKLSAENLCLGVGSDESIDAII
                     RACCVPGKEQILTMPPTYGMYSVCADINDVEVVKCPLITGDNSFQMDTDAVLETLKRE
                     PSIKIVFITSPGNPTGAKIKTERIEKLLQNWDAGMVVVDEAYVDFCGESTAPLVTKYP
                     NLCVLQTLSKSFGLAGIRLGMTYASKEFARVLNSMKAPYNISSVTSEYALKAVQNDSI
                     QRMEQNAKSCKKEQQRLLQSLTALDLVDDQYVGGLDANFLLLRINKGDNKLANKLYQK
                     LATESGVVVRYRGSELGCEGCLRITVGTPEENDLLIREFARQLDALKETESD"
     gene            complement(<582785..>587104)
                     /locus_tag="HG536_0B03120"
                     /db_xref="GeneID:59324568"
     mRNA            complement(<582785..>587104)
                     /locus_tag="HG536_0B03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282229.1"
                     /db_xref="GeneID:59324568"
     CDS             complement(582785..587104)
                     /locus_tag="HG536_0B03120"
                     /inference="similar to AA sequence:RefSeq:NP_012151.1"
                     /note="ancestral locus Anc_2.253"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138124.1"
                     /db_xref="GeneID:59324568"
                     /translation="MRSSIGEEVHTETSEDYGFKKLGQVAILPSYNEKLPFASLQNLD
                     ISNENGLYIASSGGKVVIGDLQLLRDFIQNHKDTEISFRWEKALDDVIAVKFLPDNEA
                     LIVCRTGVVYKIDCANFDSFEEACSLKQPLLQVSVSRSKQLLAMTSEQELLCYDLGKS
                     SAPIEIADGVASFDSLGDEVYLLLSNNSIQIRRLAGDHLELQSTLAVPPELLEELGDQ
                     YQPLLLKVLNKKQLLVVYGEGVPESAEDVMYDHKMYIVNFSAENSTFSESFDITPAFG
                     SVLRYPTAYDVHIEALTGESETINILASACSSEISIWDSAEVVQPSQDSERAVLPISK
                     VTDNDTNPVGMALDIRTTGNISEPCQGVESVEKLPLIYILNNEGSLQIVGLYHSSAIK
                     EGTFKVPDVSRPATDLVAGADFKQVEDSADRASDAEETTVHEVARESKNTASSSGEET
                     KSVAAGTKSENSFGAPAFKSVNTGSAFGSPAFGISESKPAFGTPSFGSTNTELAFGNS
                     PFGQSGSKPAFGSPAFGAPSFGSADSKVAFGTSEDKPTFGTPSFGSSGAESAFGKPSF
                     GHFGAKPAFGSSAFGKTSFSDLGSKPALSAPENKPAFGTPSFGDSGTQSAFGKPSFGD
                     FSTKPTLVTPSLGGTNTSSTFGSPGFVGSDNKPSFGSISTTTPPKGSESKHAFGTASF
                     GTSSKSPFSSLSSSTFQGQNLPFASAPFKKFAENKLPSSGESPSPFASLANKMTDDSQ
                     KAAFASSDKLGDFSSTFVASEEQANDLKISNADRERAASAEASYEDLPDEKAQKKALA
                     REAEKESEDEALSSSENLESEEEDQKLSEVGSQEESELSRDKRDFKDTDLSDSTVERG
                     TPSQIQITDHTEDAKSSISAITARIKEGAKLSSSDLQINQFGREDDRRSASPFTAFAG
                     DLKKASSPGFSFASISSSSEKADKRISEKSAVGTAQGNASHSTKPINSSDATASTEKE
                     EAIQRNPFLTKHDDASHGDSQAVIDKSSLKLNTVLKPSSNDINSADAANDSDTLERHN
                     EKDFSSNKPKDASYAQIATSQGLDMTTADNDLSNSEENETTRDSDSSREESYDALDDV
                     LQEELDEAIKTKNQAQKVELPSTIDKALPPKETVEVKKEYISQGIQVYEAVDSALQAD
                     IPTACDFTVQSFENDETICALQNMPKSLPEYFTSANITAINFSSQDLTMRSIEKTYHV
                     LSSEIAVWQENAKNIEDFLKDQSTSCIERRTIASVPNVYTWRLQESEKLQDIMSEEMS
                     AFSGSARKIEQLQEQLAKSKVEKARDLQEELYKVKNDYYHYEISSSNPGFAELKHHQL
                     EMQSELRRKMLNAAERLNHIEEMLQILKLYTIDREEIGNNAYVHKLARDLADRDNLCN
                     EITRLREQVDELISRNRSSERQADASKSPDVSNQEIQSLPVAELCLKLRTRMQIGSLL
                     KRR"
     gene            complement(<587471..>588316)
                     /locus_tag="HG536_0B03130"
                     /db_xref="GeneID:59324569"
     mRNA            complement(<587471..>588316)
                     /locus_tag="HG536_0B03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282230.1"
                     /db_xref="GeneID:59324569"
     CDS             complement(587471..588316)
                     /locus_tag="HG536_0B03130"
                     /inference="similar to AA sequence:RefSeq:NP_012152.3"
                     /note="ancestral locus Anc_2.254"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138125.1"
                     /db_xref="GeneID:59324569"
                     /translation="MAPPFFSDINKGVNDLLNRDFYHTSVAAVDVSTIAKNGVKFDLK
                     AKQTVKDGPLAANIETKVSDKATGLTLTQGWSNSNNLNTKIELADVTPGLKTELVTSL
                     VPGVSKAAKLNVNFVQPFFTARGAFDLLKGPSFVGDLTLAHEGIVGGAEIGYDITGGS
                     LSRYAVALGYSAGDYSLGLSIDNAQLTTVSFFQKVSPILQVGAKAISTPKQLANVNIE
                     FATLYLPDPTSQVKAKVADSGIVALAYKQQLRPGVTLGVGASFNALNLSEPVHKIGSS
                     LSFSA"
     gene            <588844..>591813
                     /locus_tag="HG536_0B03140"
                     /db_xref="GeneID:59324570"
     mRNA            <588844..>591813
                     /locus_tag="HG536_0B03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282231.1"
                     /db_xref="GeneID:59324570"
     CDS             588844..591813
                     /locus_tag="HG536_0B03140"
                     /inference="similar to AA sequence:RefSeq:NP_014344.3"
                     /note="ancestral locus Anc_2.255"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138126.1"
                     /db_xref="GeneID:59324570"
                     /translation="MQWLMTMELIESKYGERIRRDWDCGGSCRVTGRDRDNLKSFAGM
                     VEDDNKLIVETETVEAPVSSLLIASTAAGNPANASGGGGSRMAYKEVSEVGVAVPGIK
                     TVVGNTVGSRNDASSSLKKVDGAASGSNINLIDHNPMSPHVGQASLRNKKSSLLIDSS
                     NDDRPKGDDEVKGRMVEADSRIGAGGGTGLRKHMDEIANANRDEAESHQGRPAGDGEL
                     GASRAFQSSKASSAVPTPLMLPVASHSIAGVTVPPTSMVSATSGTQANRAAESKPFNK
                     IMERPSVTVASSRELLRDEELLRKKGGSNAREDQVAGGPIKPSATHAEDHDIDSLHKP
                     TKADFFAARLASAVGENDISDSEETFIYESAANSTKNAIGTLAVDQQNDHSPQAQHGI
                     ASKMSVPVLSSNAKLLTRLKNTRHTSMSALPTGMGTKQPANIESFNSKTEAPPHGGSM
                     APPTTSTLNAEQDSVRSSNVHRAGKPADAHSIRSVTSETWSPDKRLSLTSVTKGANGP
                     AKQGHSSRKPSISNSTLRHVSSSQAGTARGKFAANNASKPEPEGTPNACNKRNLRTTA
                     SKIFDANGAPLRRYSGVPDDINLEDFIEQSNGHLMPSVSNQKEERQKVNSESNHLTDK
                     RFSRDMMDQDHRRTIQEVEGEDNGDEDDMHSMFYYNHRGDLEARPQISDYEEDPEAME
                     DDHHDDKYFNVTFNTGLGNSNSRQPRLFESGFSPADIHFQTSHLGNGPSNGQGQNTNI
                     NEQTPLRHRKQFSRAQLSYSPHNFYTRKSSWAKIKHCVYFTFVVISLLTTGFILGFLL
                     ATNKELQDFNIVLMDNVLSSSDELLFDITVSAFNPGFFAIGVQDVNLDIFAKSAYISK
                     NIQGSSELNSPTRETILLGTVYTLETPLKFEGGFIRRNYDVSVSTVKLFDPGSKQDLP
                     DGDEREMTTSTAVKRSKDDVQRWKLLIKHEYELIVRGSMQYRVPFFRNSKSVAVQNSV
                     EVRPGKDDDEDGDDDET"
     gene            <592344..>593660
                     /locus_tag="HG536_0B03150"
                     /db_xref="GeneID:59324571"
     mRNA            <592344..>593660
                     /locus_tag="HG536_0B03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282232.1"
                     /db_xref="GeneID:59324571"
     CDS             592344..593660
                     /locus_tag="HG536_0B03150"
                     /inference="similar to AA sequence:RefSeq:NP_012153.1"
                     /note="ancestral locus Anc_2.256"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138127.1"
                     /db_xref="GeneID:59324571"
                     /translation="MAQEAEETMATPSSGLDIRSKSPRSLQSRNTKNLSLSIQESITS
                     SVTDFQDAQGCVPSVVTKPIAIDREMTKNGTADQQLQSRRTEASIYALPTGARSGSTS
                     PIYSPSGLRSPDNGVAPGDKVGRAHSLSLSVKTKELGSSLLPGERVKTMYSVFETSTP
                     KSNHFGSKDGRSWPTGVDRGTSDVTLSYPEAIKGDAYPSGPLMVIPPNVYLYSEPKLE
                     EILDFDVVINVAKEVPNMKQLVPGTKSISYHHVEWSHNSKISTDLDYLTDLIHKASAT
                     SKKVLIHCQCGVSRSASLVVAYIMRYHNLGLNDAYNHVKGIAKDISPNMSLIFQLMEW
                     NELRNKTPRQPEEAETRDMSTSSTSPTNDLTIVSPESTPRTPGEFFNKVSTASSSSTA
                     STSSTIIVSQNQSKPVALSPGLGNYLSTDISAPSPTDNFWSRFDAV"
     gene            <593886..>596930
                     /locus_tag="HG536_0B03160"
                     /db_xref="GeneID:59324572"
     mRNA            <593886..>596930
                     /locus_tag="HG536_0B03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282233.1"
                     /db_xref="GeneID:59324572"
     CDS             593886..596930
                     /locus_tag="HG536_0B03160"
                     /inference="similar to AA sequence:RefSeq:NP_012154.1"
                     /note="ancestral locus Anc_2.257"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138128.1"
                     /db_xref="GeneID:59324572"
                     /translation="MGEPGGPSVKKRSLSSYLSNVSSRREELEKLKKQQVEEKLEEEK
                     LEEEKQDDENQRLHLQQPEQNEQVSERDRQHACEKKADDVLQEIDQIKHQEEQEIDGV
                     YDGARKQNSEDVIDVKANEQDARDRETKNERSEDLQTSNGPLEISRSPLDLQKDSTKS
                     KSLTREDLHSLLKEPDGQNDPESERRGMDSGRAPKVRHNDSDEDIESDAPTEPASPPK
                     PRRRRLIRGDKLQSMSPSHSTFDNESDSELSDIDELKSIHISSSIIHGDSSPLKSTQE
                     DLRRKRLASSPRIEKRYSGSPRQLKPDISTPRIGRHKKGVYRDAGGRTKLQISCDKGN
                     YDQARKLIKEENYDVNDQDNAGNTALHEAALNGHLDIVKLLTESGADVNIQSFEMFKD
                     TPLIDASANGHLNVVKYLLAHGADPTICNAKGLTAFESIEEDSDLDENEQEIVSEIKK
                     HLMSAAKNWKSEKATQNAAKEKHDKNSTQRLQASEESLGDFEFFWTDITSRAGKQKLL
                     KASKEGKLSYIGSYLENGGRVDLRSFFEAVKLGHEDVASLFLAFGAQVNAVSKEGTTP
                     LISSVGRGHVGTVKLLLEAGADPRKKDKNGRTALYYAENSPMGVVDAEEVSLIRKALQ
                     DSGATAEEMAKGVEKVKNFKQEQIESSTNRRTWKKEENNEEDDEDDDENVINVGRKRR
                     TVSPDRSETKRQTPSIQPVKSTLAESPEHMETPEDVSETPSLEPETIKTQEETPEERE
                     LRLKAEEEYIQRRLQNKRRKEQELLKKLALDEEKREKERAEQKIKEAEKMAEEERLRQ
                     IELDNHEKELEILRRREIRSFYPLGLRLIDFNDKTDQDDFLPTYFVKLGEDQSKYVLD
                     LQLCVILKNPGFISQLANSEKIPVAMRHRKQLWNILKTTFLYGGPKNRHLLNWEALNI
                     QSRMHFELQEYNKFSSLPMNWIKTQDIPFDDPDTRRRVQQDMVQIALADDSDDTATSN
                     VPRGSAKPSPRHATHLPALPNKFQKRHTVSQLLQDYNCQSFW"
     gene            <597476..>597817
                     /locus_tag="HG536_0B03170"
                     /db_xref="GeneID:59324573"
     mRNA            <597476..>597817
                     /locus_tag="HG536_0B03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282234.1"
                     /db_xref="GeneID:59324573"
     CDS             597476..597817
                     /locus_tag="HG536_0B03170"
                     /inference="similar to AA sequence:RefSeq:NP_014346.1"
                     /note="ancestral locus Anc_2.258"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138129.1"
                     /db_xref="GeneID:59324573"
                     /translation="MPAAEQQDIVSKLSERQKLSWSELTDTEKQAAWYISYGEWGPRR
                     PVHGKGDASYIAKGVALGLIFSVGLFAFARQFGGEAPKTMTKEWQLKSDEYLKSKNAN
                     PWNGYSQVQSK"
     gene            <598227..>599327
                     /locus_tag="HG536_0B03180"
                     /db_xref="GeneID:59324574"
     mRNA            <598227..>599327
                     /locus_tag="HG536_0B03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282235.1"
                     /db_xref="GeneID:59324574"
     CDS             598227..599327
                     /locus_tag="HG536_0B03180"
                     /inference="similar to AA sequence:RefSeq:NP_012156.1"
                     /note="ancestral locus Anc_2.259"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138130.1"
                     /db_xref="GeneID:59324574"
                     /translation="MSFSFGFSSKDFSDDEIDNDGLLAGSEAVSPASSVNPLDDGRLL
                     GKDVVQPQWQNLKAVLDSLKDVRVSFEQFPTPRNSTVLYRRELFDVKHQLMSEAGDGD
                     EDSVELDILMGETSEDLRKNVYEGGLKSWECSIDVVDYLSELKSGLEDIDCVLELGCG
                     TALPTEYIYSMFLQLQPTTDLTFILSDYNRSVLRLVTIPNLIITWAKVVLSEDQYSQL
                     QKCNDETIPVRSDELLLTQQLLDAFYHDMQARKIRINLMSGTWGRSFTNLLAPTLNAH
                     SGILAITSETIYQPENLPVVAETLLDVILANKGSKVKALVAAKNIYFGVGGSMMEFEK
                     YLQKRIQQDCLPIIYHTQKVDAGLKRSIMFIE"
     gene            <599457..>600608
                     /locus_tag="HG536_0B03190"
                     /db_xref="GeneID:59324575"
     mRNA            <599457..>600608
                     /locus_tag="HG536_0B03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282236.1"
                     /db_xref="GeneID:59324575"
     CDS             599457..600608
                     /locus_tag="HG536_0B03190"
                     /inference="similar to AA sequence:RefSeq:NP_014347.1"
                     /note="ancestral locus Anc_2.260"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138131.1"
                     /db_xref="GeneID:59324575"
                     /translation="MSEDLEDFEVLLTDDFSSTQFCNDILVTVNGQPGTDELDLGTPL
                     KKLRYDLNEINLMIEETLKNNPTNVIDQMYRGKAVRNVTQRGLASSLEYLDISYQRVQ
                     REVIQPFERAQSLQNVLSKVHQTSILLRDGLVVMHLTGRLQMITGRRKPWSIDTMVEL
                     AAVYSQIDASLRENANLKSLKLIKQLESDTILPTRKELLSLLSIALTNALTAADENLE
                     NQADISKLAEALHTMSSREFTSTVQKAVLSFVAKSIQVLSKTLNSIKNFPLAFGEVVR
                     RGTIIRKIEQVLQNVKFEETNLLAIFISRSTPKSVKPNRLYWEKVSDAFRREFEVSFS
                     RGGPVGKLLSRNSDMIVDTIKQKMTDPHNHGGDPQLVDLMLQSVSIARS"
     gene            complement(<600644..>601075)
                     /locus_tag="HG536_0B03200"
                     /db_xref="GeneID:59324576"
     mRNA            complement(<600644..>601075)
                     /locus_tag="HG536_0B03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282237.1"
                     /db_xref="GeneID:59324576"
     CDS             complement(600644..601075)
                     /locus_tag="HG536_0B03200"
                     /inference="similar to AA sequence:RefSeq:NP_014348.3"
                     /note="ancestral locus Anc_2.261"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138132.1"
                     /db_xref="GeneID:59324576"
                     /translation="MKVSLREPIYETAKQERPRSYYFSSLTEEERSRYAESALDYESV
                     LRDASLGPYRGWARFRGRVLDVQLHNDRIELSSQQDKRLKRRRPGQKQRLARRMAQQR
                     EKERDEKAKEIKKMIKRKFHKRGGKKNKKKPEPTLPRFRTE"
     gene            complement(<601705..>604425)
                     /locus_tag="HG536_0B03210"
                     /db_xref="GeneID:59324577"
     mRNA            complement(<601705..>604425)
                     /locus_tag="HG536_0B03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282238.1"
                     /db_xref="GeneID:59324577"
     CDS             complement(601705..604425)
                     /locus_tag="HG536_0B03210"
                     /inference="similar to AA sequence:RefSeq:NP_012157.3"
                     /note="ancestral locus Anc_2.262"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138133.1"
                     /db_xref="GeneID:59324577"
                     /translation="MSHHKKRVYPQAQVQYAQNGFGQQPMVSPDGYPAVGAPGMPVQP
                     QNGVPQVAAAQQQFFTPVQQQLHQQIDQTAAALDNVHLHNVPVVDPSSYYQQQQPAAA
                     GQTFPQGQYQQQAASVPLRGGKPMNQLYPVDLLTELPPPINDLSLPPPPLMVPPERIL
                     VPSEEANASPDYVRCTLNAVPKTHSLLKKSKLPLALVIRPYQHLQDEINPPPLNEDGL
                     VVRCRRCRSYMNPFVTFTDQGRRWRCNFCRLANDVPMQFDQTLSGVPANRYDRNEVKY
                     GVMEYLAPKEYTMRQPPPSTYAFILDVSQNAIKSGLLATATRTLLEVLDSLPNHDDRT
                     RVSILCVDNAIHYFAVPPDEESDQIKMMDVGDLDEPFFPRPNSMVVPLNACRNNLEKL
                     LNQIPEIFQFNIMSKFALGPALKSAFNLISAIGGKIIVVSSTLPNVGIGKLQKRNENG
                     VVNTSKESSQLLSCQDSFYKTFTIDCSKSQITVDMFLASEDYMDVASTSNLSRYTGGQ
                     THFYPGFSAAKLTDVTKFTEEFSKHLCMDISMETVMRARGTSGLRMNSFYGHFFNRSS
                     DLCAFSTMPRDQSYVFEVTMDESIIGDYCCFQIAVLLSLNTGQRRIRVITVCLPTTES
                     LVDVYASADELAVTSYYTQKAVEKALGSSLEDARELLNKAVQDILAVYKKEIVVSNTA
                     GGAPLRLCANLRMLPLLMHSLTKHMAFRPGIVPSDHRAAALNNLESIPLPYLIKTIYP
                     KVYSLHDMPDEAGFPNEDGHIVLPEPINASASLFERYGLYLIDNTTELFLWIGGDAVS
                     ELVTDVFGCGDIFEVPIGKQELPIIENSEFNQRIRSIISKLREHDDVITYQSLYIVRG
                     ASLSEPVNHASAREVATLRLWATSALVEDKVLNSESYREFLQNMKMKISK"
     gene            <604858..>607014
                     /locus_tag="HG536_0B03220"
                     /db_xref="GeneID:59324578"
     mRNA            <604858..>607014
                     /locus_tag="HG536_0B03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282239.1"
                     /db_xref="GeneID:59324578"
     CDS             604858..607014
                     /locus_tag="HG536_0B03220"
                     /inference="similar to AA sequence:RefSeq:NP_012158.1"
                     /note="ancestral locus Anc_2.263"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138134.1"
                     /db_xref="GeneID:59324578"
                     /translation="MAMDLDTSADIKEDRGLGDWFLVLGESGSMKLTGSGEIELFNLH
                     DNDQFVSPCLTVHGKCKSGSGARMLQVLHPQLPPVTYPIHADGFKATVILVPGENRLT
                     FVTDTKVSRSVGCLYVPMLQDPPIHLCLLVARDSSLEFDSPRAQREKEGGNGLDLAVR
                     KLRVGARLMQAYTNEQMMRAGFGNRSFRFLEEFTWDTTFQQKEEMRNTVKIHILRSDK
                     STKEIRDYNLAQQNPDASDAGGLFGIAMEALQKYGGPFTKGPEPVQAAVMFLDTHWDG
                     KLITAHAALGGGTDEIKLAIFGSHGLFAWPPHIEQLVAYFTDDTRTSQKEVSNDCNEC
                     GTHWETFTLTLGAFMHEIGHSLGCPHEENGVMLRDYVTLNRSFLTKEAFSVRTNSFGS
                     QAPIFPKEECTWHHLDLLRFLYHPSFTLPQDYYDPSFMRPGKIDKFTEPKPSLYPLGD
                     NLCRITSRTGIYSIEMICGDLSKGYIEYLPRSLGGPGPVRDLTLSLDDLVARLPPNER
                     GTSFTLRILSVNAPEIQIGNFPSFLKPSFISMERYGLPRNVQGVKSQLLGNEHGGADS
                     GVVAFDVRHVSAIRVYHGGALDGIRLFLQPNMGSVNPPLPPRNYMEKLTNSFKATTLN
                     DEAKSSVLFGRQTNDYTDFVLEKDEIVTGLNVRCGGWIDAVQIATNHGRITKMLGNAT
                     GGGIVELRPPEGQYILGLYGRIGQWVDAMGIIYGNL"
     gene            complement(<607168..>609561)
                     /locus_tag="HG536_0B03230"
                     /db_xref="GeneID:59324579"
     mRNA            complement(<607168..>609561)
                     /locus_tag="HG536_0B03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282240.1"
                     /db_xref="GeneID:59324579"
     CDS             complement(607168..609561)
                     /locus_tag="HG536_0B03230"
                     /inference="similar to AA sequence:RefSeq:NP_012159.1"
                     /note="ancestral locus Anc_2.264"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138135.1"
                     /db_xref="GeneID:59324579"
                     /translation="MFKSVQYFESTAPSPSDSEVEPTEPRDVKPDACESEEHEDHGSR
                     GKHVRIMIDDESEDNAQDGESEGEDKQDKLDGLPSFQKRPLSDTPVTSTWNSPASSTD
                     NTPLTSPETSTTNLVQMNQALNQIPRQEAESTETRQANLSLSPPLATGALSPSRFPHP
                     SRRPTTIDVPGLTKSKSSPDGTISKEDPGSKLVIVMVGLPATGKSFITNKLSRYLNFS
                     MYYCKVFNVGNTRRQFAKEHNISDQDSKFFDPGNNEFSKLRDKWAMDTLDQLLDYLLE
                     GPGSVGIFDATNTTKERRKHVYDKIHERNPHLKVLFLESVCSNRAVVERNIQLKLFGP
                     DYKGKDPESSLKDFKERLANYMKAYQPIEDSENFQFIKMIDVGKKVIAYNIQGFLASQ
                     TVYYLLNFNLTERQIWITRNGESEDNVDGRLGGDSHLTPRGERYARALTNFIDYQRAL
                     FYNNEMEKKRKSDCDDEKQCNEFFVWTSMRQRSIETAKYFNEEDYPVKQMRMLDELSA
                     GDFEGMTYPEIQQDFPEEFEERRKDKLRYRYPGIGGESYMDVTNRLRPVIAEIERIED
                     NLLIITHRVVARILLGYFMNLSKDIIANVDVPLHCIYCLELKPYGITWALWEFNEETG
                     NFFKVPESEMNTTMVKENELVYKERRYSLVPTAPASANNSSSDIRAKKNGSTGSSTLT
                     RETGDKRITCSSSQNEAIHPTSAPAVPFAHNLPNPSNLIDGGGTSISVNRRQPTALQS
                     CVKSSLLANSIESLRPATSPRQTLQIDKLNERLINLKTRSPNKIKAVDDNERENKNK"
     gene            <610900..>611376
                     /locus_tag="HG536_0B03240"
                     /db_xref="GeneID:59324580"
     mRNA            <610900..>611376
                     /locus_tag="HG536_0B03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282241.1"
                     /db_xref="GeneID:59324580"
     CDS             610900..611376
                     /locus_tag="HG536_0B03240"
                     /inference="similar to AA sequence:RefSeq:NP_012160.2"
                     /note="ancestral locus Anc_2.265"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138136.1"
                     /db_xref="GeneID:59324580"
                     /translation="MAVHCVDFYNQINMLYGTVTEFCSPQSCPRMIATNEYEYLWSFH
                     KGESPVAVSAPKYVECLMKWCQDQFDDETIFPAKTSGQFPTKFIQRFVIPMLRRLFRV
                     YAHIYCHHFNEVLELNLQTVLNTSFRHFCLFSQEFELLRPADFGPLLELVMELRDR"
     gene            <611549..>613291
                     /locus_tag="HG536_0B03250"
                     /db_xref="GeneID:59324581"
     mRNA            <611549..>613291
                     /locus_tag="HG536_0B03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282242.1"
                     /db_xref="GeneID:59324581"
     CDS             611549..613291
                     /locus_tag="HG536_0B03250"
                     /inference="similar to AA sequence:RefSeq:NP_014350.1"
                     /note="ancestral locus Anc_2.266"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138137.1"
                     /db_xref="GeneID:59324581"
                     /translation="MAAVMFSDWAIARLITIGICSFVFLKGLLRTAPYFTMKPPAKYR
                     VRINNAIKKIEKDPGKNVKLDFGWKHGSVRRQMILASARPCEYSNGISSSNSISIGQS
                     DKLHREEFVNKLVPELRRNKRVLYGFFHPYCNAGGGGEKVLWKAVESTLSKSSGNVAL
                     IYTGDIFATQEQILNSVSQRFDYELDRDRVVFIYLKNRRLVDSKTWPRFTLLGQAIGS
                     IFLTLEALYKCPPDVWCDTMGYPFGYPFVHYFSHIPIVTYTHYPVISSDMLQKLQNME
                     NARSLRITVKYWYWKAFMLWYKYVGSFVSIATTNSTWTDNHMKRIWNGLNSKILYPPC
                     STEKLVTKSAKSKRKNQAVVVAQFRPEKRHKLILKAFAHFLESLDDISLAPKLIMIGS
                     TRSEADKDHVSYLRDWSRNSLQVPEILLEFRTDCPYEEIKSVLRESTYGINAMWNEHF
                     GIAVVEYAASGLIPLVHASAGPLLDIVVPWDSSERKQAEENTTETRTGFFFKDKSDPD
                     YNETQDRGKYPTLEELFITVVNLTDEEKHAISDRGRECVLVKFSDLKFHQGWDGVLDE
                     VQRDFLSQINKREY"
     gene            complement(<613381..>615516)
                     /locus_tag="HG536_0B03260"
                     /db_xref="GeneID:59324582"
     mRNA            complement(<613381..>615516)
                     /locus_tag="HG536_0B03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282243.1"
                     /db_xref="GeneID:59324582"
     CDS             complement(613381..615516)
                     /locus_tag="HG536_0B03260"
                     /inference="similar to AA sequence:RefSeq:NP_012161.1"
                     /note="ancestral locus Anc_2.267"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138138.1"
                     /db_xref="GeneID:59324582"
                     /translation="MSKHNTMTSHLSEVLAQQQHNLQQLQNLQQRAKSLTSNEYPGNT
                     NYMPQSPGIRQQQVYDQQPQVPLQSQPYPMDGLTSGSPAADTLTTQGGRTNSMSTYQN
                     AANIVAPVGIQASSGSAQGQFMQQAPAQGQAPIQAHLRQQQTPVNGQETAVQQPQAAM
                     PGSNRAAMQGRNSLTNASSVSRARTSMNRNNANAQQDPRSPLVILMPTNAQPTEVLAN
                     RFAAWRTVIRAIITYLTETASIQDEIVRQQLRLTHAVQFPFFATENQHQPSAPEDRSI
                     QKFFLPLGNGSIQDLPTILNQYHGSLASHASRTSKELTNEVIPRLEDLRRDLLVKMKE
                     IKSLQSDFKNSCSKELQQTKQDLRNFLESIEEAKYGTAKQDPYLTKIILDRQIKKQLT
                     EENFVHEAFDNLENSGAELEKVVVMEIQNALTIYARLLGEEAQLVFDCLLSKMEVGFF
                     SKDPQLEWENFILRDPNFIVPNLPMRKMKEIVYKNQNDPLTYEIRSGVLERRSKFLKS
                     YSRGYYVLTPTFLHEFKTADRKKDIVPVMSLSLNECSVTEHSKKGSSDDRFILHAKQN
                     GLIHRGHNWVFRADNYETMMAWFEDLKIFASIGNAQEKAKAVIERLGLQVDSKGQPNS
                     KLSSSPNPARPSMSQPPQDQQRVSMDVQSNNMDILTHNNIPSSTPRLDNQTNTITTSS
                     IPDTRDFEIDNSIPNIYIDIPANEAKNKR"
     gene            <616644..>617216
                     /locus_tag="HG536_0B03270"
                     /db_xref="GeneID:59324583"
     mRNA            <616644..>617216
                     /locus_tag="HG536_0B03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282244.1"
                     /db_xref="GeneID:59324583"
     CDS             616644..617216
                     /locus_tag="HG536_0B03270"
                     /inference="similar to AA sequence:RefSeq:NP_014354.2"
                     /note="ancestral locus Anc_2.269"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138139.1"
                     /db_xref="GeneID:59324583"
                     /translation="MNIIDQATRISALMKLLLTLVKQLSRFTEDLSMDRIKSEIRSLQ
                     GRLSSVRPPQEFFNVKNVSKPQNFGDIQSRVSYNLKYFSTNYALIIGALGIYTLLTNF
                     LLLFVIVFVLIGVAGINKLNGQDLVTPFGSFKTNQLYTGLLFVAVPLGFLASPISTLL
                     WLIGASAVTVLGHASFMEKPIETVFEEETV"
     gene            <617605..>618597
                     /locus_tag="HG536_0B03280"
                     /db_xref="GeneID:59324584"
     mRNA            <617605..>618597
                     /locus_tag="HG536_0B03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282245.1"
                     /db_xref="GeneID:59324584"
     CDS             617605..618597
                     /locus_tag="HG536_0B03280"
                     /inference="similar to AA sequence:RefSeq:NP_014356.1"
                     /note="ancestral locus Anc_2.270"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138140.1"
                     /db_xref="GeneID:59324584"
                     /translation="MNTPKNSHSATRDERPRSLFEVLFGAKVEDTNLTANVLEKALEL
                     RIEQERTKQQYYRLENASRTIELFTMAKEYGVPSYEIPKLFGGEELNIGSSGFRSGAS
                     NIGVPTSTVTDCSVKQPLCYKFPPAGSNLRPKPVAGDATTLAARRANSPARIGAYAVA
                     ALNEAASLKEEDQQLKFSPFPTNANHSVASHSRNLSLPVAKTAGSDIPSEMTSILSFG
                     KDYNEQISNSAGFGDSNQPGLRKASMVHKKHRRTRSGSSFGVIDLNMVDAHKQLSLPK
                     LKTQVDQLPIQSTEKNPEKRFDYDEITCSENSSRNGSPTQSKNTNSVANLLNSG"
     gene            complement(<618594..>620069)
                     /locus_tag="HG536_0B03290"
                     /db_xref="GeneID:59324585"
     mRNA            complement(<618594..>620069)
                     /locus_tag="HG536_0B03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282246.1"
                     /db_xref="GeneID:59324585"
     CDS             complement(618594..620069)
                     /locus_tag="HG536_0B03290"
                     /inference="similar to AA sequence:RefSeq:NP_012162.3"
                     /note="ancestral locus Anc_2.271"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138141.1"
                     /db_xref="GeneID:59324585"
                     /translation="MLTPDFVVTQDEKFVFIKIKVSTIRFNAAALEMAVEGSVFVFYL
                     SPYYLRLAFPHEVVDDERASAKYCSKDESIDIQLPKLKEGTFFEDLDVPTKLLARRGD
                     LIGADAASKRDDRCKKPLIQEIGSGNENLEKEDLQAISAAGDSFSWEIEQTADKQNSR
                     LLSIKYGFEDAYDTSVSVSVSNGNDINELDDPERTTPNNRVKERLRKEDLKFDPEYYV
                     SEYMIKRYASPEDLVINGIEEVMKFTPPLVKDYLKWYKNSDDRNSVMPIVFTEKEQEQ
                     MQKYIPRKEYLVSEPKKLYVTILCLLFAYIFEQMETGGVHNTESAWSIGKLTPQICFL
                     DQQLLLKDATEGVSLIKAAIITGIRRSLSYPLHRNYDLSTKAWTFVYYVLRGGKRLVT
                     RCLLDIHEIFRFHDVYYVYNRILLDDLCSWFISQGSENVTRSLALEMKKELDQISKDE
                     IEFNCISGVDEDTGELATENMTIREMEILAERQFQESEGAS"
     gene            <620249..>621511
                     /locus_tag="HG536_0B03300"
                     /db_xref="GeneID:59324586"
     mRNA            <620249..>621511
                     /locus_tag="HG536_0B03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282247.1"
                     /db_xref="GeneID:59324586"
     CDS             620249..621511
                     /locus_tag="HG536_0B03300"
                     /inference="similar to AA sequence:RefSeq:NP_012163.1"
                     /note="ancestral locus Anc_2.272"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138142.1"
                     /db_xref="GeneID:59324586"
                     /translation="MSSEQRSIPRRKFVGARRQDTSCETSCNNSSIVHKPKGRISTRA
                     INHIPDDILNDKDLNEAIKLLPQNYNFEIHKTVWNIRKHGAKRVALQMPEGLLMYSLI
                     ISDILEQFCNCETVVMGDVSYGACCIDDYTARALDCDFIVHYAHSCLVPIDVTTIKIL
                     YVFVTISVEEDHIIKTLKKNFAVGARLAVFGTIQFNPTIHSIREKLLSDEAHVIYVIP
                     PQIKPLSRGEVLGCTSERLNEEQFDAMIYIGDGRFHLESAMIHNPGIPAYRYDPYNRK
                     FTREGYDQRRLVELRSDAIATAAQGQTFGLILGALGRQGNLATVEKLEEKLTAAGKTV
                     VKIVLSEIFPQKLAMFDNIDVFVQVACPRLSIDWGYAFSKPLLTPYETNVLLKQDVMF
                     TEKYYPMDYYEASGYGRGKTPTHAVRDT"
     gene            complement(<621542..>624010)
                     /locus_tag="HG536_0B03310"
                     /db_xref="GeneID:59324587"
     mRNA            complement(<621542..>624010)
                     /locus_tag="HG536_0B03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282248.1"
                     /db_xref="GeneID:59324587"
     CDS             complement(621542..624010)
                     /locus_tag="HG536_0B03310"
                     /inference="similar to AA sequence:RefSeq:NP_014357.1"
                     /note="ancestral locus Anc_2.273"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138143.1"
                     /db_xref="GeneID:59324587"
                     /translation="MDFIDLEAFSVIDSSAEKASDSSLPEPSSLLDLSTLSIDSGTNE
                     ASFKIPDLRNREDVSGSGKDNLYDRMAQHASMLMSKVDKRAVDAEATKALRGKTSHFM
                     EPSRTFMTPAELKNLPDKNPSASEVTTDLLLRKLSNILNEHTLTNYQTRTQIRKSLQL
                     LEENKERLQLDESRLIDSGFVGNLARKSMRSGLENELLKEHLLVLEELRPIIRRIKRF
                     SIPVEKIKAAGQSIVDSHGLTSEDDKESVSKDIELLCSQAKRLRLKKSILSSMKDHFT
                     LTQVEDDYLLNGPVDVQFFRIVDKAIKIKEHTVVLLSLPSSTAADALIRRINQVLESV
                     YRKVFNHLIDFLHNYDSGSNSFAQATIPPSKSDRTIFKKSVVCLSNDLKYFNEFLKRV
                     TAMRSKGILDEFLSQFDYNPNESRPILLSAGDPLRYVGDVLASVHASIANEADFVKPL
                     FKFQEDLNIVTMHNKELFDGLDTKVFNEVVRSLANPSRIRIEQVIRFEEDPVINFEII
                     RLLDLYQLMYHRQGINTNNIVIENLKSLQEISKTRIEDFFTKYLGDIPSVSDKFNDSM
                     PPEWLYGYINKLVELFEAHEQGGDWETKKRSAVINGAFLENFVSNPIDEVLMKRLQQE
                     TPLAKKNDEARYSLLSVQINCLDLIKSRLQPFANSILAREEKAVNIWKSIGQKMDDFI
                     NRMLDLQFKLLMERCGLGLYYNLLNMIFPIASVQDELDYDMYLSLSDNPLMNLETIND
                     KVNKRLNEYVPQALTDIQDNLMFKLMSPTIADYICDSCLAKLCLFYATFRKVMIHLYP
                     ERTEDICNILNFSEEEFKALVGVK"
     gene            624475..624547
                     /locus_tag="HG536_0Btrna3T"
                     /db_xref="GeneID:59324974"
     tRNA            624475..624547
                     /locus_tag="HG536_0Btrna3T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59324974"
     gene            complement(<624653..>626758)
                     /locus_tag="HG536_0B03320"
                     /db_xref="GeneID:59324588"
     mRNA            complement(<624653..>626758)
                     /locus_tag="HG536_0B03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282249.1"
                     /db_xref="GeneID:59324588"
     CDS             complement(624653..626758)
                     /locus_tag="HG536_0B03320"
                     /inference="similar to AA sequence:RefSeq:NP_012165.1"
                     /note="ancestral locus Anc_2.274"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138144.1"
                     /db_xref="GeneID:59324588"
                     /translation="MSRCSKDVCGMERISKMTKKSGSDSVPHMARDERFKYAIHNLDL
                     SRVKLSESPLDDYQRLFFATLLSRPNVDQRRNIDVKRATYKSNIAESFACPSSGAAHD
                     AAVAKDKDTLGTSLRSQGKKVLDCFEYQFPDVDTAGSLCYSELSSLSEAVKENLGLKD
                     GRGHLLKGSISTANEESLPNAIALPAQAYAVRDSDERATNANSLTKNQQFKLRKQDHS
                     LHQNSKLINPNNCVLWTHGSGYVFLTGIWRLYQDVMRGLTSVPRLGEDSSERLQNICK
                     EELNYMITSAFYESSSSPISLSPSDRRKRRQSAGSEKISSLNLHDGSLLSSDSATVGT
                     TSLNPHYTDLHWNSLSRELKQMMCDTYRNHLINERGFNPGEIATIDYTEVVKRIRGGY
                     IKIQGTWLPFETARLLCVRFCYPIRYLLVPIFGPLFPKECEEWYTNVQQRLVRSAMKK
                     ESAISDSRELHPEQRRRKRRKSTKSEVSKPAGNELLNAFQNLLDISRHPVPIEAHEIQ
                     ARSKSLSCAPDYYTPLLPRRVSSETLPPISTVMQFISPRSSIGGGSEHSSSATEPENV
                     HYATAGPYPRQSGQLQSYPNPTVQTLSHLASFYNTHGHRYSYPGNIYMSHQKPVLNRS
                     PPYSSPDSELSEYQAKAAGINPAQKVTTGFDIPSYEPLQRENGRETRRWFSGSGKVGS
                     NDGLLSPKTVSPGQKPKRN"
     gene            complement(<627113..>627760)
                     /locus_tag="HG536_0B03330"
                     /db_xref="GeneID:59324589"
     mRNA            complement(<627113..>627760)
                     /locus_tag="HG536_0B03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282250.1"
                     /db_xref="GeneID:59324589"
     CDS             complement(627113..627760)
                     /locus_tag="HG536_0B03330"
                     /inference="similar to AA sequence:RefSeq:NP_014362.3"
                     /note="ancestral locus Anc_2.275"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138145.1"
                     /db_xref="GeneID:59324589"
                     /translation="MISDSIFTLTHDSKLDDLLAANQQWSKTMNDLHPGLFREYNAKG
                     QNPHTLFIGCSDSRYNEGCLGVLPGEVFTWKTVANVCSPEDLTFKATLEFAIRCLKVN
                     KVVICGHTDCGGIKTCLTGQIEPLNDKEGLNCQHLYQYLQDIDQMYHEEKSQLANLPT
                     LDAKSKYLSQCNVKRQFARVIENDTVKTAIANKELEVYGLVYNVDSGLLDPVISN"
     gene            <628515..>630368
                     /locus_tag="HG536_0B03340"
                     /db_xref="GeneID:59324590"
     mRNA            <628515..>630368
                     /locus_tag="HG536_0B03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282251.1"
                     /db_xref="GeneID:59324590"
     CDS             628515..630368
                     /locus_tag="HG536_0B03340"
                     /inference="similar to AA sequence:RefSeq:NP_012167.3"
                     /note="ancestral locus Anc_2.276"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138146.1"
                     /db_xref="GeneID:59324590"
                     /translation="MIKKPSSSVAGRSTGFGYVISVLTLVVLLVLAAYHHLLPLPLGS
                     ELVRTGGSGGDDGSSHNITIVDFFKPFDPAHPTSVPLKDYYRRINLRPLSPYGVASVN
                     FTEWIDEQFEISFEYLLNNVADSNFHNGGLLSQGVAEGVIIASPSKKSPDYFYQWVRD
                     SAITIRSVISNMFILNSTQVYDDVYILNATLAATVLKYVNNSYVLQRLDNLSGDGVKL
                     DQAGQLKGLGEPKWLVDNHPFMESWGRPQNDGPPLRSVAVLHFLDELRQQGLKFSDII
                     DQCNRSKLLKGRLPFKDERELFEKVIYWDLQFVLKNWQADSFDLWEEVNGKHFFTSIV
                     QFAAIRMGLRFLQEHPDYTWDSFDKSALSNALQKCVEQMLQFLTLGAGFLNPNKNFIV
                     ETPSILNSRSGLDIAVIIGSLLTRNYEDNMPFGVNDSGVLNTLYHLVKSMGIIYPINH
                     PKANLNIGVALGRYPEDVYDGVGTSEGNPWFLATCSASELLYQLILESYHAQTDLVIP
                     LNKWESEFWTLIFDGFDDYNRQSYQLVIPWGTPAFTQTMISIFDLGESFLDVVREHVS
                     EGGHMSEQFNKYTGYLQGAANLTWSYGALWKSCHARAQAQTLIGLQSEGDL"
     gene            complement(<630351..>630836)
                     /locus_tag="HG536_0B03350"
                     /db_xref="GeneID:59324591"
     mRNA            complement(<630351..>630836)
                     /locus_tag="HG536_0B03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282252.1"
                     /db_xref="GeneID:59324591"
     CDS             complement(630351..630836)
                     /locus_tag="HG536_0B03350"
                     /inference="similar to AA sequence:RefSeq:NP_012168.3"
                     /note="ancestral locus Anc_2.277"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138147.1"
                     /db_xref="GeneID:59324591"
                     /translation="MIGTDALKAYRCLIRAMVRSDRKSRIAQRMEQRRKEIAMLTYKR
                     MNVVRAQNAATDSMQKTKLFKELQMLNRQVDLLKNEKIEHDKRLHFVGDTSILRENLV
                     ERSDGERPRLLQHLEDIAAFLNNQREYDELIERYNGGSKLSQSETVRRTASKVGLEVP
                     F"
     gene            <631164..>632360
                     /locus_tag="HG536_0B03360"
                     /db_xref="GeneID:59324592"
     mRNA            <631164..>632360
                     /locus_tag="HG536_0B03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282253.1"
                     /db_xref="GeneID:59324592"
     CDS             631164..632360
                     /locus_tag="HG536_0B03360"
                     /inference="similar to AA sequence:RefSeq:NP_014361.1"
                     /note="ancestral locus Anc_2.278"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138148.1"
                     /db_xref="GeneID:59324592"
                     /translation="MTNAYIYIDNYVQLSSAHNPVTLRLVVAENLVYTTEMLRSAIAK
                     RTLATVASTEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSVFEAENLPIDWDRVDIS
                     GLDHEEGVAAAVQSLKRNKVGLKGIWHTSAADQAGKGSLNVALRKHLDIYANVALFKS
                     VPGVRTRIPDVDLVVIRENTEGEYSGLEHESVPGVVESLKIMTEAKTERIARFAFDFA
                     KKYNRQAVTAVHKANIMKLGDGLFRNVVTRVGEQEYPDIRVNSIIVDNASMQTVAKPH
                     QFDVLVTPSMYGTILGNIGAALIGGPGLVPGANYGREYAVFEPGSRHVGLDIKDQNIA
                     NPTAMILSAALMLDHLGLNTSASRISNAVHQVIAEGKTTTPDIGGTASTTEFTEAVIA
                     RLASMS"
     gene            <632841..>634376
                     /locus_tag="HG536_0B03370"
                     /db_xref="GeneID:59324593"
     mRNA            <632841..>634376
                     /locus_tag="HG536_0B03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282254.1"
                     /db_xref="GeneID:59324593"
     CDS             632841..634376
                     /locus_tag="HG536_0B03370"
                     /inference="similar to AA sequence:RefSeq:NP_012169.1"
                     /note="ancestral locus Anc_2.279"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138149.1"
                     /db_xref="GeneID:59324593"
                     /translation="MTSLINEPSTDFHLKLNEQLFHIPYELLRRNVRQVHKLIEKESL
                     VLQGLFKELDGLLKSDDLEQDKIALVKLNEIIRKVEIFEKKINRRSDEELKLLERIHV
                     RLKFFEELEESKASGNVSRLTEWYQKYTNVLIGDYLIRNDQVRSSAEQENSGGDDGSI
                     DDKLWNPGVIFLKQQQLDRLLDYDILLAANRISKSLTQDHDMQPLLHWIGENRTFLKK
                     NCSFLEFEARLQEYVELLKQRDYQGAIGCFQKFLLQFAESNYADLKLASGLLVFINSC
                     QPQQPVRPIDELIDPQIITTNEEDSSAAFRSTSQSSRDEVYEYFFRRKIPNNERRVPV
                     PSVSKLIFKQRNGNRDLARYTDLLDSRRWYTLNELFTKEYYLMYGISHSEPLLMYLSL
                     GISTLKTRECLHEREVPTSDKPELDNYLAKDVLATTCPVCTDEFASIAKDLPYAHHTQ
                     SKLFENPVMLPNGNIYDAKKLKSLASALNNAKLANLKDFEVMDPIDKKIYSEKEFITM
                     YPT"
     gene            complement(<634422..>635381)
                     /locus_tag="HG536_0B03380"
                     /db_xref="GeneID:59324594"
     mRNA            complement(<634422..>635381)
                     /locus_tag="HG536_0B03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282255.1"
                     /db_xref="GeneID:59324594"
     CDS             complement(634422..635381)
                     /locus_tag="HG536_0B03380"
                     /inference="similar to AA sequence:RefSeq:NP_012170.1"
                     /note="ancestral locus Anc_2.280"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138150.1"
                     /db_xref="GeneID:59324594"
                     /translation="MARKLKGKAGHQGLKATLQRHQNLEKLRRLHKRKEENKKLQPSA
                     QVRKNQETQKVNEARFVPFQENETLLLVGEGDFSFTRSLVEQGYMKAENLIATSYDAS
                     PAELELKYPHSFRENYTFLIENKVKIFFKVDATDLIKSFDLSKKKPWSKVLGPSWKQK
                     SLQNIIFNFPHTGKGVKDQDRNIVDHQQLVIGYFRSCKKLFELVNAPVVQSRMSYNQG
                     YDSSERLGGLTSEGYGKIILSVFTGEPYDSWMIKSLAKDCNLCVERSNKFQWNYYPQY
                     HHRRTNSEQDTTKPAQQREARIYVFQKFMLPQAKRKAESDDEA"
     gene            complement(<635595..>636107)
                     /locus_tag="HG536_0B03390"
                     /db_xref="GeneID:59324595"
     mRNA            complement(<635595..>636107)
                     /locus_tag="HG536_0B03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282256.1"
                     /db_xref="GeneID:59324595"
     CDS             complement(635595..636107)
                     /locus_tag="HG536_0B03390"
                     /inference="similar to AA sequence:RefSeq:NP_014360.2"
                     /note="ancestral locus Anc_2.281"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138151.1"
                     /db_xref="GeneID:59324595"
                     /translation="MATTRLRKRYCLLTTQGSNQFWLKFTIKPASTKRKLVATTLAFA
                     LINILSVIWIRKGLSLDRNMGNLLILAIFVSSLLILRRPPVESFTVYRNYGLQVTKVK
                     GLLILPDAWNRRWMAQGKFIPRDQILDIVINEGFVRGFQVVFYLAVIVKESKRLELLF
                     PVCSTCFQQF"
     gene            complement(<636263..>637963)
                     /locus_tag="HG536_0B03400"
                     /db_xref="GeneID:59324596"
     mRNA            complement(<636263..>637963)
                     /locus_tag="HG536_0B03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282257.1"
                     /db_xref="GeneID:59324596"
     CDS             complement(636263..637963)
                     /locus_tag="HG536_0B03400"
                     /inference="similar to AA sequence:RefSeq:NP_014359.3"
                     /note="ancestral locus Anc_2.282"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138152.1"
                     /db_xref="GeneID:59324596"
                     /translation="MSSVVNKSGTRFIPKLKQRRLLSAAPKNDKTTITPEGTRITEEV
                     STTEGDTKVDDSNSRIDNKTDHETDQDTGTTAVSEQDDENPKAPSQLELDPIQTSTQL
                     TSVQGTGGGRRASRLDSLSSNQTAKPVFKPDYLEPTPVMNNRRLSTIAKPNLKKVRIN
                     TIAEKDSTLQALKKRRMSIRTSISKKSGSAHRISVVSRRASPDTDVHTATAVAAPNAS
                     SQLFQKTDSLYEKYTIRNLKEIPKNIQDTDSERYLIDEEEFTMAELCKPKLPIGEISD
                     NFEKAKLAGKAKFEKRRVRRELRRRAREEFKSINSLNEEEEERELEERKKAAEKLLNA
                     EVPESNQGPHTAIQLRLNQDGTMVVDEESTVVDRHKNASYQNAHKVKLNENPFENLHN
                     SGTYGKNMYTDPWTKDELIQFYKALSMWGTDFNLIAQMFPYRTRKQVKAKFISEERRH
                     PVTVELALRSRLPPNFEQYCAETKKDIGTVESFHERIERLKEQHEEHMKAIDEAKANA
                     KEEDAQNTKSSHNPEKKTSGGFRTDQVRAYRKSEIVLGTIDDLKKHPSQQVEEEQNYR
                     "
     gene            <638542..>639687
                     /locus_tag="HG536_0B03410"
                     /db_xref="GeneID:59324597"
     mRNA            <638542..>639687
                     /locus_tag="HG536_0B03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282258.1"
                     /db_xref="GeneID:59324597"
     CDS             638542..639687
                     /locus_tag="HG536_0B03410"
                     /inference="similar to AA sequence:RefSeq:NP_012749.1"
                     /note="ancestral locus Anc_1.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138153.1"
                     /db_xref="GeneID:59324597"
                     /translation="MSRKVTKLAGKKSDKMDDSAVKSVEKSVTAGNESSPAEVYASKA
                     LFKKEKRRLKKEMKRLEQAKEEEKEEDDEEEEVEEEQEEEEGLDLDRLAKSDSDDDDE
                     DEEEEEAEEEEKEEEEEEEEEEEEEEDVALSEVEFDSDADVVPHHKLTTNNVKAMKHA
                     LERIQLPWKKHSFQEHQSVTSQTNTDEGIKDIYDDTERELAFYRQSLDAVQEARDQLA
                     RLKVPFKRPLDYFAEMVKNDEQMDKVKNKLVVEASEKKAREEARKQRQLKKFGKQVQV
                     ATLQKRQQEKRETLEKIKSLKKKRKQSEIDGTGFDVGIEEATDDHSSRKPNYKRAAKD
                     AKYGSGGLKRFKRKNDAQSSADVTDFSHRKMKGKPSRPGKSRRAKRY"
     gene            <639907..>640962
                     /locus_tag="HG536_0B03420"
                     /db_xref="GeneID:59324598"
     mRNA            <639907..>640962
                     /locus_tag="HG536_0B03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282259.1"
                     /db_xref="GeneID:59324598"
     CDS             639907..640962
                     /locus_tag="HG536_0B03420"
                     /inference="similar to AA sequence:RefSeq:NP_012368.1"
                     /note="ancestral locus Anc_1.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138154.1"
                     /db_xref="GeneID:59324598"
                     /translation="MSKESPRAKFLAEFPELVQELKSELVRYGMPAEAIKWYEDSLNY
                     NTPGGKLNRGLSVVDTYAILKGYQSVDELSPDVYKKVALLGWCIELLQAYFLVADDMM
                     DQSITRRGQPCWYRVKEVGDIAINDAFMLEAAIYVILKKHFKQEPYYVDLIELFHDVT
                     FQTELGQLLDLITAPENSVDLSKFSLEKHSFIVTFKTAYYSFYLPVALAMYAAGVSDP
                     QDLKQAHDVLIPLGEYFQIQDDYLDCFGTAEQIGKIGTDIQDNKCSWVVNKALKLASP
                     EQRKILDDNYGRKDAECEARCKKLFRDLNIETHYREYEEKIAQELKDKIAQTDESRGF
                     NADVLTAFLNKVYKRTK"
     gene            <641223..>641510
                     /locus_tag="HG536_0B03430"
                     /db_xref="GeneID:59324599"
     mRNA            <641223..>641510
                     /locus_tag="HG536_0B03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282260.1"
                     /db_xref="GeneID:59324599"
     CDS             641223..641510
                     /locus_tag="HG536_0B03430"
                     /inference="similar to AA sequence:RefSeq:NP_012369.1"
                     /note="ancestral locus Anc_1.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138155.1"
                     /db_xref="GeneID:59324599"
                     /translation="MGGPPSAKTYMGWWGHMGSPVQKGITSYAVSPYAQKPLAGAANA
                     AVFNLFRRFKSQVLYVAIPAGIYWAWWVNSRDYNEYLYTKAGREELERVNV"
     gene            <641903..>644419
                     /locus_tag="HG536_0B03440"
                     /db_xref="GeneID:59324600"
     mRNA            <641903..>644419
                     /locus_tag="HG536_0B03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282261.1"
                     /db_xref="GeneID:59324600"
     CDS             641903..644419
                     /locus_tag="HG536_0B03440"
                     /inference="similar to AA sequence:RefSeq:NP_012750.1"
                     /note="ancestral locus Anc_1.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138156.1"
                     /db_xref="GeneID:59324600"
                     /translation="MPPTERLLVRDHNLDEKAMRESVASSGDSRDGIRDDELYFEPKR
                     VYRRSTDSSSRSSLVRVYSENERANFDQVTGSRIYDDLKHRPIPSDGKIAAETEGRSL
                     VSVGDAQRSRKRRLSLNDGRYGDMQDEYIPDLDFSEAVLHWQSEDSASPAVLSQKLRN
                     DSSNATPTRFPGSITRTNTWSTDREPNSGSVSPNSSYVFDSSHAQVEPIPLPNASNGV
                     SMITPLSASEVSKSITGPGANASDVDPFKHGHLASSFQPRKVSRRKTSVCESYNSASS
                     SLTYLPDNTVSIIAELRMTPEEVLELIGKLPHDFVYMPYSQRKKVILDLIPNKDYKLL
                     MSVIKKLMLKSTRSSVSISKNSLPAAAATAKSRHGSVASQFLSSFSPAGVTSTPSANS
                     VRPDEKGMEIMGYSLGKVIGFGAWGMIRECHNLETGSVKAMKIVRFRNNMKVKNQVLK
                     EVSVWKELHHQNILPLLQWKLNDDYAMYCLTERIHGGTIYDLVISWGEYDTSKIDLVT
                     RCKLTIILCLQVTSALKYMHKKYIAHGDVKLENCLLEKQSEASQWKVFLCDFGMSCHY
                     KHCEAFPVDADSDSEPLTNLPECSYTQLSPYMEKKKIAGHVNEPLPFHRSRSSSGLRH
                     GSRMVKFHKIMKNKKLTHDDTPLGISSLPKTYGPALTSARIGNSSFPSLRQIASQSTA
                     LTPTMDMTSPHQATDEETRAVGPDPHSHIGSLPYAAPELLEPSPPPLGPAADIWALGV
                     TLYTMLTGKLPFKHDYEPRMRAMIASGKFDRKALETVCRVTTEEPDVTRRERQDRPRF
                     TGLYNALMGCLASDLNQRWELDRIETSLKDDLMKLSPLYN"
     gene            <644568..>644984
                     /locus_tag="HG536_0B03450"
                     /db_xref="GeneID:59324601"
     mRNA            <644568..>644984
                     /locus_tag="HG536_0B03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282262.1"
                     /db_xref="GeneID:59324601"
     CDS             644568..644984
                     /locus_tag="HG536_0B03450"
                     /inference="similar to AA sequence:RefSeq:NP_012751.1"
                     /note="ancestral locus Anc_1.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138157.1"
                     /db_xref="GeneID:59324601"
                     /translation="MIYLKSMLKVIDNSGAQLAECIKVLKKGSPKSPARIGDRIVCVV
                     QKAKPLTQNITGTSSTNRVKKGDIVHGIVVRTKQRNMQREDGSTVAFGDNACVLINKN
                     TGEPLGTRIMANDGCVGRELRDKGYNKICSLASRVV"
     gene            complement(<645081..>647240)
                     /locus_tag="HG536_0B03460"
                     /db_xref="GeneID:59324602"
     mRNA            complement(<645081..>647240)
                     /locus_tag="HG536_0B03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282263.1"
                     /db_xref="GeneID:59324602"
     CDS             complement(645081..647240)
                     /locus_tag="HG536_0B03460"
                     /inference="similar to AA sequence:RefSeq:NP_012370.1"
                     /note="ancestral locus Anc_1.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138158.1"
                     /db_xref="GeneID:59324602"
                     /translation="MGSDDDRKPRSQSVKRSRSLTGSLKGIFKGSSWAASSASNQTLA
                     PGTPHEVPPAVVKKNSSRLGNIATSKEAELSSSRGAPVQAPRSPLQAPVGRHGIPSLA
                     KLSLLQSAHASDSDRVSRRSSPNEEETSFRAERSSSERGSDDETRSYVAAQDAEQGDS
                     MLIDSVLENGEQPAKGETNANFPPHQSRGRANSCVSNSLRRIGSSSSSSSSSNKAYAA
                     GRTRADTVSASSLPRFSEMESKCILQVDNFKVFESGLHEHCLKVTSLVADSNDGSEGL
                     TKQKSGFSLSGIFKPHKEDNQLDNALSLIPSTTWSLSQRLDRVRNHALESSEGDINEE
                     DEESANGESTDDRTPRIVNPNAAVGPAELTLINTLSEKIQRGLKGKMGKAEGEEKGKK
                     DGPTTFHEQYGKPIGVIGHGAYGVVKICARPVTAKDVSPLPTYTNGKRLFFAVKELRP
                     KATDQIEKFSTRITSEFIIGHSLSRCHKRGDKLAPNILKVLDLLETQNCFAEVMEFCP
                     SGDLYNLLTRKSKNGSALHPLEADCFMKQLLHGVHFMHSRGVAHCDLKPENILFHPNG
                     LLKICDFGTSSVFQTAWEKQVHFQSGTMGSEPYVAPEEFIHGSEYDPRLADCWSCGIV
                     YCTMVLGNYLWKVAVRSKDALYDSFCTEMAERKEFYVLEEMRHVNNELNRLRRIALYQ
                     IFQVDPIKRVTIADLLQTAWMRRTRCCVLYKSCDREK"
     gene            complement(<647662..>649611)
                     /locus_tag="HG536_0B03470"
                     /db_xref="GeneID:59324603"
     mRNA            complement(<647662..>649611)
                     /locus_tag="HG536_0B03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282264.1"
                     /db_xref="GeneID:59324603"
     CDS             complement(647662..649611)
                     /locus_tag="HG536_0B03470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138159.1"
                     /db_xref="GeneID:59324603"
                     /translation="MERGKSRRFGWKEGVRRHWSIFKQFVILRRKELFRTYVLVPIGV
                     LLVMCLLYGVDRLIKNCIKVTFPASVAVMLINFAFMSVLAAFKKPYVEFYLGVIDVPL
                     SWALRWMNVFFTPAFVTLPLSPWISCKEALLIVAVFLIGYLVAFVLLAYITVLGQKVT
                     GSLRLRSVFVRQEELHNGMENGSRFAPASQYKGNDSISSSNVAIDKEAPAGEENRDSS
                     SVQVFFGDSNGLDFHDPLVNLASNSGLSLSYVNSRATSSLGSEMLPKHEYSHHDDDNI
                     NEAEDMIQIGSSRRATASAPPNIRHGGTGLLQRLQPARHKNIETSSAVTVDSSDSRSI
                     CQRAITRQYSRQIDFHFSINMWDAHLHHVLYALGFFATIFTYYFQWYTTPFHFFTAVC
                     MFMIITDSPFIVNRPRLKRLAHPVICSVALTWLVMLISVMIKHREVVFFLRELKSYKT
                     GRTYLHLFDPSYGYHQWPGAGDIFSSCMDVSIVGLSLPMYTYRKDLKKHFFSMVPPIL
                     LFTAASLLLYPLICYNIGISSLRSIGFAGRSVTLALGGPMISNLGGDQTVMAVTTVMS
                     GVVGALTGGRMLDFIRVPEEDYVTRGLALGCNCGAIATAYLLGVDRRAAAISSLSFVF
                     YGALMVILSAIGPIKQFVHQLVGLN"
     gene            complement(<651649..>652044)
                     /locus_tag="HG536_0B03480"
                     /db_xref="GeneID:59324604"
     mRNA            complement(<651649..>652044)
                     /locus_tag="HG536_0B03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282265.1"
                     /db_xref="GeneID:59324604"
     CDS             complement(651649..652044)
                     /locus_tag="HG536_0B03480"
                     /inference="similar to AA sequence:RefSeq:NP_012754.1"
                     /note="ancestral locus Anc_1.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138160.1"
                     /db_xref="GeneID:59324604"
                     /translation="MSSVAKQLKFLNKISSTTKQAQILLDATKYSGVKLTFQVENHHG
                     HMGARKFWREYLPTLQFYNPNFRIDVIRIKNENTKFAGVPCTLEIVSNEDKVIKHIDM
                     RNKTDDIIMKEFLEKVEHEPVPEESLVKV"
     gene            complement(<652234..>653466)
                     /locus_tag="HG536_0B03490"
                     /db_xref="GeneID:59324605"
     mRNA            complement(<652234..>653466)
                     /locus_tag="HG536_0B03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282266.1"
                     /db_xref="GeneID:59324605"
     CDS             complement(652234..653466)
                     /locus_tag="HG536_0B03490"
                     /inference="similar to AA sequence:RefSeq:NP_012371.2"
                     /note="ancestral locus Anc_1.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138161.1"
                     /db_xref="GeneID:59324605"
                     /translation="MYVDPQRNNRVRNLSLPTVQKREEIMSGHESGNSKCSGEQQHEH
                     LTLKKLTEQIREAEKNREAHNKEHSEAGTEGVLQKKAADPIMRGRPTSGKYCLNDFQI
                     LRTLGTGSFGRVHLVRSNHNGRFYALKVLKKRTIVKLKQVEHTNDERRMLSIVSHPFL
                     IRMWGTFQDSEQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHAND
                     IIYRDLKPENILLDRNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVISTKPYNKSV
                     DWWSFGIYIYEMLAGYTPFYDANAMKTYENILNAELKFPPFFNHDAQDLLSKLIERDL
                     SKRLGNLQNGSADVKNHPWFSEVVWEKLLSRNIETPYEPPIQQGQGDTSQFDRYPEEE
                     INYGVQGEDPYCDLFKEF"
     gene            complement(<654019..>655728)
                     /locus_tag="HG536_0B03500"
                     /db_xref="GeneID:59324606"
     mRNA            complement(<654019..>655728)
                     /locus_tag="HG536_0B03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282267.1"
                     /db_xref="GeneID:59324606"
     CDS             complement(654019..655728)
                     /locus_tag="HG536_0B03500"
                     /inference="similar to AA sequence:RefSeq:NP_012372.1"
                     /note="ancestral locus Anc_1.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138162.1"
                     /db_xref="GeneID:59324606"
                     /translation="MVKEGSPLLSASDTATRSSRMDDQNGSREIVDEGFEYVAEQTGL
                     AFFESLMTDEPQAGETEEMRWLREVRLRHKHMNWFQRPSLAILCSLVMLVCLGETLCI
                     TPMIGLTMKKVCEGIAMHHGESGKSADDVQCDPQEVQSVMSVISSFTMILTGLACTFT
                     SGTWGEFSDRAGRVRIFGYMALVRVIGNSLHFWALLPSTPYHKWLIILAGSVSSLSGG
                     MLALLANANSYISDIVEADHRALSMSIMMSAVYATMGLGPMLGSVLVKNFGGGDRLPI
                     YLSIAIGLLAAILCFTSVREPRHEEALKLSQATFVERRDSISSIRSDTTRISARLATY
                     GRYHLLRLLDVFSSVKTLWLNPTADGSVVPRYTVLMLVALDIFFLSMTAAAMPALVLF
                     ATYQYGWRSVELGYFISISGLGRAAVLLVISPCLLHVLRRFYKPLNHSIDRIDVTCIK
                     ISLVLLTCSVAAVLVGKEHEAALFTCAVLQALSAFCSPTIQSAIIKYCSKKFTGRCFG
                     AMALIRSSVMLIVPPILLRIYGTTVSFKPELFLYIPLTCGICAIILSNFLHIIDDATA
                     VPK"
     gene            complement(<656122..>658881)
                     /locus_tag="HG536_0B03510"
                     /db_xref="GeneID:59324607"
     mRNA            complement(<656122..>658881)
                     /locus_tag="HG536_0B03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282268.1"
                     /db_xref="GeneID:59324607"
     CDS             complement(656122..658881)
                     /locus_tag="HG536_0B03510"
                     /inference="similar to AA sequence:RefSeq:NP_012756.1"
                     /note="ancestral locus Anc_1.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138163.1"
                     /db_xref="GeneID:59324607"
                     /translation="MWGKHRITFIAVGVFFHLFYLWSIFDIYFVSPLVHGMNQYRSTE
                     KPPAKRLFLIVGDGLRADTTFDMITHPTTGKTEYLAPYIRSLVLNNGTYGISHTRMPT
                     ESRPGHVAMIAGFYEDVSAVTKGWKENPVDFDSFFNQSTHTYSFGSPDILPMFKEGAS
                     DPNRVDTWTYGHEFEDFTQSSIELDAYVFRHLDQLFRNSTRNLTLDAEIRQEGNVFFL
                     HLLGCDTAGHSYRPYSAEYYDNVKYIDDQVALLSDKVRNFFGDDDTAFIFTADHGMSA
                     FGSHGDGHPNNTRTPLVAWGAGLNKPVLNEVPVFDNYTFTWGLENVQRHDVKQADIAS
                     LMSYLIGVNYPANSVGELPLAYISGQEVDKLHALYNNARSILEQYIVKEKEVIESQFT
                     YKEYHKFARRPYQKYLSQIELLIEKIASGEAELTAEAITITEDLIKTTLEGLHYLTTY
                     NWRFIRTIVTFGFAGWITYAFVIFLKFYILENASNYQTSSCNLFVFGTLGCCLNWVLY
                     YQRSPFNFYMYLLFPLYLWSQIFTNLSILRDGTQEFLKGISFTRRIVVAAAIFAVYEG
                     IVYGFFHRWIFTVILNVLAFYPIFCGISASYTLMGWIITSILLSTFTLYDAVKTESLT
                     QINSAGLLMVLTSAYGLKKVSKDIGRYTSAVLWAQVTLIPTMLLVTQKSVTSLQNRQG
                     LPHDSQLAGWLIMGMSLVVFPSLHYLRPNSNYKVRLLAIYLTFAPAFIILTISFEALF
                     YVIFTCYIVQWIEIESQIKQLKSHDNYQQLLRVALVGFFLLQVAFFGTGNVASISSFS
                     LDSVYRLLPIFDPFSMGALLMLKLIVPYVLLSIGLGVLNLKLDIKDYTISALIISSSD
                     ILSLNFFYLLKTEGSWLDIGITISNYCLAILSSLFMLILEVIGHILLKNVTITRPVST
                     TKKQS"
     gene            complement(<659068..>660777)
                     /locus_tag="HG536_0B03520"
                     /db_xref="GeneID:59324608"
     mRNA            complement(<659068..>660777)
                     /locus_tag="HG536_0B03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282269.1"
                     /db_xref="GeneID:59324608"
     CDS             complement(659068..660777)
                     /locus_tag="HG536_0B03520"
                     /inference="similar to AA sequence:RefSeq:NP_012373.2"
                     /note="ancestral locus Anc_1.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138164.1"
                     /db_xref="GeneID:59324608"
                     /translation="MSSSPDILLDLTTHYSILGLSSDATESDIHKSYMKLARLLHPDK
                     SKSDASAEQFKLISHAHYVLMDKEQRSKYDKTLHTKGLWGYLPKGNFYRHARAAQKDG
                     KHAKQAQKTQQAANHRQPYEQQPYGFGTENSRTAHPHPKVPIFQSFNLKNYQRKQRSA
                     QERTPDEPNAPASFKMFTHRTSHEAPEDIVVNEPKDASSRSTEKAVDQGRTRSYAGEA
                     EFTGNSNEDSRKKEEREEGEEELEVENLRWKMHKADTSYTSDGAPDSPFSDNQHRHYA
                     RKKHEATLRGRRSASPVKSIPTTDTPGMSESWSGLKNILNNFPSKEANIQHNNQKHAK
                     EEKELLTSLRSSSLKARKGYGGNIGLEDLSSSLPPNDDFFDMHQVSDILDDVHTVKRT
                     KRASFATESSDIEMKSPPKSQISRLQVKNSAYSSHTSRTLHMPVNEPLPKIYKKDIIA
                     MDQYKINSQVAQLELPQMPIFQCNLLDSNEVEHCKRSVIEFNARCNALKQNLLAIMHD
                     RLNADQALDERLVKIENAANWVSCKDFDFEVVNKLSELQNRQRIVAQSFLSLLKSLYA
                     TGH"
     gene            complement(661118..661189)
                     /locus_tag="HG536_0Btrna3E"
                     /db_xref="GeneID:59324971"
     tRNA            complement(661118..661189)
                     /locus_tag="HG536_0Btrna3E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59324971"
     gene            <661937..>662494
                     /locus_tag="HG536_0B03530"
                     /db_xref="GeneID:59324609"
     mRNA            <661937..>662494
                     /locus_tag="HG536_0B03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282270.1"
                     /db_xref="GeneID:59324609"
     CDS             661937..662494
                     /locus_tag="HG536_0B03530"
                     /inference="similar to AA sequence:RefSeq:NP_012374.1"
                     /note="ancestral locus Anc_1.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138165.1"
                     /db_xref="GeneID:59324609"
                     /translation="MRPSLFRLQSVGINGAKSTSGMGKGIPSQKVPFYASKKNVAINC
                     VITFLYGYGLYAFYKDYQTAKRFAVRKLSKPDPDVSPYYLERVEDIHNAPNRLFHSEH
                     EDKEVERSTMRRVIHSLTYGDVSQCAVAWGFLIQLCNTTHAVYGTKSMLFRTSLLSVV
                     GFPPLLYYLYRMRLFNLEKKGVIIN"
     gene            complement(<662678..>663565)
                     /locus_tag="HG536_0B03540"
                     /db_xref="GeneID:59324610"
     mRNA            complement(<662678..>663565)
                     /locus_tag="HG536_0B03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282271.1"
                     /db_xref="GeneID:59324610"
     CDS             complement(662678..663565)
                     /locus_tag="HG536_0B03540"
                     /inference="similar to AA sequence:RefSeq:NP_012375.2"
                     /note="ancestral locus Anc_1.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138166.1"
                     /db_xref="GeneID:59324610"
                     /translation="MQYKKTLAATTLATAVIGSYVPSEPWSTLTPSATYSNGITDYSA
                     NFGIAVKPFATSSIAKRDAVSQIGDGQIQATTATSAAAVSQIGDGQIQATTAPAVSQI
                     GDGQIQATTAPAVSQIGDGQIQATTAPAVSQIGDGQIQATGTTTLAPISQIGDGQVQA
                     TTTGAASQISDGQVQATTSASINYNKGNSSDPVKLKSCKNDGTLQMTLKGGILTDGKG
                     RIGSIVSNRQFQFDGPPPQAGAIYAAGWSITPAGNLAIGDEDTFYQCLSGNFYNLYDQ
                     SLGEQCHPVHLEVIDLVNC"
     gene            <664599..>665687
                     /locus_tag="HG536_0B03550"
                     /db_xref="GeneID:59324611"
     mRNA            <664599..>665687
                     /locus_tag="HG536_0B03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282272.1"
                     /db_xref="GeneID:59324611"
     CDS             664599..665687
                     /locus_tag="HG536_0B03550"
                     /inference="similar to AA sequence:RefSeq:NP_012376.3"
                     /note="ancestral locus Anc_1.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138167.1"
                     /db_xref="GeneID:59324611"
                     /translation="MQYKKTLATAALASGALAAYVPSEPWSTLTPSATYSNGITDYSA
                     SFGIAVKPFATSSIAKRDAVSQIGDGQIQATTATTAAAVSQIGDGQIQATTAPAVSQI
                     GDGQIQATTAAAVSQIGDGQIQATTATTTAAAVSQIGDGQIQATTAPAVSQIGDGQIQ
                     ATTAAAVSQIGDGQIQATTATTAAAVSQIGDGQIQATTATTNAVSQIGDGQIQATTAT
                     TNAASQIGDGQVQATTTTSGASQVSDGQVQATGSSSSSSNAVKAVSCKNDGTLQMTLK
                     GGILTDGKGRIGSIVANRQFQFDGPPPQAGAIYAAGWSITPAGNLAIGDEDTFYQCLS
                     GNFYNLYDQSLGEQCHPVHLEVINLVDC"
     gene            complement(<666067..>666777)
                     /locus_tag="HG536_0B03560"
                     /db_xref="GeneID:59324612"
     mRNA            complement(<666067..>666777)
                     /locus_tag="HG536_0B03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282273.1"
                     /db_xref="GeneID:59324612"
     CDS             complement(666067..666777)
                     /locus_tag="HG536_0B03560"
                     /inference="similar to AA sequence:RefSeq:NP_012377.1"
                     /note="ancestral locus Anc_1.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138168.1"
                     /db_xref="GeneID:59324612"
                     /translation="MQLKNVALVSAACLASNVCADGYTPGQEWSTLTPTATYKCGITE
                     YASSFGLAVQTISSSMAKRDAVSQIGDGQLQATTTGVSQIGDGQLQATTTAAPQATGS
                     QSQQSLSEATTTLSPSSAAASNSACATQPVTLDSSSCKNSGTLTVQLKGGVLTDGKGR
                     IGSIVANRQFQFDGPPPQAGAIYAAGWSITPGGNLALGENDVFYQCLSGNFYNLYDQS
                     IGEQCHPIHLELVNLVDC"
     gene            complement(<667449..>669929)
                     /locus_tag="HG536_0B03570"
                     /db_xref="GeneID:59324613"
     mRNA            complement(<667449..>669929)
                     /locus_tag="HG536_0B03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282274.1"
                     /db_xref="GeneID:59324613"
     CDS             complement(667449..669929)
                     /locus_tag="HG536_0B03570"
                     /inference="similar to AA sequence:RefSeq:NP_012378.1"
                     /note="ancestral locus Anc_1.190"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138169.1"
                     /db_xref="GeneID:59324613"
                     /translation="MSLKTPTQPNTEKKVHTPPSIGRDPGKPKLLKSLSGKVFKRSSN
                     SDSDTLPSSGLFVPAPSLSSRYPLPKPLNIPQPLSPPPSVKKTCQWSPGSRSSFPHTA
                     QGNRSHDVLESPIQLAPSLKIQALEKPLDSFNLTTAFNSAYRSEQGREVSPHDNTIIW
                     TDTLDDPYLEEDSPTYLTSISQNISKTSAKAGHRTFIGLRCSMCDEKICNTLSGEKIT
                     ELTCSHASHYQCYLATLECLQPAKRYPECRICGKTVKPSDKSTWEKMVTHLLSRKGSY
                     DCSETVVEPQLLYSKQPTTASQHAFFTPGEQIIRTADISSSGFRTPYGPLRSASDACW
                     NTCTESYDALFQHSIWLEETLLGDDGQADPKGDEGHDASGLGPQIEVLAGRRDSEYGI
                     TVRVPKESGRESHQTQECDDFASQREALKQRIEESVKDELDNDTQLGSLVMFDRGDFS
                     TDGERWNKDVTLYLFDQFLILFDRQALTVSGKIPLGQICQVLKLDESTLLIDLKSRTL
                     PQMYMSFPPKGMKNSQLEKWRFYLGHIGSGPSLEDITRTCWDVLPEELVGELNAFFEQ
                     ANESTADAGLALSKPWETLQTHVPLQLIVCLSLSNDSGMKNEDYQHSIIKLLKCLLNA
                     LNDDDLLGLVAVGKDGRGNIGRFGTFFGTVNKHWPYWNEAFSDLEASKHRIFDSADSE
                     LDKMLETCLRLVSTAESMLEQDKSAQFSKQVILLRDGTPAKNDHKYGRLITEVHNFNL
                     MQIQSINSLSQDELTSVIDILHRSYLRNLTVTYANEKLLFGNMAPGAEKKLPFKLDHE
                     SIPESCEISWIDSRTQEANVVTTQVTNI"
     gene            complement(<670325..>672418)
                     /locus_tag="HG536_0B03580"
                     /db_xref="GeneID:59324614"
     mRNA            complement(<670325..>672418)
                     /locus_tag="HG536_0B03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282275.1"
                     /db_xref="GeneID:59324614"
     CDS             complement(670325..672418)
                     /locus_tag="HG536_0B03580"
                     /inference="similar to AA sequence:RefSeq:NP_012379.2"
                     /note="ancestral locus Anc_1.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138170.1"
                     /db_xref="GeneID:59324614"
                     /translation="MLKGIFGSSKKKPGKSSDSNSETQSNAADHGSIPGAIAEPQAQG
                     QRDGSERAPSTYDFSSSRAASSLASSSVFSKGRHTSGTGASSSTGSTYGRKSVGALGS
                     ELDDVGKPLRVVNSEKFNYLNPVFEEEGPNEGSVPAGENTHATQGLQPSQARQRRADS
                     LSRNTRSLELVKNELNILEDNLVGLMDDIHQNVTSISKAVIQAIEYFKQFLPTVNVKL
                     SFNLTFERSSSLRAITKIFLHFMDNLLMSEAFGNSRSILMRRYIYFLEKLNISTPADF
                     ASESQLAPCLNNFCIDSTCTLPNRDNISRIIEEISKSDPSLVADQDGAFMAPVLRGLT
                     RKSAILTVMFGVPNPQQEHQEIVKALYSVMPDVHFYCVKDYIQPCAEVLNTVAKPMSA
                     STPLAAPPSTFQFSPPYRLAPDALKPPISMSLSSDQSSKTTGTLGGYLFPQIEKGSKL
                     SQFAGASFAITCSHVVLSESQDYPYVSIPSKVLQTTYRKTLSEESHRYPEDSVEHKAF
                     QEEIRRVDENMKWQEQNKFGQVVWGERSIVNQKLSDFAIIKVGQQYKCENCLGIGLTG
                     VPDPTLRFQNMYVKEKILKLRPGLQVFKIGAATNYTSGSVNAAKLVYWADGKLQSSEF
                     VVSSPMPLFASAGDSGSWILTKLENRLGLGVVGMLHSYDGEQRQFGLFTPIGDILERL
                     HTVTGVLWDIDAAPT"
     gene            complement(<672648..>674000)
                     /locus_tag="HG536_0B03590"
                     /db_xref="GeneID:59324615"
     mRNA            complement(<672648..>674000)
                     /locus_tag="HG536_0B03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282276.1"
                     /db_xref="GeneID:59324615"
     CDS             complement(672648..674000)
                     /locus_tag="HG536_0B03590"
                     /inference="similar to AA sequence:RefSeq:NP_012380.1"
                     /note="ancestral locus Anc_1.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138171.1"
                     /db_xref="GeneID:59324615"
                     /translation="MGFYTVSNVEDMRICVVMVGLPARGKSFISQKIVRYLSWLSIKA
                     KCFNVGTYRRKVGPAHPDADFFDPSNKEGSQVRQNAVTEAVKDMMAWFSEENGVVAIL
                     DATNSTKERRRWVLKLCRENAIEPMFLESWCDDKELILRNISDVKTSSPDYEGIDPEV
                     ATKDFLRRISNYEKVYEPLDSDCDKDLTFVKLINVAQEVIVNGIQSYLESRVVFYVMN
                     LHIRPRCIWLSRHGESVYNVEKKIGGDSSLSPRGLQYAEKLPEIVRKSAGDVNLTVWT
                     STLCRTQQTAQHLPYKQLQWKALDELDAGVCDGMTYEEIEEKYPEDFKARDDDKYEYR
                     YPGGESYRDVVIRLEPIIMELERQENILIVTHQAVLRCIYAYFMNVPQEESPWMSIPL
                     HTLIRLEPRAYGTEVTRIKADIPAVSTYKEKGTSKLGESSSDATAKFRNLLNGAPPSA
                     "
     gene            complement(<674342..>677068)
                     /locus_tag="HG536_0B03600"
                     /db_xref="GeneID:59324616"
     mRNA            complement(<674342..>677068)
                     /locus_tag="HG536_0B03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282277.1"
                     /db_xref="GeneID:59324616"
     CDS             complement(674342..677068)
                     /locus_tag="HG536_0B03600"
                     /inference="similar to AA sequence:RefSeq:NP_012381.1"
                     /note="ancestral locus Anc_1.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138172.1"
                     /db_xref="GeneID:59324616"
                     /translation="MSYSETLEQALSTVKQQAVLMQRCLQQRRLMDALRHTSIMLTEL
                     RNPELYPKPYYELYILIFDSLSILSTYLVENHPKHHHLADLYELVQYAGNVVPRLYLM
                     ITVGSSYLKCAESPSEEILKDMIEMCRGVQNPIRGLFLRYYLSQRTKQLLPQGAVDFN
                     VNFIVTNFIEMNKLWVRLQHQGPLREREQRTKERRELQILIGSQLVRLSQIVDDNLSL
                     YKEQILPVMLEQVIQCRDAVSQEYLLDAICQVFPDEFHLATLDALLEATTRLNPEVSM
                     NKIVLTLIDRLNGYKDRTEQEGTKNGGASLRDLNLFQNFWNYLSNLNEERPDLPLQHF
                     IPLIESVMTLSLQWYPQNLQNLDALYRFTAQKCQDYGKEVPANAEYLFQNLLTLQNNA
                     ALSKLDANFYYKLITQCASYRDLLGLQNVLPQKSILNSILEVLLQHTPLPGGESAAEN
                     QSDASSVERGFTVATKVDLDNLLSIFEPLIKASSPDILPDRKAVNKALANDDVADEDE
                     NSWILDLTQENLAKLSHIIMRSVSQSGDPIENIQLEVEILLSLRNWLYKGGKNIKYTY
                     PAIITNFWKLIRKCHLLRNRDSQNEKQYSEFVKQFFKYVSRSINDLYNVCGSPLADAL
                     YKLNIQSASLADQLSLGEIAYDFLSQAFTLFEESLSDSRTQFQALVYMAQSLQKTRSL
                     HEESYYELLIVRCTLHGSKLLKKQDQCRAVYLCSHLWWATEIALIGEEEGVTSDFYRE
                     GKRVLECLQRSLRVADSTMDNVQSSELMIEILNRCLYYFIHGDERETHISVKYINGLI
                     ELIRANIKSLKMEETTSSTIQLAEHRLDELHIHNAEGTAKEGNRFVIGLDGSYIDVPT
                     GNGGRASVTSKLNSIHLNEMIQIPVQHFNRTCEYIQNQRDVDDRFKVITLGG"
     gene            <677674..>678741
                     /locus_tag="HG536_0B03610"
                     /db_xref="GeneID:59324617"
     mRNA            <677674..>678741
                     /locus_tag="HG536_0B03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282278.1"
                     /db_xref="GeneID:59324617"
     CDS             677674..678741
                     /locus_tag="HG536_0B03610"
                     /inference="similar to AA sequence:RefSeq:NP_012992.1"
                     /note="ancestral locus Anc_1.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138173.1"
                     /db_xref="GeneID:59324617"
                     /translation="MASVFGRAVSRSSVLLVGAAAAATSLATSIALNNDNGTFSSRNH
                     SNKNNKNGWSKTGVLLGASPALHLAKAQDGKSLEDFQKVYNAIAEKLRDEDEFDGYIG
                     YGPNLVRLSWHVSGTFDKNDNSGGSFGGTYRFKKEADDPANKGLQNAAHFLEPIAKKF
                     PWISHGDLYTLAGVTALQEMQGPKIPWRPGRVDADEKDTPENGRLPDASQDGSYVRHY
                     FGRFGFTDQEIVALLGAHCLGKTHLENSGYEGPWGAATNTFTNEFFVNLLNENWKLEK
                     NEAGNKQYNSEKGYMMLPTDYALVQDGKFRKYVEKYAKDQDAFFEDFKSAYVKLLENG
                     IDFGKLGKAYVFKTLDEQDSN"
     gene            complement(<678797..>680389)
                     /locus_tag="HG536_0B03620"
                     /db_xref="GeneID:59324618"
     mRNA            complement(<678797..>680389)
                     /locus_tag="HG536_0B03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282279.1"
                     /db_xref="GeneID:59324618"
     CDS             complement(678797..680389)
                     /locus_tag="HG536_0B03620"
                     /inference="similar to AA sequence:RefSeq:NP_012382.2"
                     /note="ancestral locus Anc_1.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138174.1"
                     /db_xref="GeneID:59324618"
                     /translation="MTVQKYFTPSIKVETDKCRFTETELTTQYRYVNSHVSKNESNGS
                     IEVNLSEQDYEFKVDLRLPKLGVMLVGLGGNNGTTFVASVLANKNKVKFHTKDGLKEA
                     NYFGSVTQSSTIKLGIDSEGNDFYVPFNSLVPFVSPNDFVVGGWDINKANLSDAMARS
                     QVLEYDLQRRLGEEMSKMVPLPSIYYPDFIAANQDERADNCINRDPKTGKVSTAGKWS
                     HVEQIRSDIQNFKRQNDLDKVIVLWTANTERYADIVSGVNDTADNLLAAIKGDHEEIA
                     PSTIFAVASILEGVPYINGSPQNTFVPGVVDLAEKSGSLIAGDDFKSGQTKIKSVLAQ
                     FLVDAGIKPVSIASYNHLGNNDGFNLSSERQFRSKEISKKSVVDDVIASNQILYNEKL
                     GNKVDHCIVIKYMNAVGDSKVAMDEYYSELMLGGHNRISIHNVCEDSLLATPLIIDLI
                     VMAEFCSRVTYKKLNAGEQSYESFYSILAFLGYWLKAPLTRKGFKTINGLNKQRQGLE
                     SFLRLLIGLPALDELRFEERLK"
     gene            complement(<681040..>684381)
                     /locus_tag="HG536_0B03630"
                     /db_xref="GeneID:59324619"
     mRNA            complement(<681040..>684381)
                     /locus_tag="HG536_0B03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282280.1"
                     /db_xref="GeneID:59324619"
     CDS             complement(681040..684381)
                     /locus_tag="HG536_0B03630"
                     /inference="similar to AA sequence:RefSeq:NP_012643.3"
                     /note="ancestral locus Anc_7.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138175.1"
                     /db_xref="GeneID:59324619"
                     /translation="MTSIYRSTEPTVSTFNSPHYEPQLVEGVSSVLIVGSGGLSIGQA
                     GEFDYSGSQAIKALKEANKKTILINPNIATNQTSHSLADTIYYLPVTPEYITYVIERE
                     RPDAILLTFGGQTGLNCGVALDKMGVLEKYNIKVLGTPIKTLEMTEDRDLFAQALQEI
                     NIPIASSIACETLEEALSAADEVGYPVIVRSAYALGGLGSGFANNAGEMRELASQSLS
                     LAPQILVEKSLKGWKEIEYEVVRDRVGNCITVCNMENFDPLGIHTGDSIVFAPSQTLS
                     DQEFHMLRSAAIKIIRHLGVIGECNVQYALQPDGLDYRVIEVNARLSRSSALASKATG
                     YPLAYTAAKIALGYTLPELPNPITKTTVANFEPSLDYIVAKIPRWDLSKFQYVNRDIG
                     SAMKSVGEVMSIGRNFEEAYQKALRQVDPSLLGFQGSDEFGDKLDEALAVATDRRALA
                     VGQALLHENYTVERVHELTNIDSFFLHKCMNIVNMYKKLEAVNSLESLDKDLLQKAKK
                     LGFSDKQIALSISKGASCSVNELDVRKVRKQFGIIPFVKRIDTLAAEFPASTNYLYTT
                     YNATKNDVEFTDKGMLVLGSGVYRIGSSVEFDWCAVNTAKTLRNEGKKTVMINYNPET
                     VSTDFDEVDRLYFEELSFERVMDIYELENSEGCVISVGGQLPQNIALKLFENGCNTLG
                     TNPVDIDSAENRHKFSSILDSIDVSQPEWSELTSVDEAKSFANKVGYPVLVRPSYVLS
                     GAAMNTIHNEHELEDKLTLASAVSPDHPVVISKFIEGAEEIDVDAVAYNGKVLVHAIS
                     EHVENAGVHSGDATLVLPPQHLSEQIKNKLKEIADKVAHAWKITGPFNMQIIKHNDDL
                     KVIECNIRASRSFPFVSKVLGVNFIEIAVKAFLGGDKVPQPVDLMSKQYGYVATKCPQ
                     FSFTRLAGADPFLGVEMASTGEVASFGKDEIESYWTAIQSTMNFHVPLPPSGILFGGD
                     LTKPWLGEVISTISSLGFNFYVADESAKKYLQEYTNDHITVIEFPKNDKRALRELFQK
                     YDIKLVINLASKRADNTDDDDYVMRRNAIDFAIPLFNEPQTCKLFAKALKAKIAEKVR
                     VLESNDVVVPNEVRSWEDFVGFKPV"
     gene            <685233..>686048
                     /locus_tag="HG536_0B03640"
                     /db_xref="GeneID:59324620"
     mRNA            <685233..>686048
                     /locus_tag="HG536_0B03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282281.1"
                     /db_xref="GeneID:59324620"
     CDS             685233..686048
                     /locus_tag="HG536_0B03640"
                     /inference="similar to AA sequence:RefSeq:NP_009503.1"
                     /note="ancestral locus Anc_7.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138176.1"
                     /db_xref="GeneID:59324620"
                     /translation="MKIFGGSDSYKFEEAAELCVQAANIYRLRKELTLAGDALTKAAG
                     YQIKAGNDDEAGNTFVEAYKSYKSSGQASEAIKSLNGAIEIFTTRGQFRRGANFKFEM
                     GELLENDLKDYAKAIDCYETAGEWYSQDQALALANKCLVRCADLKALDGQYLDASEVF
                     AKLIKNSMGNRLSQWSLKDYYFKMGLCQLAATDSVAASRTLQEGKREDSNFADSREAQ
                     LLQDLVQCVADGDAEQLSEKVFNFDKFNKLDKWKTTILLKIKETISQADDDLL"
     gene            <686702..>687178
                     /locus_tag="HG536_0B03650"
                     /db_xref="GeneID:59324621"
     mRNA            <686702..>687178
                     /locus_tag="HG536_0B03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282282.1"
                     /db_xref="GeneID:59324621"
     CDS             686702..687178
                     /locus_tag="HG536_0B03650"
                     /inference="similar to AA sequence:RefSeq:NP_009504.1"
                     /note="ancestral locus Anc_7.492"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138177.1"
                     /db_xref="GeneID:59324621"
                     /translation="MGLRYSSYIECPTAKFEGDSLGSSPGSYLTPYHQISDARRFQYH
                     GSYRSREGSDLSNSKFVTYGCRRCRTHLSSSTQIMSKDYRGKTGDAYLMTKVVNVIEG
                     SVETRPMITGDYLVCDILCHWCKSLLGWKYLESERKDQRYKEGKYILEVQTICRCD"
     gene            <687725..>689734
                     /locus_tag="HG536_0B03660"
                     /db_xref="GeneID:59324622"
     mRNA            join(<687725..688065,688408..>689734)
                     /locus_tag="HG536_0B03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282283.1"
                     /db_xref="GeneID:59324622"
     CDS             join(687725..688065,688408..689734)
                     /locus_tag="HG536_0B03660"
                     /inference="similar to AA sequence:RefSeq:NP_012644.1"
                     /note="ancestral locus Anc_7.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138178.1"
                     /db_xref="GeneID:59324622"
                     /translation="MEYIKIAKVNNVLVHRRGAVTRGTLHLTTHHLILTSLSLSREFW
                     VSYSTIASVFKNHGSALISKTNQHSDSRDGRVGELYNGRDLWSFINIKVICKDYTIFS
                     IDFSDELEAHDVAAQPLPGLTKQRSVQDERLVFEIFQTSKDGTDQTPQRNMIIDARPT
                     ANAIGQAALGGGSENMDNYNFDKTCSRTFLGIDNIHVMSDTLNYMVENFLVDGDLNLP
                     IDKAALNSGKSASWLKHIKLLLSSTDTLVKSIIFNKSNLLIHCSDGWDRTAQVCSLVQ
                     LCLDPYFRTLEGFMVLVEKDWLSFGHRFQERSGLLSSENVFHDNTMGFSGLSHYSGHT
                     DLTSSTSLFGKDGNELSETEGLVNMTANSVLNSDIVSKVSEHFKRRNKNKRILKFTSP
                     IFQQFLDCVYQLLIQSPSSFEFNERFLRRLIYHVYSCQYGNFLYNSEKERVEFEVSSK
                     TRSVWDYFRSRKGEFTNKDYHPSVPSSDLCDEVTWILPNLHEVEWWWQLYGRKYDELN
                     GVAASTLSVNGTECSGHSKNIRAAEKEPPKGLSMKFPTFGLELFGKR"
     gene            complement(<689853..>690686)
                     /locus_tag="HG536_0B03670"
                     /db_xref="GeneID:59324623"
     mRNA            complement(<689853..>690686)
                     /locus_tag="HG536_0B03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282284.1"
                     /db_xref="GeneID:59324623"
     CDS             complement(689853..690686)
                     /locus_tag="HG536_0B03670"
                     /inference="similar to AA sequence:RefSeq:NP_012645.1"
                     /note="ancestral locus Anc_7.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138179.1"
                     /db_xref="GeneID:59324623"
                     /translation="MVSLLNAQRLVSLAQFDPKLKNIWYLIAAVTFSVCNQPQEIPKL
                     YHYALLLNSEGEKNDVGSLADRTIDMLRNEKLALRTSIDELYPQPSALQRQLTERFRE
                     AFMKSGPLGGLPKAINVLTQLKEVTPTKLLPSTQEIDPFAAASGGQSCYESVGRAREN
                     PEKTTRRGLEHWNQIYSKVSKRVANNLNTCYPDLWYYTLAHVYGPLLSYDEILSAQET
                     NLIIIASLVPQDVSPQLRGHLKGALNLGCDRETVDAARNLAILVSGWCGIALKSDAVK
                     L"
     gene            <690845..>691453
                     /locus_tag="HG536_0B03680"
                     /db_xref="GeneID:59324624"
     mRNA            <690845..>691453
                     /locus_tag="HG536_0B03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282285.1"
                     /db_xref="GeneID:59324624"
     CDS             690845..691453
                     /locus_tag="HG536_0B03680"
                     /inference="similar to AA sequence:RefSeq:NP_012646.3"
                     /note="ancestral locus Anc_7.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138180.1"
                     /db_xref="GeneID:59324624"
                     /translation="MTSDAKIRYLRLNQVFNKALGQSISKLESWEKVSSCFPKYASTR
                     EGASNLVNCQRQVKEFWMELCKREFEEILSERNVKQKLDELDDLISEAKQRLRSSKKQ
                     GSETQPSRNIDELSSEELIQCNLYNERQKASEQLDVRLTALNDMNKGLQKELNGLVET
                     LNVEQAELSKLYDRYLGSAVEQPLDETLVQGLGDMLSELREV"
     gene            complement(<691545..>695579)
                     /locus_tag="HG536_0B03690"
                     /db_xref="GeneID:59324625"
     mRNA            complement(<691545..>695579)
                     /locus_tag="HG536_0B03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282286.1"
                     /db_xref="GeneID:59324625"
     CDS             complement(691545..695579)
                     /locus_tag="HG536_0B03690"
                     /inference="similar to AA sequence:RefSeq:NP_009506.1"
                     /note="ancestral locus Anc_7.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138181.1"
                     /db_xref="GeneID:59324625"
                     /translation="MSSLSFQTPLTPEEKRLYGEQFRKLDEEELGIVTGEALKPLFAG
                     SGLSGQKLSQVWSLVDENNNGFLNLEEYSAALRAIGHLQQYPNLPVTGDLYAHPPAKL
                     AVLDGAQAGVQSGNQQPSTSIPILAPQDVSKYSQLFERAANGAVSLPGDKAKEIFLKA
                     RLPTQTLGEIWGLCDRNASGSLDKAEFVMAMHLIQLCMSNNPSVNPMPHTLPSQLWNT
                     IGASVAATVSPLSANSTGRSSLGRRSTISRLSSGVFNSASTDWSLTFEKKQQFDAIFD
                     SLDKSHKGSLDSQALVPFFLSSRLNQDTLASIWDLADIHNNAEFTKVEFAIAMFLIQK
                     RNAGVELPDVIPDQLLQSPALGLYQQQQPAHQLHQQVPQQQPNIAIPSRNTKPSFQEA
                     PQPQITQNSNNGSLSELLALNSSFASPSSQTPVRRNSSNFGREAPSTGAAAAHQTRSV
                     PGKADWNPNVIREDDEDAPQSQNLQQQPQQLQQQPQQLQQQPQQLQQQPQQLQQQPQQ
                     LQQQPQQLQQQPQQPQQQPQQQQYQQSTQVQQAQYQNVPQPVSKSAPPAVVPRASWSN
                     LPKVPDFSSFALPGAIAGAAGAAGALMAGAAAASGHRNNDLYADAEASSQLSSATTEM
                     ANLSNQVNSLSKQASLTNERKARAEKELKRVNEMKSAIQGKLSTLRSTHEQNVKQTEQ
                     LEADLATINRENETLNQQLAVVEGNYHATETKLRDLSEEFQQAQDKNSQLKEQISSLN
                     AMSATLQSQLAEKQQHVKQERSLIDVNGKQLEVNQMTVANFQSEIQGLDEKLTIYLTK
                     RKELDDYQKTVEDQHAQLQSKYQELEAGNSELKAREQELAQRTEQVEEQEKLYEQHVE
                     RLQRMFEDLSKRKESLDRAEEDLEKQHFEYASKVQELSDRQMKLAMGELPSDSGQIVS
                     RSAVVPNTKHDADISKFVEDSVANSKLSNPGNEDEDRAESEVFDKDVPTTGSQTEADE
                     ELEARAPVSHAETAVTLADGFESDLNEYGIPRTQSLTSSVANNPPHSVMDDAELPQKL
                     DETSGANVEDKDLTVAAAQIPGHWEEATVSTAGTTKHEIIPKNPSEKPLDKPVGASDQ
                     LSDKNIGSVPEEVLPIENLKLNEEEASSSNDEFEDTREDLNPHAGQSVRDSPVMLGGQ
                     AASYQVPSETPATVATLSTSTADAAASPARDAFDDAFTGLQQAADEEAHAVGDEQQIT
                     ESIEEFEKIEHKDLDEELQQNAFTGTLTSEATVRAKDTNNGSDNTSNDEWDEIFAGFG
                     NGDASAGSKGIAKDTQQQHPIPIKPNEGYSSSPVNRKLATTPRSLAVEELSGMGFTEQ
                     EATSALEQCNWDLEAATNFLLDNA"
     gene            <695936..>696226
                     /locus_tag="HG536_0B03700"
                     /db_xref="GeneID:59324626"
     mRNA            <695936..>696226
                     /locus_tag="HG536_0B03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282287.1"
                     /db_xref="GeneID:59324626"
     CDS             695936..696226
                     /locus_tag="HG536_0B03700"
                     /inference="similar to AA sequence:RefSeq:NP_878107.1"
                     /note="ancestral locus Anc_7.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138182.1"
                     /db_xref="GeneID:59324626"
                     /translation="MIESWLFVRMFATRKFEFWLGRPSFDLDTGTAVAQRRFVVNKYA
                     LALIVCSLGAAVGSEFLQRLLSSGRRSFDPMDMICNVLGSVTGIAVAHYQER"
     gene            complement(<696279..>697061)
                     /locus_tag="HG536_0B03710"
                     /db_xref="GeneID:59324627"
     mRNA            complement(<696279..>697061)
                     /locus_tag="HG536_0B03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282288.1"
                     /db_xref="GeneID:59324627"
     CDS             complement(696279..697061)
                     /locus_tag="HG536_0B03710"
                     /inference="similar to AA sequence:RefSeq:NP_012647.1"
                     /note="ancestral locus Anc_7.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138183.1"
                     /db_xref="GeneID:59324627"
                     /translation="MFKLSGSRLQRPLAAVARMSRYNNCQMAVRPLPISRFQSTDTKT
                     VDRNEFSDEKIDEWLDAIKSLRAEFSEHEFLPESSLAPPGQSRIDIIEDVMSQDRKFE
                     PSAQQVEEWERLKDVPIPQRRDPVVQHVTNMIMRHGKKQRAEKILSRALYLVFCHLRQ
                     DPVQILKKALDDLAPLMMVRTFNTGVAKAAVIPVPLNQRQRNRIAWKWIVEGASKRAS
                     SDFSVRLGEELIAVFKGNSSGFDKRDQIHKTAIAHRAYIRLK"
     gene            <697333..>698523
                     /locus_tag="HG536_0B03720"
                     /db_xref="GeneID:59324628"
     mRNA            <697333..>698523
                     /locus_tag="HG536_0B03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282289.1"
                     /db_xref="GeneID:59324628"
     CDS             697333..698523
                     /locus_tag="HG536_0B03720"
                     /inference="similar to AA sequence:RefSeq:NP_009507.1"
                     /note="ancestral locus Anc_7.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138184.1"
                     /db_xref="GeneID:59324628"
                     /translation="MTATATDTAQTVSDVDTNMMGIRSEKLYNLLKTIVDTGDCSVLN
                     ENDPEEVLAEIIKRITLNIPEDAFRVVGAADELQRLKYRLAEIGDYLRRNFQAKGTYP
                     FTILRICELCYDPLKYFRVFELEKFVHAISSCCFVETSWKLFEDCPGQRSARNHSAVT
                     NGDSEQEDVSLTKIPWIDEKTEKKLIPFIKEIDSVMSVNFGFEDDEDDEDESMGVELN
                     QFGGADGDFVIEEYYEKDPGDEDDDDDDGDGDYVEDAQSDTEDDDQDGDSEDEDIDDT
                     RGNPQRKRKTMELDDFEYVEKSARKSKLTTPKIRPKLRDGLIGSPGSSGLSEDQDTPR
                     SSQEEERPGGQSQISSLDQEVSFLISPANKNSSNTFEEGKIRAVTDAPYERDLGSPLS
                     NRAR"
     gene            complement(<698709..>700058)
                     /locus_tag="HG536_0B03730"
                     /db_xref="GeneID:59324629"
     mRNA            complement(<698709..>700058)
                     /locus_tag="HG536_0B03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282290.1"
                     /db_xref="GeneID:59324629"
     CDS             complement(698709..700058)
                     /locus_tag="HG536_0B03730"
                     /inference="similar to AA sequence:RefSeq:NP_009508.1"
                     /note="ancestral locus Anc_7.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138185.1"
                     /db_xref="GeneID:59324629"
                     /translation="MLRTTTLRCSSKLLKRSIATQAAPKAEVTELSNGIIVATKHNGQ
                     SLTNSVGFVFGSGSTAENPYNNGVSNLWSNLFTEKGNAGEAARKGFSLESKVGREYQS
                     YLVNSKPGQVSKALEFLQSKFSSSLNESVFENTKRSVLDQVEKFETNNHAGRALEHLH
                     STAFQNTPLSLPTRGTVESIETLIPSDLESFASNHFLASNTVVVGAGNVSHEELVKAV
                     ESQVSLKSGTKPAAKKASSFLGSEVRLRDDTLSKAYIAIAAEGEKVTSPDYFTSLLAA
                     QVFGSYNAAEPSSRLQGVKLLDIIQEYQICDTFDHFSLGYQDSGLWGFTTTTSAIGSI
                     DDLVHFTLKQWNRLTTSVTETEVARAKALLKLKLASLATDNATVATNLGASALVNKAK
                     TDLTEAYSKIDSLTAKDVKQWAGNRLWDQDIAIAGVGRIEGLLDYMRIRADMSMMRW"
     gene            <700878..>701459
                     /locus_tag="HG536_0B03740"
                     /db_xref="GeneID:59324630"
     mRNA            <700878..>701459
                     /locus_tag="HG536_0B03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282291.1"
                     /db_xref="GeneID:59324630"
     CDS             700878..701459
                     /locus_tag="HG536_0B03740"
                     /inference="similar to AA sequence:RefSeq:NP_009510.1"
                     /note="ancestral locus Anc_7.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138186.1"
                     /db_xref="GeneID:59324630"
                     /translation="MIGPLTVSQQYLLASKARSKLMKCANAGKNKDYDLRVLVGHANM
                     LDRLMDNIEKFNSKDGGASGSYGAEYISSDEDSDEENRDFSSDSSSEDDSEAEEDDSS
                     DSDYSDSSEREECDERVRYTPLGLARPNGLDAVVTVTIDQCLEDEEEYESDSESDVDE
                     HGFEMDLSMMPLAFKTRDVGMSGQVAIHEPLIV"
     gene            <701738..>703441
                     /locus_tag="HG536_0B03750"
                     /db_xref="GeneID:59324631"
     mRNA            <701738..>703441
                     /locus_tag="HG536_0B03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282292.1"
                     /db_xref="GeneID:59324631"
     CDS             701738..703441
                     /locus_tag="HG536_0B03750"
                     /note="ancestral locus Anc_7.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138187.1"
                     /db_xref="GeneID:59324631"
                     /translation="MLEKTQGGRSKRRCVLNVVVLGLITLLFVGKYRERVSSRPGESF
                     RCQGFEPLLGKPSGEVCKILQSSQLQNETLSKLSNAVRIPTEMYDYFPDPGEEPEYEG
                     WKPFAKLHEQLSSDFPLVWSKLAVEKVNEYALLLTWEGTEKDLKPVVFAAHMDVVPVE
                     KKTWGLWEHEPFSGHWDGEFLWGRGSFDDKNMLIGVLQAVEYILREEPDFKPERGIVI
                     ALGSDEESTGRYGAKYISSVLLDRYGENGIYSIVDEGVNGVKNVEGVWIAAPGTGEKG
                     FINVQFDVRTPGGHSSVPPDHTSIGISAEIIHDIESEAFPPKFTPENPVTQYYQCAAQ
                     YSETMDEGLRLDFLSAMEDEGSNRRVLEHLIKTGGKKTECLFKTTRAFDIINGGIKAN
                     ALPESVSFLLNSRVSVESSVDETVSVFSNAALKVAKKYGLGYSMNEDVLVDATDRGSV
                     KLVVERSLEPAPVSPNNEVWREFAGSIKGFYEKVVFPAKFQNSTTSLVVAPSIMTANT
                     DTCHYWKLTKNIYRYQPGFAMEDTLSTIHSVNEHVDAETVMQVVGFYYNYIHLVNGQD
                     F"
     gene            complement(<703697..>705490)
                     /locus_tag="HG536_0B03760"
                     /db_xref="GeneID:59324632"
     mRNA            complement(<703697..>705490)
                     /locus_tag="HG536_0B03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282293.1"
                     /db_xref="GeneID:59324632"
     CDS             complement(703697..705490)
                     /locus_tag="HG536_0B03760"
                     /inference="similar to AA sequence:RefSeq:NP_009511.1"
                     /note="ancestral locus Anc_7.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138188.1"
                     /db_xref="GeneID:59324632"
                     /translation="MDHDELPGNKDGRKAIKTSNVSTETLDSAVSGYESTLAGAKKRS
                     AWGRFADLVEVKHPDGFGEIKSRSIVESYVYNGELKPVEAARRKWTWKQYVFFWMAGT
                     FNVNTWQISATGLQLGLNWWQTWICVWVGYILVGVFVVLASRVGTMYHLSFPSSCRIA
                     FGTYFSIWVVLNRVVMACVWYSTQAYLGGICVQLILRSIFGNNLNSRLRDTIPSVNLT
                     PFELICFIIFWAISLPFLWFPPHRLRHLFAIKSALTPIGAFALLIWSVRKSGGKLALG
                     SLNGQSAMNSTATAWAAIRSIMSAMDNFSTLVLNAPDFSRFANTPKSSMWSQLIAIPV
                     CFAAISLFGIVCVSAAYTVYGVNFWSPLDILNRYLDGYSSGDRAGVCLIAFSFLFDQL
                     GANLSNNAIPAGTDMTALLPKFINIRRGAYICAAISLAICPWNLVASSSKFTTALAAY
                     AVFLSAIAGVIFADYYIVRKGYVNIFHCYTNKPGSYYMYNKYGTNWRALVAYIVGIIP
                     NFPGFIGSVGPTVPIGAMRVYYLNYIVGYLTAAITYLILVYYFPMSGVPAGIKITDKV
                     WLEEWVEVEDFVQEREQFERTSGSNDSAKFA"
     gene            <706127..>706852
                     /locus_tag="HG536_0B03770"
                     /db_xref="GeneID:59324633"
     mRNA            <706127..>706852
                     /locus_tag="HG536_0B03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282294.1"
                     /db_xref="GeneID:59324633"
     CDS             706127..706852
                     /locus_tag="HG536_0B03770"
                     /inference="similar to AA sequence:RefSeq:NP_009512.1"
                     /note="ancestral locus Anc_7.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138189.1"
                     /db_xref="GeneID:59324633"
                     /translation="MTTIASEYSSEVASTPIQYQFNPYADNGGTILGIAGEDFAVLAG
                     DTRHTTDYSINSRYEPKVFDCGDNIVMSANGFAADGEALMKRFKNSVKWYHFDHNDKK
                     LSLSSAARSIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGA
                     AASLIMPFLDNQVNFKNQYEPGSNGKVKRPLSYLSIDEVIKLVRDSFTSATERHIHVG
                     DGLEILIVTKDGVRKEYYDLKRD"
     gene            complement(<706909..>707568)
                     /locus_tag="HG536_0B03780"
                     /db_xref="GeneID:59324634"
     mRNA            complement(<706909..>707568)
                     /locus_tag="HG536_0B03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282295.1"
                     /db_xref="GeneID:59324634"
     CDS             complement(706909..707568)
                     /locus_tag="HG536_0B03780"
                     /inference="similar to AA sequence:RefSeq:NP_009513.1"
                     /note="ancestral locus Anc_7.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138190.1"
                     /db_xref="GeneID:59324634"
                     /translation="MNPFRIAADLSHLASILILLRTIQTTNCIDGVSLKTQVLYVLVF
                     VSRYLDLLTLHWISLYNTLMKVFFISSSIYIVVLLQRAKVSNAVAYKEMILKDSFKIG
                     YLLGGSAVLALLFNERFTFIDVAWSFSVWLESIAILPQLFMLSKSGKAQSLTIHYIFA
                     LGLYRALYIPNWIWRWLVENKNFQKLAFVTGVIQTLLYSDFFYIYYKKVIKGGGVSLP
                     H"
     gene            complement(<707708..>708760)
                     /locus_tag="HG536_0B03790"
                     /db_xref="GeneID:59324635"
     mRNA            complement(<707708..>708760)
                     /locus_tag="HG536_0B03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282296.1"
                     /db_xref="GeneID:59324635"
     CDS             complement(707708..708760)
                     /locus_tag="HG536_0B03790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138191.1"
                     /db_xref="GeneID:59324635"
                     /translation="MLRFANGWGVVFLLLRVSALEFGSTGELYQELLRTECYTLVYVY
                     AVGCHWCQRLDPQFDRLAALFGRDAVQFGRIEGRRSRNFSRDFNVESYPQLLLFAPGR
                     PGDGLLPQDLLMGVYHGPMEFTAIAHYVGEQTGQMPEWPQARGNTLQLADGESLEKLY
                     RQLNGRWRRALGLPLAPRSGLASSPVVLFFVSPWMGSRHRELFLQDPASNAIGQLGKQ
                     GGPSAQLWTVDCTREQWSGLVNEFRVSGAPKVFILPQSDNENGAVVAVDLLEYDRQVW
                     QHELELLSRLLDAAVGEDHRALSSMSQEFHSINVYDSLQDMQLQFKKERDRSIDDGDG
                     GDDQVVEQLVARIRCM"
     misc_feature    708818..708886
                     /note="pseudogene similar to Saccharomyces cerevisiae MIN6
                     (YBL039W-B); ancestral locus Anc_7.478"
     misc_feature    complement(709111..709251)
                     /note="FBA1 fragment"
     gene            complement(<709371..>711221)
                     /locus_tag="HG536_0B03810"
                     /db_xref="GeneID:59324636"
     mRNA            complement(<709371..>711221)
                     /locus_tag="HG536_0B03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282297.1"
                     /db_xref="GeneID:59324636"
     CDS             complement(709371..711221)
                     /locus_tag="HG536_0B03810"
                     /note="WHO10_min6, WHO10 element inserted into MIN6 locus"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138192.1"
                     /db_xref="GeneID:59324636"
                     /translation="MNGDPEFIGGLAPGTKVFLANWKTVPIETIKVGDEVLTSEGGAA
                     KVEAVLKGDHDLVTIRQNTRHRAHLKDPSVEKPWGIVEMTCSKRQKLILSTRQGIKIY
                     NNGRGVRVVSVSQLADCQTKDGRIIKIIKEKTRRFPLTTEAPEIRDYVKPMVLRNEGR
                     CFTWQCEAGDLEEYVNKKIRAATRMILQPISIEIPVLGPWLEQSFERNITAGQLEAMA
                     WLLGFWIGDGSRTGAIFALHSRDDDVNTRLRENAKVWGMTLRIELGKGFSASGFLQTY
                     NGAVRNLNKDNPLVKVLEELKFYGNGRRNGPKNVPLFMRTEQIAVREAFLAGLIDSDG
                     YCNIQNGCIHVVIKTVYLPIRDAINFIGRSLGLTVSTNFRRANFDERSGVNHRDHWVC
                     ELYGGTNHETLRSMLNRCSCERKRNPKLVYIRNRDFEEFDSDYQSEENENDPDPEDND
                     DLSGIMESFEDDPEDDPEEQEDGTFNFGKLRFNIIQSCKSPVIGLVLSDTSNRTFVTD
                     DQIVCGTAELITEGLESRPYFKRRCLSCHTETAKKWFKVPWLGDVFDRLCGNCRDSYS
                     RTHMRCSNGLCNRVFKPIDLNPKRLSGRKREVARQATHQCERCGSSPLQG"
     gene            <711898..>712362
                     /locus_tag="HG536_0B03820"
                     /db_xref="GeneID:59324637"
     mRNA            <711898..>712362
                     /locus_tag="HG536_0B03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282298.1"
                     /db_xref="GeneID:59324637"
     CDS             711898..712362
                     /locus_tag="HG536_0B03820"
                     /inference="similar to AA sequence:RefSeq:NP_012638.1"
                     /note="ancestral locus Anc_7.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138193.1"
                     /db_xref="GeneID:59324637"
                     /translation="MVKAVALLRGDVGVSGTVYFEQKSESEPTTISWEIAGNDADALR
                     GFHIHEFGDNTNGCTSAGPHFNPFGKNHGAQEAEERHVGDLGNVMTDSKGVARGAKQD
                     SLIKLFGPTSVLGRTIIIHAGQDDLGKGGVEESLKTGNAGGRAACGVIGIAK"
     gene            complement(<712414..>714144)
                     /locus_tag="HG536_0B03830"
                     /db_xref="GeneID:59324638"
     mRNA            complement(<712414..>714144)
                     /locus_tag="HG536_0B03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282299.1"
                     /db_xref="GeneID:59324638"
     CDS             complement(712414..714144)
                     /locus_tag="HG536_0B03830"
                     /inference="similar to AA sequence:RefSeq:NP_009514.1"
                     /note="ancestral locus Anc_7.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138194.1"
                     /db_xref="GeneID:59324638"
                     /translation="MKYVVVSGGVISGIGKGVLASSTGMLFKTLGLKVTSIKIDPYMN
                     IDAGTMSPLEHGECFVLDDGGETDLDLGNYERYLKVTLTKDHNITTGKIYSHVISKER
                     KGDYLGKTVQIVPHLTNAIQEWIERVSRIPVDDTGLEPDICIIELGGTVGDIESAPFV
                     EALRQFQFRVGKENFALIHVSLVPVIHGEQKTKPTQAAIKDLRSLGLTPDMIACRCTE
                     ALDEPTINKIAMFCHVGPEQVVNVYDVKSTYHIPLLLLEQKMMDYLHKRLQLSDIQLA
                     PEDKQRGDQLLEKWRSMTENFEASDRLVKIALVGKYTNLKDSYLSVIKALEHSSMKCR
                     TQLQILWVEASDLEPESQETDKAKFHEAWNKVSSADGILVPGGFGARGTEGMILAAKW
                     ARESNVPYLGICLGLQIAAIEFARNVMGVKNAQSGEFFPDLDEADQVVVYMPEIDKEH
                     MGGTMRLGLRPTYFQEDTQWSKIKKLYGDQPSILERHRHRYEINPKFVAELEKHGLIF
                     VGKDETGDRCEILELKNHDYFVATQYHPEYTSKVLDPSKPFVGLIAASAGIMNPVLKG
                     EYEFHGKADF"
     gene            complement(<714549..>715133)
                     /locus_tag="HG536_0B03840"
                     /db_xref="GeneID:59324639"
     mRNA            complement(<714549..>715133)
                     /locus_tag="HG536_0B03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282300.1"
                     /db_xref="GeneID:59324639"
     CDS             complement(714549..715133)
                     /locus_tag="HG536_0B03840"
                     /inference="similar to AA sequence:RefSeq:NP_015371.1"
                     /note="ancestral locus Anc_7.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138195.1"
                     /db_xref="GeneID:59324639"
                     /translation="MERVLELEREHVQLHDELLSALDKLFLLQLGHGNLKDREAESSI
                     AIRRQLQLSLEKSAAILTAIQRMSKLQHSEDSDVRTTEDILASRLANLMQENYELDYT
                     VKELLEKEEKANQDLLDERTRYFDLIAKMTEVSDKIHKQKQASLAAGALPDSTPVAHT
                     PREKEKQQAIIDQNEQIQELLVALKVHGGYDPLS"
     gene            <715249..>715815
                     /locus_tag="HG536_0B03850"
                     /db_xref="GeneID:59324640"
     mRNA            <715249..>715815
                     /locus_tag="HG536_0B03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282301.1"
                     /db_xref="GeneID:59324640"
     CDS             715249..715815
                     /locus_tag="HG536_0B03850"
                     /inference="similar to AA sequence:RefSeq:NP_012636.1"
                     /note="ancestral locus Anc_7.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138196.1"
                     /db_xref="GeneID:59324640"
                     /translation="MSNQSELPPIYSFPPLYTRQPNGLIRRQQINSWIEIILQYCISQ
                     KCWRMTAEGMPVGEPDVTKQSIFNNSSIQRVVPQVFVDEIWSQMCEEGKALGVQDGKR
                     DSSQFYILWRNLDSWASLILQWFESSGSLNQVITIYELSQGDGTADWEFHGMPEALVA
                     HCLKPLCQRNRATLIKDERGIAVATKVV"
     gene            complement(<715872..>716645)
                     /locus_tag="HG536_0B03860"
                     /db_xref="GeneID:59324641"
     mRNA            complement(<715872..>716645)
                     /locus_tag="HG536_0B03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282302.1"
                     /db_xref="GeneID:59324641"
     CDS             complement(715872..716645)
                     /locus_tag="HG536_0B03860"
                     /inference="similar to AA sequence:RefSeq:NP_012635.1"
                     /note="ancestral locus Anc_7.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138197.1"
                     /db_xref="GeneID:59324641"
                     /translation="MLRNAVIRRGIHTVPKIPQAVQLSRQGIPNVLSAGGFKVLWDQQ
                     QKYLCDKLTLATAGTSLESYLPFHLILNTAKKASQSHIFNLASAAHNNHLFVENITPT
                     INSASNQPSRLFLACVEDSFGCDWETLKKEMINRAEQDVLGQGWLFLVENGDKELHIL
                     TIQNNGTPYYFPRNQLFDVNSALTLEEFAQLEEIRKLVKENGGKKAQDWTMPLICVSL
                     WDQAYLHDYGIQNRSKFVENVLNNLNWGVVNSRLYSDSL"
     gene            complement(716777..716875)
                     /locus_tag="HG536_0Btrna3L"
                     /db_xref="GeneID:59324973"
     tRNA            complement(join(716777..716821,716837..716875))
                     /locus_tag="HG536_0Btrna3L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:59324973"
     gene            <717147..>718151
                     /locus_tag="HG536_0B03870"
                     /db_xref="GeneID:59324642"
     mRNA            <717147..>718151
                     /locus_tag="HG536_0B03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282303.1"
                     /db_xref="GeneID:59324642"
     CDS             717147..718151
                     /locus_tag="HG536_0B03870"
                     /inference="similar to AA sequence:RefSeq:NP_012634.3"
                     /note="ancestral locus Anc_7.472"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138198.1"
                     /db_xref="GeneID:59324642"
                     /translation="MFRPMILRKLYSSTSGIIRNGPFRRLGPSKNSAPQVIRAEKLFD
                     DRIETTFIQPHHPVATTILNEPTIVIERQLEMMNVFLGYEQANKYAIMDVMGNRIGYM
                     QERDFSIGKAILRQIYKLHRPFTVDVFDNWGNVILTIRRPFSWINSHIKAFLPPPMII
                     EREHLSESNASGRQVHSSSFGNVPRPQFINKAHEDGILVGESIQNWHLWRRRYELFQR
                     DADSESSFSQYGQIDAPFLSFEFPVMDQEAKIIAGVDRNWVGLGRELFTDTGVYIVRF
                     DSRRSFENVYPPELISSSVLNLDQRAVLLANAVSIDYDYFSRHSRHNGGLLSFGSYDE
                     "
     gene            <718403..>719953
                     /locus_tag="HG536_0B03880"
                     /db_xref="GeneID:59324643"
     mRNA            <718403..>719953
                     /locus_tag="HG536_0B03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282304.1"
                     /db_xref="GeneID:59324643"
     CDS             718403..719953
                     /locus_tag="HG536_0B03880"
                     /inference="similar to AA sequence:RefSeq:NP_015370.1"
                     /note="ancestral locus Anc_7.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138199.1"
                     /db_xref="GeneID:59324643"
                     /translation="MEATYNKVTPVALGKSRKKGKTPRTRNNEMAASDDLTIPPPPSI
                     PPPSFILAPPPQLLEGSSGDHSNAFVTNASHSSVQQSFQSWNCYATVPNNQSIPELHA
                     SEPIPSNNGTVIPKPSSSGTVLRSPDAGFDYRIDNSMGTLASWNSFPAIDAMSQSQRA
                     SNSPGKDRKKRKTHRNQNVIRGGADSMSLAEEAERRKKRAERFANTKNSVSSSSLDSE
                     ENFANLNAISTTSHRFDKNKSIVGRCQSLEKSYLRLTSEPNPDLVRPLNVLKKAYTML
                     MKKYQKKQASYQYLCDQFKSMRQDLRVQMIENQFTVKVYESHARIALENGDLGEFNQC
                     QSRLITLFELPTVKPSFLEEFTSYRILYYMLTEDSGSMNTLRLKLMTENEAVFKNHMV
                     QTAFRLAHARLMGDYHHFMKIYTSMKNLGKKLVDAFIEKEKLKSLMVICKSYNQIKLD
                     FLIQEFHLNDHEELMGFLKQRGLDKYILTKNLGEENESQYLDTKACRVPVMQQYFSSK
                     KIDIKGQQ"
     gene            complement(<720023..>720742)
                     /locus_tag="HG536_0B03890"
                     /db_xref="GeneID:59324644"
     mRNA            complement(<720023..>720742)
                     /locus_tag="HG536_0B03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282305.1"
                     /db_xref="GeneID:59324644"
     CDS             complement(720023..720742)
                     /locus_tag="HG536_0B03890"
                     /inference="similar to AA sequence:RefSeq:NP_012633.1"
                     /note="ancestral locus Anc_7.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138200.1"
                     /db_xref="GeneID:59324644"
                     /translation="MNSDRSVVPLESNPEVFTDFAHDLGLIDSYGFVDVYSLTDPDVL
                     GFVPRPVKALILLFPISEVSESDKNTDTKKIAQATEDGNQPIWFKQTIKNACGLYGLL
                     HSLANNIDLLKPDSKLKQFIGSNPSDNGQYANAATDDFVISLSLQHADKFQQGQTAAP
                     SASEDVDLHFITFVERNGEIYELDGRRLSGANCLGSITDNNSDLVGNKIITDRVQWYI
                     ENADEKNRLNLSLLGLVQPWD"
     gene            complement(<720887..>721738)
                     /locus_tag="HG536_0B03900"
                     /db_xref="GeneID:59324645"
     mRNA            complement(<720887..>721738)
                     /locus_tag="HG536_0B03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282306.1"
                     /db_xref="GeneID:59324645"
     CDS             complement(720887..721738)
                     /locus_tag="HG536_0B03900"
                     /inference="similar to AA sequence:RefSeq:NP_012630.1"
                     /note="ancestral locus Anc_7.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138201.1"
                     /db_xref="GeneID:59324645"
                     /translation="MTVQRHYTLSNGVKIPSLALGTYDIPQHDTAKVVHEALKCGYRH
                     FDTAVLYRNERQVGEGIYQWLQDDPENNKREDVFYTTKLWNSQNGYEPAKRAIRECIE
                     KVQNLGYIDLLLIHSPLSGSKKRLETYRAMQEAVDEGLVKSIGVSNYGQHHIEELLNW
                     SGLKYKPVVNQIEISPWCMRTELAKWCQSQGILVEDYAPLTHGYKLKDPQLQKVADEV
                     RKNTGQVLIRWSLQKGYLPLPKTKTIGRLPGNLNVYDFELTQKQMKAIEHPEAHEPTD
                     WECTDAP"
     gene            complement(<722034..>722993)
                     /locus_tag="HG536_0B03910"
                     /db_xref="GeneID:59324646"
     mRNA            complement(<722034..>722993)
                     /locus_tag="HG536_0B03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282307.1"
                     /db_xref="GeneID:59324646"
     CDS             complement(722034..722993)
                     /locus_tag="HG536_0B03910"
                     /inference="similar to AA sequence:RefSeq:NP_012629.1"
                     /note="ancestral locus Anc_7.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138202.1"
                     /db_xref="GeneID:59324646"
                     /translation="MSQKKKSSNPVVNLIAGGTAGLFEALCCHPLDTIKVRMQIYRRA
                     ASGEIKPPGFLTTGRSIYMEEGFLALYKGLGAVVIGIIPKMAIRFSSYEFCRTLLADR
                     TTGTVSTGNTFLAGVGAGITEAVLVVNPMEVVKIRLQAQHMSPAEPGVSPKYRNAVHA
                     CYTIVKEEGISALYRGVSLTAARQATNQGANFTVYSKLKEYLQNYHGTDVLPHWETSC
                     IGLISGAIGPFSNAPLDTIKTRLQKDKSVSKDSGWKRIVSIGAQLVKEEGFHALYKGI
                     TPRVMRVAPGQAVTFTVYEFVRRHLDNMGIFKSKKEQPPKPLK"
     gene            complement(<723864..>724319)
                     /locus_tag="HG536_0B03920"
                     /db_xref="GeneID:59324647"
     mRNA            complement(join(<723864..724140,724318..>724319))
                     /locus_tag="HG536_0B03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282308.1"
                     /db_xref="GeneID:59324647"
     CDS             complement(join(723864..724140,724318..724319))
                     /locus_tag="HG536_0B03920"
                     /inference="similar to AA sequence:RefSeq:NP_015368.1"
                     /note="ancestral locus Anc_7.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138203.1"
                     /db_xref="GeneID:59324647"
                     /translation="MAKRTKKVGITGKYGVRYGSSLRRQVKKLEVQQHAKYDCSFCGK
                     KTVKRGAAGIWTCTSCKKTVAGGAYTVSTAAAATVRSTIRRLREMAEA"
     gene            <725203..>726021
                     /locus_tag="HG536_0B03930"
                     /db_xref="GeneID:59324648"
     mRNA            <725203..>726021
                     /locus_tag="HG536_0B03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282309.1"
                     /db_xref="GeneID:59324648"
     CDS             725203..726021
                     /locus_tag="HG536_0B03930"
                     /inference="similar to AA sequence:RefSeq:NP_012627.1"
                     /note="ancestral locus Anc_7.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138204.1"
                     /db_xref="GeneID:59324648"
                     /translation="MQNMFITPQHNGSTASGSVAAKPTDIYDCYLQPDNYEEEYEELD
                     DYEADNFFESSQLHHLVHTQPIHLVNKQEIIDYMPQTQQLVVEEDQEKKAFISPMMTS
                     RSSSMSSTFSKRTSGFKNYYDSIHEEMNSEYEDYEVFFGAKEQNKSLYSAFYSMHNPE
                     TTEAYHNDASVPRTYACEDAAIDLSSREIAEDETALETTDRSYHYSIQTSNAVPAASC
                     VHQPTDEEIQFVKAVNLKLSRYAGYFTAGSKDQEYSDKVRFQEISYKFSKTYFQ"
     gene            <726472..>727347
                     /locus_tag="HG536_0B03940"
                     /db_xref="GeneID:59324649"
     mRNA            <726472..>727347
                     /locus_tag="HG536_0B03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282310.1"
                     /db_xref="GeneID:59324649"
     CDS             726472..727347
                     /locus_tag="HG536_0B03940"
                     /inference="similar to AA sequence:RefSeq:NP_012626.1"
                     /note="ancestral locus Anc_7.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138205.1"
                     /db_xref="GeneID:59324649"
                     /translation="MSSSEDEDDRFLYGSDTEHAEVGTKRTSQDINADEESSSKRQRL
                     SNDATGIESGDGSNNSSEESDSDDGSSESDSDSDVEFIISTGADTTRLDSKVVSGSGT
                     STAAQPSGIAVATTTEVADATSPDVNAETKTKIAAPPTGTIDLNAEGMFEGEPVTSLD
                     PEVLKEKPWRQPGANLSDYFNYGFNEFTWMEYLHRQEKLQQEYNPHKILMGLLTLQQQ
                     GNLGGPKKIDQRGMGPGDLGTSGGIKSNTSLNQSIPGHPMPPHGFPPLPMFGGFSPFP
                     MPGMMPPMNPHAQKK"
     gene            complement(<727416..>731510)
                     /locus_tag="HG536_0B03950"
                     /db_xref="GeneID:59324650"
     mRNA            complement(<727416..>731510)
                     /locus_tag="HG536_0B03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282311.1"
                     /db_xref="GeneID:59324650"
     CDS             complement(727416..731510)
                     /locus_tag="HG536_0B03950"
                     /inference="similar to AA sequence:RefSeq:NP_012625.5"
                     /note="ancestral locus Anc_7.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138206.1"
                     /db_xref="GeneID:59324650"
                     /translation="MVGDNADETMDSLLKEIDDEMENTIPLDSQILKQDQGEKNTRRW
                     SIPLQEIGDETMEMLVSHNTIRNIKIKDASEFQKLEQEGKESTPLPSMRKSVVFSEGV
                     NFHEYADGSADEQKDSDHESVKIDTTWKRSSFVPATELPNELNQSLIVETPSDSDEGQ
                     EEHDLVLTTQDLLEHTVADLDQKLSHMFDANRNAHRLKLATEEMDEVAPERREPPKIE
                     YTLQSTKPLTVGTSGKVEEAGLIHFQTTEDAVEAHDDEDQDAELSTEYMDEIRHSPSK
                     IPLTNTVSINNFSIAQQGGDPQTRLSSGSSCCDSVADLKTTIQHDRYNLLESTNNLAA
                     QREENYYSDTGSFSRHETLATHPNASRIFSVATSGDGYKSAKETAYSVCSACSIEGAP
                     VRPVAKLAEGSVEDLDISAGLLKNGDSTSTIAENSRLEDESVFTDNGELSSHEIYHPP
                     QLPQLPILALRRIERQPIRIAEEYSEAKETEISRDNQTRETISADSVEEQTADELAVH
                     SPSDQIVEGCTAIMKLQDQEDSSCQNSIADQEASQNSSINCSKTYIAEPTGQADLLSE
                     VQPANSDKGCSAPNDRQTVDTENGNEIESPMLPRVARMGSLFLDNPFMDDFDTSAESI
                     DLTRSVKPSDYLSIWHMQEEDIKSTSPALSSNSQFSRYTNSTDTSAVNSNLEHTFKFK
                     PRVISRSKYYYPEPRYETSNYNDEYVITRPETALDPLRRNTNISKKIQENIKNQRRLF
                     ATLHNLREGYELEENCDQEAKLNDKDDQSLIEGTDSAELSNTRETGNNQLQLLPSLPD
                     FELGEEFATYLEVATNDNRSILHPSKDEQGNYSVWNHNIELGTPTAPAKNNVSIDAIH
                     KLLGDENKTTELLETDARSVGSNNVIGVLKTPVKEVSVGRGLSLKGYEAMVSEGFGSE
                     GYSRSIKKHGSEEAALDPLSISPSPSPVKKTHVGSPFKVKTRRNDICHEKTKSNNQPP
                     EDDSRREDKLEVEDFHLSSCNEPQAESACVTDDLDQRTVLPDRGNLYLKLKNITDLLL
                     QNVKYHKAEFSVEFDNGMDTIQTTWQPMTSNDRCDIDKEFEIILANDMKKISKLIITL
                     RCRYQSPKFELQEVVEKIPVGRKFPFGKSKFEYQKRFVQKSPTQDEWDFLFARDGSFG
                     RCEINLDEAFLGGVKFRNKLLTFTMVNEWARKPDPLSSKKLHELPRRSPYAIGALNIE
                     ACYLERTSPLEKFPKTLQIARSIISKYMQQQAIFKEGYMLQEGGDVQSNIQRRFFRLQ
                     GNNMLGYHEITRQPKLAVNLLKVVKVFGPGDIPKGGERNLTDLVLFSGCFHLVFDNEE
                     RITFSTESPKDGEDWCNKISEVISLNRCHQPWVKYFHQSIDLDH"
     gene            <732606..>735815
                     /locus_tag="HG536_0B03960"
                     /db_xref="GeneID:59324651"
     mRNA            <732606..>735815
                     /locus_tag="HG536_0B03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282312.1"
                     /db_xref="GeneID:59324651"
     CDS             732606..735815
                     /locus_tag="HG536_0B03960"
                     /inference="similar to AA sequence:RefSeq:NP_012624.1"
                     /note="ancestral locus Anc_7.462"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138207.1"
                     /db_xref="GeneID:59324651"
                     /translation="MSDKKVFRNDAVASNGGTLSNIPEVIDPGITIPIYEEDVMQGSS
                     AGGHVEVQPQKLGSYRSRAGKFSNTLSNLLPSISAKLHHSKKATQGKAPGDDSPNNNS
                     SESTVDSGNAYATRANSKNFIQSIGTIPIEGAESLTPPHEMEKLVHFPDANFLVSQPR
                     TSNDSFTFGGSGLPQHRISRTRNSTISSQITSMSSIPANNGSSSVIWSNNQNSSDPLQ
                     QHLLQQFNSNNINQNNSLSANNTSPLNEYSSSTTYFDTAIPSSNVNATLAGGTNSINL
                     TVPGSMWSQNNISNRPRSLSNASSIYTDAPLYEQPARSRATSTYTLSQAHATQTQEIP
                     FIEDDIDPRSINWVTTDPLVPAINQISNLLPTNTISISNVFSLQQQQPQLMNAVNLTS
                     ASLATLCSKYGVVISATTLKGLNMALVEFDSVESAIRALEMLQGKEVSMIGAPSCVSF
                     AKVLPMHQQTPQVVVSPRATGNVGSDAVPQPLLQEQLFSGTVTFQQQGNVSLPIFSHQ
                     QPDSHPQSTHTHSNSNQGFGHSAQNEKEQCPFPLPPSPFESHIGAVKDIMKSFDTPFD
                     QAQTSHIVNNALKYDGTSDTTDFGPLPEPLTVREFDAPKLRELRKNIDANLIPDIEIE
                     QLAIAMLDELPELSSDYLGNTIVQKLFTHSTDIVKDIMLRKTSKYLTSMGVHKNGTWA
                     CQKMISMARTPRQIMLVTNGVKDYCTPLFNDQFGNYVIQCVLRFGFPWNSFIFESIVA
                     NFWTIAQNRYGARAVRACLEAHDIITQEEMLVISAMIVLYAEYLATNSNGTLLVSWFL
                     DTCSLRHKHSMLAPRLLSHIVELCRHRLASLTVLKLLNYRGDDIVRKKIAHAIFGEPI
                     TDEPALPLRQILCDTNYGPTFIYKVLTTSSLEGDLRNHAIRQVRKVLMETTPSQQHRR
                     LMEEVGLTPANSQHSSQSKHCSSISQVFNQDGTHLRGLSVSSVRSNGSRHSGLAAATS
                     AGQASVQPSVPASNNGAWNIGYSNYPGLFPGFSNSGYPVNSEDLSNQFDMMSLNNGTH
                     ISLPQLSLTNQNNSTNLIYPTKSTSSQDPHTKSHGMFGQ"
     gene            <736264..>739524
                     /locus_tag="HG536_0B03970"
                     /db_xref="GeneID:59324652"
     mRNA            <736264..>739524
                     /locus_tag="HG536_0B03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282313.1"
                     /db_xref="GeneID:59324652"
     CDS             736264..739524
                     /locus_tag="HG536_0B03970"
                     /inference="similar to AA sequence:RefSeq:NP_012623.1"
                     /note="ancestral locus Anc_7.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138208.1"
                     /db_xref="GeneID:59324652"
                     /translation="MSDRHGHNAPGNMPGGLPAGWFTNPVPSRESLNQQGRDAVSREH
                     RQRVSRIAQNETALRDMFRFNVHRSSHHSNGQSGNHAADERRQGGQQNIGGGGSLIAD
                     AQTNMLNGVPGSANLQPEDLRKLNLFQIALQQKVQAFLDVIENRRNTILNEISTRNTN
                     LERIQEPSSSQAANYSNKLQRVRLRAIETETMELQSLRAKFLTVVEEYRRAMNAYCKA
                     KSEGKEAPNPTDYFQQWIESLDPTESSMPIRLQELSWGSKTLINTIAAPADKARERPS
                     SYKVFPLHYLPSEILHLVLEKLSHKFDIVDLLTVCKLWAQFIVKILYYRPHINKKSQL
                     ELFMRTMIMHPDETVFNYRSMIKRLNFSFVGDYMHDEELYSFVGCQNLERLTLVFCKN
                     ITSNSISAVLKGCKYLQSVDITGIREISDDIFDTLAESCPRVQGFYVPQAKNVTSRAL
                     HNFITHAPMLKRVKITANNNMDDNLINLFAEKCPMLVEVDVTLSPNIHDHSLLKLFSK
                     LTQLREFRITHNTNVSDKLFLELPKKVKQLPALRLLDLSGCENITDKTIEKVVELAPK
                     LRNVFLGKCSRITDYSLHHLAKLGKNLQTVHFGHCFNISDQGVRVLVQSCPRIQYVDF
                     ACCTNLTNRTLYELSDLSKLKRIGLVKCSQMTDEGLLNMISLRGRNDSLERVHLSYCS
                     NLTIYPIYELLMACPRLSHLSLTAVPSFLRPDITAFCRPAPNDFSDNQRQIFCVFSGK
                     GVHKLRHYLMSLTTPTSGPQTDLRDVLTKYIMSKNMLQQGEDLEDGINRITRDLNQDS
                     AAILAATGLSQMNGANNDFLFQNIDFDRLEDVFNWYETPPVNAELSSDEITLLLSQVD
                     RKFCEDPFDEEYDDLDTVVAPGANPDLNNELCYIVRKLHELDDRVNDFEVNVASLARV
                     QFQFTGFLLHEMAQIYMQMVELNRQISQIQARTNESNIQPDIRGLSIWRLLFIEKFIE
                     LLQKYKLSTVVLRLYLKDSITLLTRQRELLLAHQRTAWNVNNGNDNEDSEDPAIWRQF
                     ENNMQMTPDQMRIIQFGLRSPPVVGVGGLRPLAEANNNNIDERAETPDDETILEDA"
     gene            complement(<740300..>741802)
                     /locus_tag="HG536_0B03980"
                     /db_xref="GeneID:59324653"
     mRNA            complement(<740300..>741802)
                     /locus_tag="HG536_0B03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282314.1"
                     /db_xref="GeneID:59324653"
     CDS             complement(740300..741802)
                     /locus_tag="HG536_0B03980"
                     /inference="similar to AA sequence:RefSeq:NP_012622.3"
                     /note="ancestral locus Anc_7.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138209.1"
                     /db_xref="GeneID:59324653"
                     /translation="MNNGSSITTGGLSPMCSLEARIKSFRNTAIIDGKKYRWPYTVIP
                     FEDMAKLGFFYHPFKDSKLEGEVCRDAVQCVYCKNVTHDFKECRSKKKDITETMTNVL
                     RQHLANDGESCLLSSVKLQALQDVSMEFESVKWEETPVFRDPLGQKATHLRKFTFEMN
                     WNLKSDNLTPQKMSEAGLLRYDSSFTGFEDLTEGQVHDACYCIYCKRLVASWQSHDNP
                     LLEHYKSCGGNCFFFKTMKADINYSGILQELEDKLANDSFANDTDKEPCRATNGLIEK
                     GDAPLGKIGEENDEREVESLLASGSSSPASEGNGQLSSPMKSPIRKKRLLRRSSTKRY
                     FEGDTSNVSEIGADQDKDLVVEFKDHVEKARTVGRKNKILDDSSDDFSFSAQGQSTFE
                     IPAIPVPLAANNFEKVDEETEEHSDVSQSERAASHEQSKESVHSDLQNERLNAIPIDG
                     ILSPDTSLRSSIASTPIHSPQTGPHKILRRVDQLPEEPQHLRHLRGRKIL"
     gene            complement(<742244..>743476)
                     /locus_tag="HG536_0B03990"
                     /db_xref="GeneID:59324654"
     mRNA            complement(<742244..>743476)
                     /locus_tag="HG536_0B03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282315.1"
                     /db_xref="GeneID:59324654"
     CDS             complement(742244..743476)
                     /locus_tag="HG536_0B03990"
                     /inference="similar to AA sequence:RefSeq:NP_015366.1"
                     /note="ancestral locus Anc_7.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138210.1"
                     /db_xref="GeneID:59324654"
                     /translation="MSINICRDNNDPFYRYKMPPIQAKVEGRGNGIKTAVLNVADIAR
                     ALNRPAPYIVKYFGFELGAQTSISVDKDRYLVNGVHEPAKLQDVLDGFINKFVLCGSC
                     KNPETEIIITKDNDLVRDCKACGKRTPMDLRHKLSSFILKNPPDSMNGSKKKKKAATA
                     SANVRGGGVSISDIAQGKSQASNNSPNGTTEALQVDEDDDELARQINAAASTLEKIEM
                     KDDEWAVDMSEEAIRQRAKELQASADAANGEMSKLEEFGEWILKEAGDDKKNLPSDVE
                     LFKQAADMDVLKDPKVACVLAQCIFDEDIVQQVGEHAAFFTKVFVAPEYEREFLGGIE
                     RFLGLEHKDMIPLLPKILVQVYNNDIVSEEEIVKFGTKCSKKYVPKDVSKKVRRAAKP
                     FITWLQTAESDDDEEDDE"
     gene            <744118..>746580
                     /locus_tag="HG536_0B04000"
                     /db_xref="GeneID:59324655"
     mRNA            <744118..>746580
                     /locus_tag="HG536_0B04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282316.1"
                     /db_xref="GeneID:59324655"
     CDS             744118..746580
                     /locus_tag="HG536_0B04000"
                     /note="Rover element"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138211.1"
                     /db_xref="GeneID:59324655"
                     /translation="MSGASTHATPIVIQQDMPFTNTSSLSAPIPSRSCPATPAEMVRS
                     TPNTTLKVKKSPKKSPSRWMERSSFKIHFTLLNLNNKKRAKCIYCGKMFKEGESTGNL
                     SKHITAVHPSAIKSKKPKVSKEQTLDMLPRRSKSLRLSDSLVQECQKNPEILETLLLI
                     SEGFLPFNFVRLLSWGMINRRHAANAFIQSRTTLSTKINLFKRYLNETLHYNLKDTTM
                     VNIQLDIWTSPSNISFLAVMVSFAPNILNMESLELANDAKILLNNRGESRNCHLLEFV
                     SLGHKRHTGLNIYKVFKEILHRHDLVDKLGTITMDNATNNESFHKSLVYDYLNTIKPS
                     GHQMLGKVRFIRCANHVLNLIFGRIIKSLCEDLLFADAFSKVTKLAKIMRRSTAVNAS
                     LKEHGIPLIPYESQTRWIYTWRQVTVFLQNYAAYSKWFEALDTESHTHIINRVQSIIA
                     FEEKTIQMLTYFVECCDIFGELNFTFQNDEINNLPQGVPLYYLLGHYYKLCLSAFAGN
                     HIPKTPGMDFSYFNGPEYLSLDDKRIVLQAIKDSYGCYQDYLSHIQVNPLFYVAVILD
                     PTAKQDKLYEIMEDEEFTVRISEVNSFMRNYLKVQRFSCVTEQERKKIPKAPSHKNLL
                     SFNIRVAPDPSRHTGSAAMEAECNDGSLEEWVKYQREPVIAGNSRQEAIKWWYDYRHT
                     YPMLFKLAMSLFYTKFTSCDVERCFSLAGRVVRKDRARLSHNNIGTLMILRDRFSNFG
                     FYNGGLVSDAILDDDDFDINLDDTTYVDSLPDVPDHEREDSDDAIFEEWPQESWSPET
                     PTAPRTPEDSLRQATDSPTPVG"
     gene            <746921..>747787
                     /locus_tag="HG536_0B04010"
                     /db_xref="GeneID:59324656"
     mRNA            <746921..>747787
                     /locus_tag="HG536_0B04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282317.1"
                     /db_xref="GeneID:59324656"
     CDS             746921..747787
                     /locus_tag="HG536_0B04010"
                     /inference="similar to AA sequence:RefSeq:NP_012621.1"
                     /note="ancestral locus Anc_7.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138212.1"
                     /db_xref="GeneID:59324656"
                     /translation="MSARTQRLLTIASTKLYTELDAGELHDLHDELVAYTSSLGSGVS
                     ESAQLTLLEMLFYVKVYLSKDVDAQVIYNTLRDRFGEHSPSLYVMKATLLQINEGDQV
                     AIDYIEKLIKESLEYDTDAVSYLLLQKKLLSIKASSHDKEWLLKQVLSLIEKFPLDPE
                     LYWFAAKIYTELGQFDRAAYCYEEVLCIMPFNYVAFGQLAESLYYKALKNEKLSTRRR
                     DGLQKALENALRSVELSENYLKGWSFVAMISKKLDGRDKIFKLARSKIQQIADSSNAK
                     NKATANLLLKNL"
     gene            complement(<747840..>748919)
                     /locus_tag="HG536_0B04020"
                     /db_xref="GeneID:59324657"
     mRNA            complement(<747840..>748919)
                     /locus_tag="HG536_0B04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282318.1"
                     /db_xref="GeneID:59324657"
     CDS             complement(747840..748919)
                     /locus_tag="HG536_0B04020"
                     /inference="similar to AA sequence:RefSeq:NP_015365.1"
                     /note="ancestral locus Anc_7.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138213.1"
                     /db_xref="GeneID:59324657"
                     /translation="MSGRKVVRGGGINTIEVNAAREIHMRTVRARIPTSAAADKTSQR
                     DFKTPASPLKTPARHVCNNPNNPPCSHCGTMIVPSPSASLPLEDFPSMTINDWTISTK
                     KRPILNSQELEHWEKHELRGLTLPEMIFGNSFVRIENTRYGWTLQFNALDALKLVNLA
                     DSGIRVSYSKKWMDSKQKKQSQKSSSPSEFEMDDSSLQIAHHYDWTYTTRYKGTERCQ
                     NEKYRLKRDDTQSLPLDKLARPDHILFYDDMILFEDELADNGISILNVKIRVMNERLL
                     LLSRFFLRVDNVLARVMDTRVCVEFDENKVMREFKEMEGDYKSLLARHRLSHSHDPKA
                     ALRDANWVAQNLPQIRREFETLIFD"
     gene            <749066..>749683
                     /locus_tag="HG536_0B04030"
                     /db_xref="GeneID:59324658"
     mRNA            <749066..>749683
                     /locus_tag="HG536_0B04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282319.1"
                     /db_xref="GeneID:59324658"
     CDS             749066..749683
                     /locus_tag="HG536_0B04030"
                     /inference="similar to AA sequence:RefSeq:NP_015362.1"
                     /note="ancestral locus Anc_7.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138214.1"
                     /db_xref="GeneID:59324658"
                     /translation="MKRFNYKSGHIVRVLAAFAIVGLWWFFSSNELSYSKSSVDLPQT
                     IETKGASKAGTEDKRISAVNDLGTIMPSMPEKEAKEVLGRASWRYFHTLLARFPDEPT
                     EEQSAKLKQFIELYAELYPCGECSYHFVQTLKKYPPQVSSRTAAALWGCSIHNMVNEY
                     LKKDKYDCSTILEDYDCGCGDDDGKIKDDLKMDKISLLKENKQGG"
     gene            complement(<749713..>750033)
                     /locus_tag="HG536_0B04040"
                     /db_xref="GeneID:59324659"
     mRNA            complement(<749713..>750033)
                     /locus_tag="HG536_0B04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282320.1"
                     /db_xref="GeneID:59324659"
     CDS             complement(749713..750033)
                     /locus_tag="HG536_0B04040"
                     /inference="similar to AA sequence:RefSeq:NP_012619.1"
                     /note="ancestral locus Anc_7.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138215.1"
                     /db_xref="GeneID:59324659"
                     /translation="MIVPGGLSRWRGSMSQEMLSYRIQCLKLKRVNELNNRLRDELGR
                     ERITASNACLNFIDYVSTHTDYTLPEIWGYPSPGANPFANGNDRRRRSRQDSSGTGSC
                     CNIM"
     gene            <750367..>750684
                     /locus_tag="HG536_0B04050"
                     /db_xref="GeneID:59324660"
     mRNA            <750367..>750684
                     /locus_tag="HG536_0B04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282321.1"
                     /db_xref="GeneID:59324660"
     CDS             750367..750684
                     /locus_tag="HG536_0B04050"
                     /inference="similar to AA sequence:RefSeq:NP_012618.3"
                     /note="ancestral locus Anc_7.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138216.1"
                     /db_xref="GeneID:59324660"
                     /translation="MEHPAYTLSLLAATGGIMGYARKRSVPSLVAGLVFGGIYGYAGY
                     LLHHNRDNGLEIALGASLVMMATGVARGIPSRFRKPVPLALTVLGSLGSYYYYNKYRE
                     FYP"
     gene            complement(<750883..>751050)
                     /locus_tag="HG536_0B04060"
                     /db_xref="GeneID:59324661"
     mRNA            complement(<750883..>751050)
                     /locus_tag="HG536_0B04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282322.1"
                     /db_xref="GeneID:59324661"
     CDS             complement(750883..751050)
                     /locus_tag="HG536_0B04060"
                     /inference="similar to AA sequence:RefSeq:NP_690847.1"
                     /note="ancestral locus Anc_7.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138217.1"
                     /db_xref="GeneID:59324661"
                     /translation="MAFLTLTSEVQTPFIIPEISPVSPASSRKNSTLSVSPVATNVPA
                     PSGRKGSISLL"
     gene            complement(<751388..>752632)
                     /locus_tag="HG536_0B04070"
                     /db_xref="GeneID:59324662"
     mRNA            complement(<751388..>752632)
                     /locus_tag="HG536_0B04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282323.1"
                     /db_xref="GeneID:59324662"
     CDS             complement(751388..752632)
                     /locus_tag="HG536_0B04070"
                     /inference="similar to AA sequence:RefSeq:NP_012617.1"
                     /note="ancestral locus Anc_7.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138218.1"
                     /db_xref="GeneID:59324662"
                     /translation="MVKVNLNRYFVEKRYDDQFLQFLRNDNFNESQDFILTLQNDGKL
                     DQLYNVTMELKFQCWVNDNRDKRFELADEQLRLLNRIAEQETNWIVYPLYVVANQYFQ
                     IAQKTRTSASGENLLERCGRTIHRSFNLCLNDRNPELPRNRKIGCYLFANLEFQLYRK
                     LENRDMAKNLVKVLQSRVNEIPTLSQSLAAHHAKHKVLYNYYMGEYYGCYESDFQKGF
                     TYLQEALLECSTSGSCDAQIDRILLLLVPFALLTRRLYPNFHHTALANARRHRRAAQH
                     IYQPIIKSLLTGNLKDYDAHFAKHELFFLRNGLFVAMSLLRELVLLKLVKTCWTVLNH
                     VTVVPLSTIAIGYLASLHGTRKKPKRLTTPINDSLLDELECQLANLICKNAIKGYLSH
                     SNRCLVLSKKDPFPHSSHVTQL"
     gene            <752773..>753576
                     /locus_tag="HG536_0B04080"
                     /db_xref="GeneID:59324663"
     mRNA            <752773..>753576
                     /locus_tag="HG536_0B04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282324.1"
                     /db_xref="GeneID:59324663"
     CDS             752773..753576
                     /locus_tag="HG536_0B04080"
                     /inference="similar to AA sequence:RefSeq:NP_012616.1"
                     /note="ancestral locus Anc_7.451"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138219.1"
                     /db_xref="GeneID:59324663"
                     /translation="MSRNVSNPIELHKLTIVDKRQEESPTRLSNTSSQIKLPSSPRRQ
                     GIQIALPLESSPAKEHDSLDLTPVSSPPRSKRNSVSSVQSESQSQDLLYRLAAKEREI
                     VELEQKLQSAKKELLLLENHYRSVVAGQSNLRNTLSSGSYRKDDVIQNLSKKFQKTLD
                     EVHNSPNVLKSKKSISNFFNGERNAPRSAEEAKGRGGFFQNLIDKFNDFSVAEAEEEE
                     FDRTQNVHKDDFYLKEKLEYDDDEDIVNEETGATLLDVQDPRLRDIYKR"
     gene            complement(<753606..>755015)
                     /locus_tag="HG536_0B04090"
                     /db_xref="GeneID:59324664"
     mRNA            complement(<753606..>755015)
                     /locus_tag="HG536_0B04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282325.1"
                     /db_xref="GeneID:59324664"
     CDS             complement(753606..755015)
                     /locus_tag="HG536_0B04090"
                     /inference="similar to AA sequence:RefSeq:NP_015361.1"
                     /note="ancestral locus Anc_7.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138220.1"
                     /db_xref="GeneID:59324664"
                     /translation="MILLDSTHFNNIRSAIRSRPVAWDALARSAEISELDASNAKTLE
                     SILIKCANDQSSSMDINLRINENTMSPLIHLLSTSNNADSKKSVQNLLAELLSSPRFS
                     RDTIRYFIENPGKVEELFNVSLVGDRQTVMISSFNLVNLLIQPELLNRDLVERMLASD
                     TFLNILNNLDMTDTSYVCIRLLQELAAIEAYRPVLWRAQKNFVPTLFKVVRQALGPNS
                     ATKVVATNSNNLIIQLQYYSLLLIWLLTFDRKVAYDLTQNYLQDFLNFLELVKVTIKE
                     KISRICISIILQCTSKEVKNHKSSIKNLLLLGNALPALQWLSERKYSDEELRQDMATL
                     KEILEKEYQELTSFDEYLAEIDSKLLCWSPSHVDNGFWSDNIDKFKLDNWKLFKQLVN
                     LLIETKESGLNDKQHRIILEVALSDIAHVVELLPESVDVLSEMNGKLVIMELLNHSDS
                     RVKYEALKATQSIIGYTFK"
     gene            complement(<755316..>756422)
                     /locus_tag="HG536_0B04100"
                     /db_xref="GeneID:59324665"
     mRNA            complement(<755316..>756422)
                     /locus_tag="HG536_0B04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282326.1"
                     /db_xref="GeneID:59324665"
     CDS             complement(755316..756422)
                     /locus_tag="HG536_0B04100"
                     /inference="similar to AA sequence:RefSeq:NP_015360.2"
                     /note="ancestral locus Anc_7.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138221.1"
                     /db_xref="GeneID:59324665"
                     /translation="MSGVEKTQILQKYLDLSQNGRVIAEYVWVDGTGNLRSKGRTLKK
                     AVTSVDQLPEWNFDGSSTNQAPGHDSDVYLKPVAMYPDPFRRGDNIIVLAECYNNDGT
                     PNKFNHRHEAAKLFAAHKDEEIWFGLEQEYTLFDEYDNVYGWPKGGFPAPQGPYYCGV
                     GAGKVHARDVIEAHYRACLYAGIEISGINAEVMPSQWEFQVGPCTGIDMGDQLWIARY
                     LLSRVAEEFAVKISLHPKPLKGDWNGAGCHTNVSTKKMRSPGGMKYIEAAIESLSKRH
                     AEHIKLYGADNEQRLTGRHETASMTAFSSGVANRGASIRIPRSVAKEGYGYFEDRRPA
                     SNIDPYLVTGIMCETVCGAIDSADMTKEYEREFS"
     gene            complement(<756877..>758295)
                     /locus_tag="HG536_0B04110"
                     /db_xref="GeneID:59324666"
     mRNA            complement(<756877..>758295)
                     /locus_tag="HG536_0B04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282327.1"
                     /db_xref="GeneID:59324666"
     CDS             complement(756877..758295)
                     /locus_tag="HG536_0B04110"
                     /inference="similar to AA sequence:RefSeq:NP_015359.1"
                     /note="ancestral locus Anc_7.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138222.1"
                     /db_xref="GeneID:59324666"
                     /translation="MTKEDKKCVVIHNGSHSTIAGFSNMELPQCIIPSTYLQRGDEMI
                     FGTFEMLDEAQQNAPGTEVYTIMDSHGLPYNWTALEAQWRYIYEKQLKVSPHDLPLVI
                     SVPTSHAEFDMHVMERYFELAFVQLGVPVLQIVIEPLAVALSMGKSSALVVDIGAKGC
                     TVTPIVDGTVIKSGVMRSKFGGNFLDFQISKLPQIDTPATASTCETWYNANTWIQQFK
                     STMLQVSDKNLVELERYYQEQLQLQQQQQQQMNGFQPYMVNPLTQKRNFLYNGQKTIT
                     MELRDCYKIAEYLFQPNLASDTFSSADGLSELMSKSIRKAGGSVSTMGTQSGGTGASL
                     VYHRSHAAASGNPKSSSSAQSPGSGTPAAASSSSTTAAAAASAGGLTSEQVYSLLLTN
                     VIITGCTSLIGGTEQRIINELSIRFPQYKLTTYANQIQFDRKVQTWISMSAMASLPNW
                     ELGRWYVPSDWRTAPAPASGTI"
     gene            <758448..>758801
                     /locus_tag="HG536_0B04120"
                     /db_xref="GeneID:59324667"
     mRNA            <758448..>758801
                     /locus_tag="HG536_0B04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282328.1"
                     /db_xref="GeneID:59324667"
     CDS             758448..758801
                     /locus_tag="HG536_0B04120"
                     /inference="similar to AA sequence:RefSeq:NP_012615.3"
                     /note="ancestral locus Anc_7.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138223.1"
                     /db_xref="GeneID:59324667"
                     /translation="MDNEPKAYEKLKEDLKKSLQEQKDLEDEFDRLQQEIYDKETEYF
                     GGKSSGSVSMGFGKTSCGGNIIRGFDAFNKSHHGHGHGHESSSHFTNDDRLFSLSSAV
                     FVKQLRQEDSQDHIE"
     gene            <758910..>760046
                     /locus_tag="HG536_0B04130"
                     /db_xref="GeneID:59324668"
     mRNA            <758910..>760046
                     /locus_tag="HG536_0B04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282329.1"
                     /db_xref="GeneID:59324668"
     CDS             758910..760046
                     /locus_tag="HG536_0B04130"
                     /inference="similar to AA sequence:RefSeq:NP_012614.1"
                     /note="ancestral locus Anc_7.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138224.1"
                     /db_xref="GeneID:59324668"
                     /translation="MKELIMRPATRSISILRPVTSTVIPTQAELTTATGTNAESLFFE
                     TPATPQFRVLGQPPTLASLVIPPSIPLYVRKGCLTSLHGSASISMAYEWIGFWSSLLR
                     YGTLKPAMYHRLVSSAQFDALVAPNFLSNRLGPRLGLSSSPFRTLCLLNLDGLSDWNV
                     WGKDSIVAFEDNTSLELRPPAFGFSKSPFSSQYTTLKGRGNVLLSGSGSVYTIQLKDA
                     SDEIILRSEHLLAISGSSLLDIDEAVTETALGQPAKQGGKAAEEQREFDIKMFFQISS
                     EIVSAVWNRTKQIYSYVMNGPTKFLKIKGPRNLLVQSSYNVYLPASSKSAGPAIGEPM
                     ALTYKPSKNYLSYVSVSKDGEVEFQSTADFQDTVTRIQNLAKRK"
     gene            <760240..>761847
                     /locus_tag="HG536_0B04140"
                     /db_xref="GeneID:59324669"
     mRNA            <760240..>761847
                     /locus_tag="HG536_0B04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282330.1"
                     /db_xref="GeneID:59324669"
     CDS             760240..761847
                     /locus_tag="HG536_0B04140"
                     /inference="similar to AA sequence:RefSeq:NP_015358.1"
                     /note="ancestral locus Anc_7.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138225.1"
                     /db_xref="GeneID:59324669"
                     /translation="MLLRASTRSISSLRKLSTKMSQTSDAAAAAASSKKAKASKLQVS
                     LKTPKGTKDWADTDMVIREAIFSTLSKLFKRHGGVTIDTPVFELREILAGKYGEDSKL
                     IYDLQDQGGELCSLRYDLTVPFARYVAMNNIQNIKRFHIAKVYRRDQPAMTKGRMREF
                     YQCDFDIAGNYEAMVPDAECLSVAVEGLTSLGIKDFKIKLNHRKILDGIFKISGVKDE
                     DVRKISSAVDKLDKAPWEVVKQEITVEKGQSEETAKKIGEYVKLNGSLRDIHSKLSED
                     PEISANELAKAGLDDIALLINYVEALGIDSFISFDLSLARGLDYYTGLIYEVVTEASA
                     PPKNASDLKKKAKADEDASAYVGVGSIAAGGRYDKLVSMFVEASGKKPVEIPCVGISF
                     GVERIFSLIKQRTISASLKPTATQVFVMAFGGGKDWTGYLPERMRIAKQLWEAGIETE
                     YVYKSKANPRKQFDAADKSGASLAVILGKEEYADGKLRVKRLGPEFADDDGEVVKAEE
                     IVKVVKEKLSQVHQDGIDQVTRLIKGL"
     gene            complement(<762042..>763517)
                     /locus_tag="HG536_0B04150"
                     /db_xref="GeneID:59324670"
     mRNA            complement(<762042..>763517)
                     /locus_tag="HG536_0B04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282331.1"
                     /db_xref="GeneID:59324670"
     CDS             complement(762042..763517)
                     /locus_tag="HG536_0B04150"
                     /inference="similar to AA sequence:RefSeq:NP_012612.3"
                     /note="ancestral locus Anc_7.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138226.1"
                     /db_xref="GeneID:59324670"
                     /translation="MSKNIRLPTLEEYGLSDNGFLPSEFPVSKLSDEYYKDWETIVEN
                     IPSLLLSKKMREVVDRLPVLDVKDSLVGDVRQVRRAYSVLCFIANAYVWGYDKPCDTL
                     PDCIAKPLLTVSDILGLPPLATYASVVLWNYKPIVANSELVDDLLDLSNLTSINTFTG
                     GMDETWFYLVSVMTEKIGAPCVTSGLKAIQAVRADDLEGAISELKCIAEAIDNLGSVL
                     MKMEAMCDPHIFFFRIRPYLAGWQNMAEVGLPKGVKYGSEGDYLSFAGGSNAQSSLLQ
                     ALDIVLGIEHFPTGKKGSGARTISANSDQNSFINEMRKYMPREHREFLGHLAKVSNIK
                     DYVETKKDKELTLAYDACIAMLKSFRDKHIQIVTRYIILQAHKKDASSQSKVLRSGLS
                     KSQGQKEQRGTGGTALIPFLKQCRDETGSSAASDWGKKVLSTAVLNVHENSTAAGVRK
                     RSHESTADSGGDAKRMKLGLAGNWNIDQESDEEGSYPAGHW"
     gene            complement(<763864..>764463)
                     /locus_tag="HG536_0B04160"
                     /db_xref="GeneID:59324671"
     mRNA            complement(<763864..>764463)
                     /locus_tag="HG536_0B04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282332.1"
                     /db_xref="GeneID:59324671"
     CDS             complement(763864..764463)
                     /locus_tag="HG536_0B04160"
                     /inference="similar to AA sequence:RefSeq:NP_009443.1"
                     /note="ancestral locus Anc_7.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138227.1"
                     /db_xref="GeneID:59324671"
                     /translation="MSSDSIEVTAPEALLDANLSFPEETPLIRHLTMTRERCVDPTLA
                     DSFLRLLRYGSDDSIKQRLSAYQRHEENSPFKNKRCGSFLRNELYPNWQARNRIITFC
                     RNQLEDMKAELDEKYGQHSATPLKAEVDLRIDPYAAKDRQHEQENRYKELKRLNTWIE
                     NQIKIESILLANSNRTLQQNCDQNVNYINEFWKFHRATR"
     gene            complement(<765676..>768762)
                     /locus_tag="HG536_0B04170"
                     /db_xref="GeneID:59324672"
     mRNA            complement(<765676..>768762)
                     /locus_tag="HG536_0B04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282333.1"
                     /db_xref="GeneID:59324672"
     CDS             complement(765676..768762)
                     /locus_tag="HG536_0B04170"
                     /inference="similar to AA sequence:RefSeq:NP_009444.2"
                     /note="ancestral locus Anc_7.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138228.1"
                     /db_xref="GeneID:59324672"
                     /translation="MFKSKRLNVSNPFKSDRSKTTTSTSDSNKASAAKPSKKFSIKDI
                     NYGSSYSKLFSVREVSRYGLSGRIVTAAFDFTQSLLAVATDAGEIHVYGQQQVEVVFA
                     LDNKVLIKHMTFVKGIYLVVIDSRDAIMIFSLYSKKLLTSVFSPGKIACIESDPSLDW
                     LLIGLQSGITLIYDVDRNQMSNIKIENLQKTRFFPNSRVSPVVSLQWNPRDIGTVLIS
                     YELVTVIYSLVEGTIKRDFIYELAPGAPGGEFSIDVNKARRPLVKQSLYHPNSLHIMT
                     VHDDNSMVFWDANSGKLIQARTLFETDVHIPQPAIQKPSISDVPQITKVAWICQSNPE
                     YTSLLVSTGSRQAGQSMAMINLGGTPMYSITSYENMSKYYANTREQKIFPLTTGAPIV
                     NFYPLPRKSPYFSGCHDPGVILILLGDGEIETLLYPSGFFTYKASLFPQSIAWVRPTA
                     TISVAATVPKNLWLGMMSAAKADDFLLKGGSPVKKTVRANDIRSALATGHINGSVRIW
                     DASHGELSSSAVFEMNLSHVLNRSTGLEVDHISFATETLELAVSIKAGEVVLFKFEVN
                     QFYKPGQENSDRELQMNFRRFSLNDSKELLVDVRDRSPENVRQGFMPVTAVHAQKGTI
                     TAVKNSNVGFVGIAYQEGTLVVIDRRGPAAIFMGNINDMCEASRSWITSMEFVILEYG
                     DDGYSSILLLCGTSMGELITFKILPEAGGRFGVHYMETKKTNVESPILNIDSYSKTTG
                     HSCQATIAQMQDLKNGVVHNGVVIVSSSNDVRSLKVGKSLESRKTFKSPVAASSLSFI
                     PYVEAEGEVKVATVSVNLLASGDIAILSVPDFKEISSLRVPIASRSQFLSGSSILRNG
                     DLIVRTNQSQASLLSIVNEQATGLNKHYDLKSESATDQLYNPGLKIPYRPQVNSLQWA
                     RGTMYCTIDQLDKLLGGEYRPQSKFEESIIAKGTLSTKPEEKSSIDSETDYKRPTRSG
                     SRSSRYGVFKSVSRAVENRMDAIEDTFNDYATAMSESVNDVVEQTTKDMAKGAFGL"
     gene            complement(<769021..>772491)
                     /locus_tag="HG536_0B04180"
                     /db_xref="GeneID:59324673"
     mRNA            complement(<769021..>772491)
                     /locus_tag="HG536_0B04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282334.1"
                     /db_xref="GeneID:59324673"
     CDS             complement(769021..772491)
                     /locus_tag="HG536_0B04180"
                     /inference="similar to AA sequence:RefSeq:NP_009445.2"
                     /note="ancestral locus Anc_7.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138229.1"
                     /db_xref="GeneID:59324673"
                     /translation="MYTQVEQDIQKKIERECNIIQGATHLKKRTQNAMVIQKCNANIR
                     EARQNIEYLEETLKKLRLSSSGRNTLNQAEDDAQGHGSKGYRHLSTISPEEHSFSRLD
                     LIKYDCPSLSQKIQYMLQQLEFKLQVERQYQEANAKLTKLYQIDGDRQSSSAAEGGAM
                     ESKNRIQLLTKALKKYQAINVDLDPFKQHDADSLNHQPKFRRKQLTGELTIGVNVVRD
                     VDHIESPMFSRKPESYATIKIDDTVKARTRASRNDRWNEEFQIHVGKGNEVEITIYDK
                     VNDTMIPVAVMWLLLSDVAEEIRKKKAGQTSDQNGWVNARVISTYSAAADSNFNSATN
                     IPITDPSSRTSATTQSNGEQNTSSATSPGRITTNSWFTLEPAGQILLTLGFNKSSQPQ
                     RKNLMGGLHRHGAIISRQEEVYEQHGHHFVQKSFYNIMCCAYCGEFLRYTGFQCQDCK
                     FLCHKKCYNNVVTKCIAKTTTDSDPDEAKLNHRIPHRFEPVSNRGTKWCCHCGYILPW
                     GRQKVRKCSECAIMCHAQCAHLVPDFCGMSMEMANRILRTIQDTKRTQEKKKRISPSI
                     HVDSSASTAVSRNTSPIKSEEKFSPQSKEAYIVTTKGQATEEYDQHVASIHTKPLPLP
                     GTQLDEKLNSFIDQNEAYLNFTQKGGLEYEPRSLDPSVSNKSKAADLLDEKSDDAYHS
                     KGTWESWKANERLIYDDSYNNQEEVDVQMEENLEENLPHTEVRKVEVERIDQDKEENK
                     TSEEIMANVLQKISTEPEVQHVNPFREMNDEMFKREQAAVDLAAETNSLQNVETHVSK
                     GSVQSSPNKAHTAVKHRRKAPKRRKVSLDDFILLKVLGKGNFGKVLLSKSKNTDRLCA
                     IKVLKKDHIIQNHDIESARAEKKVFLLATKAKHPFLTNLFCSFQTENRIYFAMEFIGG
                     GDLMWHVQNQRLSVRRAKFYAAEVLLALKYFHANGVIYRDLKLENILLTPEGHIKIAD
                     YGLCKDEMWYGSKTSTFCGTPEFMAPEILKEQAYTKAVDWWAFGVLLYQMLLCQSPFS
                     GDDEDEVFNAILTDEPLYPIDMAGDIVQIFQGLLTKDPEKRLGAGPRDALDVMDEPFF
                     RNINFDDILNLRVQPPYVPDIKSPEDTSYFEQEFTSTAPTLTPMPSVLDARQQEEFRG
                     FSFMPDDLVL"
     gene            complement(<773022..>776015)
                     /locus_tag="HG536_0B04190"
                     /db_xref="GeneID:59324674"
     mRNA            complement(<773022..>776015)
                     /locus_tag="HG536_0B04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282335.1"
                     /db_xref="GeneID:59324674"
     CDS             complement(773022..776015)
                     /locus_tag="HG536_0B04190"
                     /inference="similar to AA sequence:RefSeq:NP_009446.2"
                     /note="ancestral locus Anc_7.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138230.1"
                     /db_xref="GeneID:59324674"
                     /translation="MGLIKKVTTWSYDGLLDYLSVNPTRDEVTHYKVDPEIDEEKSIM
                     KLRTARDFGSITCLDYSDLDVGLIAVGEKTGFVRLFNIIMCDNPELDSIDMKVRPKQQ
                     RCINTLGMNENGLVAMGLDRNRNDASLQVWDINYQSKNSTIINPTFSYCTNESIVSSK
                     FFDDTGLIVASTKFIKEIDLRSPNPICQHPSRLSYDVKLNPFNFWQFSTYGDDGTVAI
                     WDRRRLVAPTNSSDLNVAEPLLTFEKLLGVGAASKKYMNSCFRWSTGRNREFATLHRG
                     DTIKRWWLGSCGTKADAENEIEELFVSTVHDISTTFDRVVTFDYIPQSEHKTSLLCMR
                     QSGTVYRMPVNQSFSTTRFNNHNSLLLSNCESSSIAEFRVTETSEKSNFESKALRNLC
                     FEDLDISDDYSAEKSGESEADNSSASSNEDEDIRSLYQDGSWKPEKLLQKDISVIMKA
                     RAMLGYGLDPVATVAMIDGSKMLQNNAYLRNTWRWIAIAKASVEDGTMVSGDLDLGYE
                     GVIGIWNGLKGISNQNRFPEGRILNDDHLNNHMEKIIKVRRKQKNVSGSIPPADKFSN
                     SRKSVQRKLCLILSGWDLLPVDYEEKYQNIIKTGSYEKAAAWAVFFGDIPKAVEILAS
                     AKKERLRLIATAIAGYMAFKDQPGNNSWREQCRRMSSELDDPYLRVIFAFIADNDWWD
                     ILYEPAISLRERLGVALRFLNDRDLSKFLERTAATVIENGELEGLILTGITPSGIDLL
                     QSYVNKTSDVQSAALISIFGSPRYFRDRRVDAWVQTYRVMLNSWQLFSMRAKFDCLRS
                     KLSRTGSGQVTADVKPRQMYMQCINCKKNINRPSAISGGTQAPPIPAGFATADNASRV
                     QNVFQKSKKYGMPNTLSPLTQQRKNSSCPHCGTPFPRCVICLLPLGTRGLPFVIEGVG
                     SMPADSDSKQDSSSKAEKLRDSSGGPDIIAVNDGEYQRRKQKINEWFSFCLSCNHGMH
                     AGHAEEWFERHNVCPAPGCFCQCNK"
     gene            complement(<776157..>778346)
                     /locus_tag="HG536_0B04200"
                     /db_xref="GeneID:59324675"
     mRNA            complement(<776157..>778346)
                     /locus_tag="HG536_0B04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282336.1"
                     /db_xref="GeneID:59324675"
     CDS             complement(776157..778346)
                     /locus_tag="HG536_0B04200"
                     /inference="similar to AA sequence:RefSeq:NP_015356.1"
                     /note="ancestral locus Anc_7.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138231.1"
                     /db_xref="GeneID:59324675"
                     /translation="MQRGFRDNGPKLREEKQLEDLYCDLDKDTLIPIVRPDQDAPGDA
                     PELDNGHSRVLNDDRGHLKQLIFNGKTTLERIRLHHKRTRFKKCKYSISQLGDDKQVN
                     HLLGKKSKISSQGGSTFSEDQTPYLNKFSAPIGTAEEILKLPANLEQISSNLTDLVVE
                     YDMDEQDDLYLQFLNDKCCQMKMNEEIFELLISAVEKEWTHLEKLIPPKSLVVEESPS
                     GHRSETTRLHYELFGSDDGTERTTDQPCAVCGGADSDNANAIVFCDGCDIAVHQECYG
                     IVFIPEGQWLCRRCLVSKNRKVSCLFCPSHTGAFKQTDTGSWAHVICGLWIPELYFAN
                     LHYMEPIEGVENISKSRWKLVCSICKQRTGACIQCTNKSCFTAFHVTCAKRAGLYMNF
                     GGASISEVASNQAAGLRMLSCFCRKHSPPGWPDTTKGILQTRRYFAEYNDSEISTNLH
                     LNQGRGGTKFGSANNKWKTNRGTPIAPNIFADHLSKIIASYGIPNAESTAYNICKYWS
                     MKRELKRGGPLVRKYDPSSSNLLNEAQLQERINVTDILLKDLQKLRELSSLTRKRTSS
                     WNSMKEVSYRVECLSRNPESYLMKEVVVDKFLESEVFKKIERSLTDNTMISKLIECKS
                     YDVHSNESWEVFPSRMNTILSSLEEEPSSTRAFRNLVRKARTLLELLLGKFETADVTK
                     RLHEDFIIEGDKVLVRPWKGQILKEQEELSDVEELKPQEVKLLKKLI"
     gene            complement(<778714..>780666)
                     /locus_tag="HG536_0B04210"
                     /db_xref="GeneID:59324676"
     mRNA            complement(<778714..>780666)
                     /locus_tag="HG536_0B04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282337.1"
                     /db_xref="GeneID:59324676"
     CDS             complement(778714..780666)
                     /locus_tag="HG536_0B04210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138232.1"
                     /db_xref="GeneID:59324676"
                     /translation="MMAIKSRLRQIVHVVRRKNSRVLRICMVVLLTTLIFIGLHQGSD
                     YIEIDLLSNITYLNDYKAETNGTVSFDASKLRNVLKLTMDEIRRLSPQDEIDRTRGKD
                     CRIGDIQIENSHDLDIVSRAELLKCVELHTSTKDKLKDLHRAFLHTMKDKIIPRFHKE
                     MYVGSGIVFVAGGKFTMHVMPAIKAIRANAGGEIPIEIMIPPENTGESSFCDNVLPLL
                     DPSGLTRCVFMETLFDSTTLGSVKGYQLKALALLASSFRKTLLLDADNYVVNPINKMF
                     NCPIFDEFGLALWPDYWRRLHHPGVYDIAGIEVDTTKRTRYSVDNVSPAERYKVNDIG
                     KVPFHDLDGAIPDGSTESGQLLVDKHKHLDTIILSLYYNYNGPSYYYPLLGQGFAGEG
                     DKDTFAFAAKALSANGIHRNYYQVKAPVRAMGYWANKKDEVKILSEDRISADEQAFRG
                     VAMIQHDLNADFEAYKKARQELHSKPMEELRALREEAFLSEVSADFTDIDKVFWQEQR
                     KKGYDVKGFLSFFKEVPVSFIHSHLPKYDPWEYAANEDMMFDGRKTASRHEDEPNFTP
                     AHHGHFRMYNDEFPKLTNYDLELSNWLCFQKYVCQENGYKNFNYLLQKVEKVQGGHKS
                     LEHMCDYINKRVEMLLATTWEGSKVM"
     gene            complement(<781140..>782585)
                     /locus_tag="HG536_0B04220"
                     /db_xref="GeneID:59324677"
     mRNA            complement(<781140..>782585)
                     /locus_tag="HG536_0B04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282338.1"
                     /db_xref="GeneID:59324677"
     CDS             complement(781140..782585)
                     /locus_tag="HG536_0B04220"
                     /inference="similar to AA sequence:RefSeq:NP_009447.1"
                     /note="ancestral locus Anc_7.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138233.1"
                     /db_xref="GeneID:59324677"
                     /translation="MDNDGRGDGQGDSSGAAASHLSLPAEYGGGKFSFATGFEDDLPT
                     GQACSSDAPAKQRERLLYVKKEEADISPYLSMSHSQLNSSISFLDDKFSSSLLDGRQS
                     VTDGSRNSISNNQHWGSFSNGAQNGPDTGQQSASFKNDELDLFFRRNDDALSSLADDL
                     SSSFGSSLHSDLLASSYDSFQYQPQSLNGPSAGQTLSAHFSPPVRSPSSSVRAGSHLS
                     ASLRNGSAGTPGLMGTPRTRHASLSGNYYPDGYLSASVPKNLTADERLKRKREFHNAV
                     ERRRRELIKQKIKELGTIVPPSLLNYDMSGKQVKPNKGIILNKTVEYLEYLLQVVEIQ
                     ERRKKQLLNKMKELEEKKERLASSQLAEQNRGSANNTTERPASHEPASLTKSVAQSDF
                     TDIDVDVSNERIIDTRAKPHPHNFGVSQPWGESNSFGLMDNILSNSEHNLPLHDDLQQ
                     FLSGDLIEAEDNAKLMFNSGDRAEYLLDFDS"
     gene            <782919..>783563
                     /locus_tag="HG536_0B04230"
                     /db_xref="GeneID:59324678"
     mRNA            <782919..>783563
                     /locus_tag="HG536_0B04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282339.1"
                     /db_xref="GeneID:59324678"
     CDS             782919..783563
                     /locus_tag="HG536_0B04230"
                     /inference="similar to AA sequence:RefSeq:NP_009448.1"
                     /note="ancestral locus Anc_7.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138234.1"
                     /db_xref="GeneID:59324678"
                     /translation="MSDTANGQVNSLRESLNRWNQSRSQNSQGFNESAKTLFSSWADS
                     LNTRAQDVYQRLPISRQDLVQNQEPSWFNISRTERLLLFVCFILGSVACFTTCIFLFP
                     VLAVKPRKFGLLWTMGSLLFVLAFGIFMGPMAYVKHLTSRERLPFSVFFFATCISTIY
                     FAAIRKSALLTIPCAILELIALVYYAISYFPFGSTGIKVISSVGVNSARGALHI"
     gene            complement(<783633..>786833)
                     /locus_tag="HG536_0B04240"
                     /db_xref="GeneID:59324679"
     mRNA            complement(<783633..>786833)
                     /locus_tag="HG536_0B04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282340.1"
                     /db_xref="GeneID:59324679"
     CDS             complement(783633..786833)
                     /locus_tag="HG536_0B04240"
                     /inference="similar to AA sequence:RefSeq:NP_009449.1"
                     /note="ancestral locus Anc_7.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138235.1"
                     /db_xref="GeneID:59324679"
                     /translation="MIEASRQFAMPYPLPRPIPSLADRDGEDHVFSTLGGLRPRSVSP
                     TKNVGNRRRSSTIKSTLFSIFGAAGGSGSHQRGSSLPRSSSTLSVGCGETAVEEDEKS
                     RRKSAAGGELGCLRHSRGSFNGAISAPSSPEQSSANEAEEGTASTSSCQRDGVVDGTT
                     VGGNSTTCSSTSNPSRGSLKSFGREFLCEYLTERGLLAPKIISETPDIRISIATSGDH
                     VFLPTMSSSDDEYLARLNGLRSDEEEAVEVEPDALQDRPLGNTPDVPSHSLPGFSDST
                     SLNDERAIEDDTDDASDELPGGLETGGSDTRTCQRMSSLTSTSVATPAFEIDNSMATC
                     TMAVILSFPKVTTLGNIRGELCSRVRVYWHNGVPPTKSFYEEFYCAGSLEWELNTNNA
                     NLYVPLNVSSDEKIIENNRNLRPMKLFKNNSTEMRPYLDKNQTRTNLLKKVKLRKSQV
                     FQPGDYVFIIPVVFSNHIPETLYMPSARVDYRFRIATKISSDDQTAVPGTDMDRGRQT
                     ETDQPSGRRFSNAIKKFKNNLHVMNQAQTKSDELNEIYSEYPIDVVRTPPLISISTAN
                     KPVYINRVWANSLSYEISFGQKYVPLGSKVPVKIKLAPMCKGIYLKRLRVSVIEKITF
                     VSKNYEYEYDQIDPVAKDPYNPYFSDFASRRKKERNISLLEVRTSEKGSRAIREEIVE
                     NCINDNLLAYAAADSDDGQPIIGIAEPLMVETVLEFPRYEDLNKKTARTVPPYGIDVY
                     TSVPNPEAASHVPTHRSGVMGFLVNRRPSLTHQSKGSSDSGQLGRPQSDENFHETTLR
                     SNSGIPVQFHTNLNKTKRGLYLDSLNFSNIYSKHKLEFMLRISKIDDTNPKRLRHYEV
                     LIDTPVFLVSELCNNGNMELPTYDMAIKKQPPLEADADAALPPTFEEAISVPGSPIQS
                     PIVSPFGSPNVRSRYDADDLSIQQLSLSRSNSIAGPSETIPSSSHQMSLSHPMEANTR
                     FNNLDGILSTNAANNTDSGASSGANEPASFVTSQEPTHGSGIFKSRYSLTQNSGPPKD
                     DEDHGGTSEEEIPDSGPTASPPPGYDEVIPLMSDEE"
     gene            <787325..>789814
                     /locus_tag="HG536_0B04250"
                     /db_xref="GeneID:59324680"
     mRNA            <787325..>789814
                     /locus_tag="HG536_0B04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282341.1"
                     /db_xref="GeneID:59324680"
     CDS             787325..789814
                     /locus_tag="HG536_0B04250"
                     /inference="similar to AA sequence:RefSeq:NP_015354.1"
                     /note="ancestral locus Anc_7.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138236.1"
                     /db_xref="GeneID:59324680"
                     /translation="MAGSSLRSFIKDVRGAKTVAEERAIVTKASAKIRTKLRDDHLPL
                     EKRRNNIQKLLYLYILGEKTHFGQVECINLIASDDFADKRLGYLAAMLLLDESQDLLT
                     LLTNLLNNDLNHPNRFVVSLALTTLGFLSSSELARDLYPDVESILNTSKDPFLVKKAL
                     QCVAKLVMTDSSLLEIFQPQLLLSLLNNQSICTHGVLLSIAKVLQAALSGFSMHHKRV
                     KENEPTADTTGILRQLLGAVPELLDLLQNLNVKNFEPEYDIQGTCDPFLQCELLYTLR
                     LFFQVCFEFKITEIDQYSNKFNDLLTQIATNTDSGKNCGQAILYEATRTIFSLNLNQP
                     SRVLGINILAQFLSGKDNNTKYVALSTLLKVVPQEPVAVQRHRKFISRCLRDPDVSIR
                     SRALELAFAILNDVTMVELTEQLVEFLKNASDDDKNLIVYTVEYLVRAFEIHTSVDEK
                     WKLETLITVLKLVGNVISAETVSNLLVFINNASCPQERCELVAEMLKLTLDDSKRSEI
                     SEHNVGWNLVTIWCVGEYGGEILGNKADAKISERSLTKYLVDQHAASDRNDNKIVHYL
                     LTAALKLSAHVNDPGCNESLRQILVSRSRDADLMLQSKSVQYEIIFRQPLKVKKPILD
                     SMPKFEKKIDAATQKPSKIASQSSASQPESSDLLDLLGEKQPSHSPQPQPSVAQSSTS
                     VLSPTDLLADIFGSNGTNGKPSSDKDLSERNSSTLEVPAGSTKIHESAAAECYITLKS
                     CGDGAAQMELYLKAKTNLQNVQTFCAVPKTQKLTLGQIQPGNTLVSHQVARQNLKVVG
                     SGRLKLRVKLNFAADGNDSSEQFDHKFDQAL"
     gene            complement(<789904..>790509)
                     /locus_tag="HG536_0B04260"
                     /db_xref="GeneID:59324681"
     mRNA            complement(join(<789904..790392,790459..>790509))
                     /locus_tag="HG536_0B04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282342.1"
                     /db_xref="GeneID:59324681"
     CDS             complement(join(789904..790392,790459..790509))
                     /locus_tag="HG536_0B04260"
                     /inference="similar to AA sequence:RefSeq:NP_015353.1"
                     /note="ancestral locus Anc_7.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138237.1"
                     /db_xref="GeneID:59324681"
                     /translation="MSDLGSSIQSQLKSFDTRFSSNHILQELENRTKLPKSYLAIGAA
                     FVYLLLIFINVGGIGEILANIAGFVVPAYLSLIAVKSAGKEDDTQLLTYWIVFAFLNV
                     IEFWSKAILYLVPFYWFIKTVFLLYLALPQTGGANMVYNVAISPIADKYILPRNKKTD
                     DIRAAVSEAAGRTTGASVH"
     gene            complement(<792207..>792773)
                     /locus_tag="HG536_0B04270"
                     /db_xref="GeneID:59324682"
     mRNA            complement(<792207..>792773)
                     /locus_tag="HG536_0B04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282343.1"
                     /db_xref="GeneID:59324682"
     CDS             complement(792207..792773)
                     /locus_tag="HG536_0B04270"
                     /note="Ty like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138238.1"
                     /db_xref="GeneID:59324682"
                     /translation="MVEPVIMSNQNIPNASKPPKFSGQGEPLAVAAFMTRISIHLRRF
                     EFTDDYEKILYFADCLTEGAALWFEGLTGESLRQGTFNDFIGRFKRKYYSEHQVDSIL
                     THLRYCKQQGSLESYNKEYNALSAAIPDELLSPKCKQSFYLSGLEKSLQITVRNLRPD
                     LLETAMILASSPMRTARSDDSTRNKMAL"
     gene            793115..793208
                     /locus_tag="HG536_0Btrna1F"
                     /db_xref="GeneID:59324964"
     tRNA            join(793115..793152,793172..793208)
                     /locus_tag="HG536_0Btrna1F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:59324964"
     gene            complement(<793475..>797071)
                     /locus_tag="HG536_0B04280"
                     /db_xref="GeneID:59324683"
     mRNA            complement(<793475..>797071)
                     /locus_tag="HG536_0B04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282344.1"
                     /db_xref="GeneID:59324683"
     CDS             complement(793475..797071)
                     /locus_tag="HG536_0B04280"
                     /inference="similar to AA sequence:RefSeq:NP_015351.1"
                     /note="ancestral locus Anc_7.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138239.1"
                     /db_xref="GeneID:59324683"
                     /translation="MSGGEHLSESSGSRVHTPPALENRSKDKKLLYFLLTIIMITLIA
                     MLVFFSSFLTYVSGLSATSNNVLQHQQGYIQEACLESHSLYRNENARKASRKLYELLC
                     DFGDAIYDEDNMILGSTKMYPNTYSKQPYVSNGYIGSRIPNVGFGYALDALNLWTNSG
                     EEIPGALDNGWPLRNRRYAGAFVSDFYCLQKKLNSTNFPELDDKGYSTVISVIPQWTN
                     LQFSINDSIWFNPQNVTVNDVTNYNQNLSMRNGVVTTQLDWLKGMLNVKSEVATHKKI
                     YSLGMVSLEISLNLDRLPSEVPHIDLNVYDFLDFGTSQRTVLQDLGFDKNNNGIYMIV
                     EPENVPESNAAIFSTCTIQDPAGSNISTFDWAQEYSNDERVAQSSHVRLTRDSPKAVV
                     RKYVGIMSSEFNKNGASDVSNIEFATTIATASRGRFEELISSNTEAWERIYNDAFIEI
                     PSDALLEMAARSSLFHLLANTRTFNVSDERGLPVGVSGLSSDSYGGMVFWDADIWIQP
                     ALLPFFPNIAKNINNYRNATHQQARENAKLNGYPGAVYPWTSGRYANCTSTGPCIDYE
                     YHVNVDIALASFSIYMNGAQGVDEDYLRYTTWPMVKDAADFFTAYVKFNETLGKYETY
                     NLTDPDEFANHINNGAFTNAGIKTMLKWATDIGNHLGEYVDPKWMDISKRIYIPRSCS
                     NITLEYSGMNSSIQIKQADVPLMVYPLGYITDESILNNAIKDLYYYSERQSATGPAMT
                     YPVFVAAAAGMLNHGSSSQSYLYKSILPYLRGPFAQFSEQSDDNFLTNGLTQPAFPFL
                     TANGGFLQAILFGLTGLRYSYEVDETTKKISRLLRFSPIEMPLLPGGIAIRNFKYMGQ
                     VLDIIIDDHNGTIVHKSGDADIKVKVPDRSLIRDRDITRYEGPNTTHHKDCFNDYSEE
                     GGGDKPVSAFGTYYTIKPGQELVLPLFRPALNVPGNIVESKQVTNLTAGVPGDVPFSA
                     LDGNNYTHWQPANKYKTAKLLIDLGENNFQEIKSGIILWGQRPAQNLTVAILPHASEI
                     ERLFSNLTEVLETTDADLTKEDEEISEVLEDAGEDISEIETDACDEDIAAILSWKTNG
                     IEGFLDNLKESHLLSKHFVRIVDNLQIEPSEPYFQEVYNKSLIELLPSNITEFYVDYD
                     SLQLNNNPCCFEESINTTEWRKTRFILVSIQGSYDDDIDIRGGTIKEIVLKN"
     gene            <798137..>799777
                     /locus_tag="HG536_0B04290"
                     /db_xref="GeneID:59324684"
     mRNA            <798137..>799777
                     /locus_tag="HG536_0B04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282345.1"
                     /db_xref="GeneID:59324684"
     CDS             798137..799777
                     /locus_tag="HG536_0B04290"
                     /inference="similar to AA sequence:RefSeq:NP_009453.2"
                     /note="ancestral locus Anc_7.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138240.1"
                     /db_xref="GeneID:59324684"
                     /translation="MLARTAAIRSVTRSFVNVARVARVARPATIIAGRRYATAKAQPT
                     EVSSILEERIRGVSEEANLNETGRVLAVGDGIARVFGLNNIQAEELVEFSSGVKGMAL
                     NLEPGQVGIVLFGSDRLVKEGELVKRTGKIVDVPVGPELLGRVVDALGNPIDGKGPIK
                     ASGRTRAQVKAPGILPRRSVHEPVQTGLKAVDALVPIGRGQRELIIGDRQTGKTAVAL
                     DTILNQKRWNDGSDESKKLYCVYVAIGQKRSTVAQLVQTLEAHDALKYSIIVAATASE
                     AAPLQYLAPFTAASIGEWFRDNGKHALIVYDDLSKQAVAYRQLSLLLRRPPGREAYPG
                     DVFYLHSRLLERAAKMSEKEGAGSLTALPVIETQGGDVSAYIPTNVISITDGQIFLEA
                     ELFYKGIRPAINVGLSVSRVGSAAQVKALKQVAGSLKLFLAQYREVAAFAQFGSDLDA
                     STKQILTRGERLTQLLKQSQYAPLAAEEQVPLIYAGVNGYIDGIELSRVAEFESSFLA
                     YLKANHEDILSSIREKGELPKDLLEKLKSATESFVATF"
     gene            <800053..>801147
                     /locus_tag="HG536_0B04300"
                     /db_xref="GeneID:59324685"
     mRNA            <800053..>801147
                     /locus_tag="HG536_0B04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282346.1"
                     /db_xref="GeneID:59324685"
     CDS             800053..801147
                     /locus_tag="HG536_0B04300"
                     /inference="similar to AA sequence:RefSeq:NP_015350.1"
                     /note="ancestral locus Anc_7.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138241.1"
                     /db_xref="GeneID:59324685"
                     /translation="MTSIRQQTPVSDGKASKDSSTEKPSNYKRLSDDDLFRHSSQYRF
                     WSFTPEQLEQKRIQVNAQAVQSIEEDLRNFVADNKTDLNEEEIKTIEMKAVPVTAEEE
                     LKLINLYAKKVQMIAQRLNLPTEIVATSITFFRRFYLENSVHKFEPKAIVLTTIFLAC
                     KSDNYFIGIDSFCEKTRGSKEQILKYEFPLLESLKFSLFNHHPYRPLHGFFLDIQAVL
                     HGKVDLSYMGHIYDRCKKRITEALLTDAVYFYSPPQITLSALMIEDEALTTRYLELKF
                     HGNNPDSSADEQKTISQDISISLEKLMTLIRDCKKIIEQSTNTSVEEAKSIAARLYFC
                     QNPEDLLKKLKKRKHDEQDSPRAEKKTRVE"
     gene            complement(<801402..>803657)
                     /locus_tag="HG536_0B04310"
                     /db_xref="GeneID:59324686"
     mRNA            complement(<801402..>803657)
                     /locus_tag="HG536_0B04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282347.1"
                     /db_xref="GeneID:59324686"
     CDS             complement(801402..803657)
                     /locus_tag="HG536_0B04310"
                     /inference="similar to AA sequence:RefSeq:NP_015349.1"
                     /note="ancestral locus Anc_7.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138242.1"
                     /db_xref="GeneID:59324686"
                     /translation="MSLINLLTSSVARNGVVSMLGRRSPVIGVALLSRVSRRQERILN
                     LQGSIVNSRRFYVKNIDEKGENGSGGDKDASDVTRGAVKAGSVPLGSAASSATAAQSV
                     SHAILATKEQEANKDLTNPEAQAAFYRLLLRSNYPQYVVSRFETPGIASSPECSELYM
                     EALQRIGRHSEADAVRQTLLTASSAGAVNPSLASSSVSSSAYHGTFPSLYSPSYGSRK
                     EPLHVVVTESTFAIVSRWIKWLVIFGLLTYGVSEAFKYVSENTTLLKSSEVADKSVDV
                     AKTNVKFDDVRGCDEARAELEEIVDFLKDPAKYESLGGTLPKGVLLTGPPGTGKTLLA
                     RATAGEAGVDFFFMSGSEFDEVYVGVGAKRVRDLFTQARARAPAIVFIDELDAIGGKR
                     NPKDQAYAKQTLNQLLVELDGFSQTSGIIIIGATNFPESLDKALTRPGRFDKVVNVDL
                     PDVRGRADILKHHMKKITMAADVDPTIIARGTPGLSGAELANLVNQAAVYACQKNAIA
                     VDMQHFEWAKDKILMGAERKTMVLTDAARRATAFHEAGHAIMAMYSAGATPLYKATIL
                     PRGRALGITFQLPEMDKVDITKKECLARLDVCMGGKIAEELIYGKDNTTSGCGSDLQS
                     ATGTARAMVTQYGMGEQVGPVNLADKWESWSDKIRDIADKEVLDLLKQSEERTRKLLT
                     EKSVELHRLAEGLIEYETLDAKEIEKVCKGEKLNKLKATTNLVVEGPDSDERKDIGGD
                     KPKRPALLGAS"
     gene            <804179..>805663
                     /locus_tag="HG536_0B04320"
                     /db_xref="GeneID:59324687"
     mRNA            <804179..>805663
                     /locus_tag="HG536_0B04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282348.1"
                     /db_xref="GeneID:59324687"
     CDS             804179..805663
                     /locus_tag="HG536_0B04320"
                     /inference="similar to AA sequence:RefSeq:NP_009454.1"
                     /note="ancestral locus Anc_7.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138243.1"
                     /db_xref="GeneID:59324687"
                     /translation="MAKITNLTALSTGRLTAKKALKGLVAMSESVAVVGAGLVGCLAA
                     IALAKRGYKVTVFDYRKDPREKSTTDRNLRSINLAISSRGITSLEFVDVEMAERVLKD
                     IIPMKGRMIHHLNGREESQIYGLFGETINSIDRAVLNNYLLDELDRFDSDKVQLKFSH
                     KLKKIKFRDPKELQSCVFSTDDGVEQVYGVNFIVGCDGCYSTTRDQMQREVRMRYSQE
                     YIDCCYIELYIPPSKTYVEEFRGNFSLTPDHLHIWPRHKFMLIALANKDGSFTSTFFG
                     PWKLVESLLESRSRVEEFLQENFPDAMALMGLENAVQCFMTYPKGALMCVECEPYHVP
                     GGRCIILGDAAHSMVPFYGQGMNCGFEDVKVLMKLLDANHGDRAKAFQAYTETRHRDL
                     TAIIKLAVRNYREMSHDVTSMAFLLKKKIDSWLGKLLKDTWLPLYTMVSFRADIPYSK
                     AVAISNRQNKILNVIQALVVASVSVLGYKALRLCYPIIRRLKRS"
     gene            <805944..>808199
                     /locus_tag="HG536_0B04330"
                     /db_xref="GeneID:59324688"
     mRNA            <805944..>808199
                     /locus_tag="HG536_0B04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282349.1"
                     /db_xref="GeneID:59324688"
     CDS             805944..808199
                     /locus_tag="HG536_0B04330"
                     /inference="similar to AA sequence:RefSeq:NP_009455.3"
                     /note="ancestral locus Anc_7.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138244.1"
                     /db_xref="GeneID:59324688"
                     /translation="MSARMPYDNYDNDDQGLFTNRSMMMANFEEWIKMATDNKINSRN
                     SWNFALIDYFHDLNVLRDSENNINFQKASATLDGCVKIYSSRVDSVTNETGKLLSGLA
                     QKKLSEKQRHADQNNVDGGEGGNGPEESAEDDIQIDPSTGLPIARGDDVRTKRRVHNR
                     VLETTLVDFDAIKMKELDQELNIDPLFKKALVDFDEGGAKSLLLNTLNIDRDVRVVFD
                     AALRDAKEKDTGGTDGHQREAEDHGIDGSDSVTDMDSGAHERSNGSNTDITNNSIIIE
                     DEILALGMDYIKFEDISKCLISTSMQQLPKVVEDITKAKTFIDGVNSKFDNFLSEKEL
                     EEAVPDLGLDEMEEDNNILQDEFDDQQSDGSSYGQEDANDHNDDDTGNNLDAKDPSTL
                     EDEEAGLAGIYEQDLMAYFDENLTKTWRGREHWKVRNFKKNMIKGVENNKALGQDKDG
                     NELTASDEATKKKNKKTSQEIDFFALDDRLEEAVFASKKRTNIELPQKSRTNASHYLL
                     PDDFHFTTQRITRLFIKPQQTMSIFRPRRGKRPGRQEGHEARLNNSTIEDRHADRAST
                     PIADEQFWADNYQRIDRENDQQPSEEPVNIVTKGPENPFEEDEGGVDFNQAFEDEEIK
                     DDDPNLLPSEATAKFSLPDNKVNFSRVSKKVDVKKLKDNIWSSIKTLANRYKSQKTDE
                     STIDEGTLRFSEIAVELSKTYKTEAKKDISTSFCFICLLHLANEHGLKVTSMEDYEDL
                     LVEFPYSSLQA"
     gene            complement(<808348..>810321)
                     /locus_tag="HG536_0B04340"
                     /db_xref="GeneID:59324689"
     mRNA            complement(<808348..>810321)
                     /locus_tag="HG536_0B04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282350.1"
                     /db_xref="GeneID:59324689"
     CDS             complement(808348..810321)
                     /locus_tag="HG536_0B04340"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138245.1"
                     /db_xref="GeneID:59324689"
                     /translation="MSDSSSAEDVHGTTSHHDARDEKMENINNESLFKPRMGESSSND
                     LENDSLVDGDVNSAGDGNVLGQYSVKQVMQMGRHFAEKHGLPNDDDIFARAAALARDP
                     NRYDHMDFLSEDERIACYDESHRPWTSMTRTLIAIICASAMSAGVQGMDETVINGAML
                     FYPKVLGLGSGSDRDNWIEGLINGAPYLCCAGFSCWTTDWLNNRMGRKNVIFFTCLVS
                     AISCFLQGFGPVGESGWHYLLAMRMLLGVGIGPKSATTNVYLAECASKQIRGSVTMMW
                     QLNTAFGILWGYVFSLIFYHVGPHGIAGGLNWRLMLGSAMIPALFVMVQIPFCPESPR
                     WLMGKGRYKEAFDNTVKIRPHKILACRDIFYQHILMMEEESLQLPFATRLKEMITVRR
                     NRNGLLASCVCAFMQQFCGINVIAYYSSTIFVESGFATLNALLASFGFGLINTVFALP
                     AFLMIDRFGRRFLLLRTFPWLALFLLIAGFGFWIPQDRGDAKIGVVTMGIYVFSAIYS
                     FSCGPVPFIIAAESANLASRSLNASIFTVVLWGFNFILSVTWPSMLKAMKPQGAFGFY
                     SFWNVAGFFMVYFFLPETKQYTLEELDEIFDVPLRKRVAYEFKEMWPNFQETILRKKN
                     VKRQPPLIPHHRIALKSDEWNDKATTEFVEDAK"
     gene            <811055..>811798
                     /locus_tag="HG536_0B04350"
                     /db_xref="GeneID:59324690"
     mRNA            <811055..>811798
                     /locus_tag="HG536_0B04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282351.1"
                     /db_xref="GeneID:59324690"
     CDS             811055..811798
                     /locus_tag="HG536_0B04350"
                     /inference="similar to AA sequence:RefSeq:NP_009457.1"
                     /note="ancestral locus Anc_7.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138246.1"
                     /db_xref="GeneID:59324690"
                     /translation="MNPTAAIIGKGLLLPAFGFTLGLGYFIKAWPDEAGSMTLQDSDS
                     SRKRGQSNLQLQRHDVVEKIARHGLYQKLMKDPNFDHSLQSHKIPPGHRAYHVGQGIL
                     FGPDKLAIDPLILADTKRHEVVIFYHLGKDLGNENGKIHKGVLSLILDEALCYCGFPT
                     LPSKRGVTAKLDIQFDKDIPADSTVVLRARVSEFKGRKCVIEGTLESLPRVSNSWINA
                     LWGPSQYARAKCILVEPKWFKYISWLNVF"
     gene            <811832..>813388
                     /locus_tag="HG536_0B04360"
                     /db_xref="GeneID:59324691"
     mRNA            <811832..>813388
                     /locus_tag="HG536_0B04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282352.1"
                     /db_xref="GeneID:59324691"
     CDS             811832..813388
                     /locus_tag="HG536_0B04360"
                     /inference="similar to AA sequence:RefSeq:NP_011048.1"
                     /note="ancestral locus Anc_7.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138247.1"
                     /db_xref="GeneID:59324691"
                     /translation="MCHEFSRLKWLCAKRETKAGQIELKSYSQHPGNSVRASMSGEEG
                     EAFANKELTTQVFQRLASKLENRVCFDCGNKNPTWTSVPFGVMLCIQCSAVHRNLGVH
                     ITFVKSSNLDKWTVNNLRRFKLGGNHKARDYFLKNNGQQYLNTSNVDARVKYTSSVAK
                     RYKEHLDKRVKKDSELYPSELVLLEDDLENGSSTDPSSLGGSKENSVEDFFSTFQKPA
                     STPSAINNSRQGSSSPKVLTPSSTGGQASKTNPRSSLLAGSRKKTPSSGSGSKKHSIL
                     SSSRKPTRFTANKVDKSEADDLFEQYAKEAEQEKVEKQSAGFASSQRSKPTYKASKIG
                     EESEDIFHSTKKDNSFLDDLDDNDDFKAPSGPVEELKPKFAKLGFGMTMNDADELAKQ
                     QKEQRTAKTGMNYTGKIAAKYGSQKAISSDQLFGRGSYDEDASNEAKQKLKSFDNATS
                     ISSSSYFGEEEASQTDEFGRQQSFGSQSNNNGFVDFHLGNEDDLQILKDAVEQGAQKL
                     GNYLRDYLRK"
     gene            complement(<813482..>814096)
                     /locus_tag="HG536_0B04370"
                     /db_xref="GeneID:59324692"
     mRNA            complement(<813482..>814096)
                     /locus_tag="HG536_0B04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282353.1"
                     /db_xref="GeneID:59324692"
     CDS             complement(813482..814096)
                     /locus_tag="HG536_0B04370"
                     /inference="similar to AA sequence:RefSeq:NP_009459.1"
                     /note="ancestral locus Anc_7.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138248.1"
                     /db_xref="GeneID:59324692"
                     /translation="MSTAINEQTMPSYYYYVDPEITYQPQRPNPLDDLISVYGLQDLS
                     QQVARTNPDGSKAIKLRKSYKNQISELSGKFTTIPTRENGKGGEISHILFQNNPDMMS
                     HVRREPGMTPEQYHEAMINRDSSLFEAPNMDWNMCRSVLSQFERSYPTEFQNQLGFQV
                     DDLAFDLDGTGKASSKKRKVKSNGSSMATPNSDMQEDVKRRRLE"
     gene            <814986..>815381
                     /locus_tag="HG536_0B04380"
                     /db_xref="GeneID:59324693"
     mRNA            <814986..>815381
                     /locus_tag="HG536_0B04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282354.1"
                     /db_xref="GeneID:59324693"
     CDS             814986..815381
                     /locus_tag="HG536_0B04380"
                     /inference="similar to AA sequence:RefSeq:NP_009460.1"
                     /note="ancestral locus Anc_7.424"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138249.1"
                     /db_xref="GeneID:59324693"
                     /translation="MASSLPHPKIVKKHTKKFKRHHSDRYKRVSENWRKQKGIDSVVR
                     RRFRGNISEPTIGYGSNKKTKFLSPSGHKVFLIANIKDLELLTMHTKSYAAEIAHNVS
                     SRNRVTILARAKALGVKVTNPKGRLALEA"
     gene            complement(<815610..>816426)
                     /locus_tag="HG536_0B04390"
                     /db_xref="GeneID:59324694"
     mRNA            complement(join(<815610..816298,816384..>816426))
                     /locus_tag="HG536_0B04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282355.1"
                     /db_xref="GeneID:59324694"
     CDS             complement(join(815610..816298,816384..816426))
                     /locus_tag="HG536_0B04390"
                     /inference="similar to AA sequence:RefSeq:NP_011046.3"
                     /note="ancestral locus Anc_7.423"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138250.1"
                     /db_xref="GeneID:59324694"
                     /translation="MVLVDISPDLLEYKPPFTEQSTEYATITNNSDQPIAFKVKTTAP
                     KFYCVRPNAAVVAPGESVKVQVILLGLAKEPAEDFKCRDKFLVITLPAPYDLGEKSVA
                     EAWPELEAEFKQKAVSKKIKVKYLLDQREPSQQAVEQAVEKPAQQAQAQEQNNAAVVQ
                     ESHPEHAPESVQTIDQTKRSVEEEEVSKPVEDTPASEPEKHVKSAPSAASAKTEPVSA
                     QEGALNSTALILIAIIALVLGWLYY"
     gene            complement(<816713..>817957)
                     /locus_tag="HG536_0B04400"
                     /db_xref="GeneID:59324695"
     mRNA            complement(<816713..>817957)
                     /locus_tag="HG536_0B04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282356.1"
                     /db_xref="GeneID:59324695"
     CDS             complement(816713..817957)
                     /locus_tag="HG536_0B04400"
                     /inference="similar to AA sequence:RefSeq:NP_009462.2"
                     /note="ancestral locus Anc_7.422"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138251.1"
                     /db_xref="GeneID:59324695"
                     /translation="MHEQLKESEEAVAELEVDPQEAVETPEGSPAGDSEAKDKKKKKK
                     KKSKKKNANIKEISTFYPDGIYPQGEWMDYQQDFNLARTTDEEKRYLARSQANEEHWN
                     DVRKGAEIHRRVRKNVQNKLQPGMALTDIANIIEDATRKFTGAEDLTKMENPLSQGIG
                     FPTGLSINHCAAHFTPNAGDTSVLKREDVLKIDIGVQVNGNIVDSAWTVAFDHQYDNL
                     LTAVREATYTGVRESGIDVRLTDIGEAIQEVMESYEVEINGKTYAVKPCRNLCGHNII
                     PYKIHGGKSVPIVKNGDNTKMEEGEHFAIETFGTTGRGCEVSHYAKNTSSTALPSLSR
                     ARQLLQTIDKNFGTLPFCRRYLDRLGEDKYLFALNNLVRQGIVQDYPPLSDVPGSYTA
                     QFEHTILLHPHKKEVVSKGDDY"
     gene            <818427..>818945
                     /locus_tag="HG536_0B04410"
                     /db_xref="GeneID:59324696"
     mRNA            <818427..>818945
                     /locus_tag="HG536_0B04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282357.1"
                     /db_xref="GeneID:59324696"
     CDS             818427..818945
                     /locus_tag="HG536_0B04410"
                     /inference="similar to AA sequence:RefSeq:NP_009463.1"
                     /note="ancestral locus Anc_7.421"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138252.1"
                     /db_xref="GeneID:59324696"
                     /translation="MFKPVCHANYSANAMRSVRFFGVSCRVLQDFPTFDHSLLNPLSN
                     KSSQKSNQLSQSLNHDYVQKTRSNGQNSARKFAEFAHNPRDDALSSRLTGVAAGRTVD
                     VFNNDTASAFRQLNSIMFANRIPQDSRNQRFYMKPGKVAELKRSQKHRRDFMKGFKRL
                     IEIVKDAKRKGY"
     gene            <819085..>820446
                     /locus_tag="HG536_0B04420"
                     /db_xref="GeneID:59324697"
     mRNA            <819085..>820446
                     /locus_tag="HG536_0B04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282358.1"
                     /db_xref="GeneID:59324697"
     CDS             819085..820446
                     /locus_tag="HG536_0B04420"
                     /inference="similar to AA sequence:RefSeq:NP_009464.2"
                     /note="ancestral locus Anc_7.420"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138253.1"
                     /db_xref="GeneID:59324697"
                     /translation="MSSSVRSGVITLLHTACGAGILAMPYGFKPFGVIPGIAMISFCA
                     LCSLAGLLLQAKVARYVPGRSASFFSLTQIINPNLSVIFDVAIAIKCFGVGVSYMIVV
                     GDLMPQIAAVFSSHELLLNRNLHITLIMLFIVAPLCFLKKLSSLRYASLVALSAVAYL
                     CVLILVHFAWPSQDIEELKGRVSLGLPDGHTNPLTTLPIFVFAYTCHHNMFSVINEQA
                     DDSFGNARRVAIYAMSLALALYVLVGGLGYLTFGDHIIGNIIKLYPQSVSTTVGRIAI
                     VLLVMLAFPLQCHPARASVNHILFYIQERKKQSMRTDNRVGAGTVDEASTLIVNPEQE
                     YIIDELIEEDSSQQPQVVTLHGRKFVIITTVLLIASYLLAVSVSSLARVLAIVGATGS
                     TSISFILPGIFGYQLIGSEIEAGSLQLKTRLFKYSGLLLAIWGLLVMVTSLTATLTMH
                     SSH"
     gene            <820775..>821767
                     /locus_tag="HG536_0B04430"
                     /db_xref="GeneID:59324698"
     mRNA            <820775..>821767
                     /locus_tag="HG536_0B04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282359.1"
                     /db_xref="GeneID:59324698"
     CDS             820775..821767
                     /locus_tag="HG536_0B04430"
                     /inference="similar to AA sequence:RefSeq:NP_011043.1"
                     /note="ancestral locus Anc_7.419"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138254.1"
                     /db_xref="GeneID:59324698"
                     /translation="MSMPSRASARAQRSRSQIEYSFRPSNLFSDPFAISSISICLLSW
                     IIAFVGCITTASGNQSFPRFTWWGIVYELMILCMTITFYCFNVVDYYKTFLTGAFAVA
                     FIYTTNSATILVYGDGSKKAAASAGVILLSIVNLIWIFYFGSDNGSPTNRWIDSFSLR
                     GIRPSPYEDAFLRARRRSVGRALQTGPKSNRYTSDNFYPENLPQNYVSSTALAGFENT
                     DPTYSSNAQVNNADNNAGNTFITDSTNANTDTTMSGTLELYSDAGDESFPYTAKTLYS
                     YQADAGDAYEISFEQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQLVDNDVL"
     gene            complement(<821839..>830196)
                     /locus_tag="HG536_0B04440"
                     /db_xref="GeneID:59324699"
     mRNA            complement(<821839..>830196)
                     /locus_tag="HG536_0B04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282360.1"
                     /db_xref="GeneID:59324699"
     CDS             complement(821839..830196)
                     /locus_tag="HG536_0B04440"
                     /inference="similar to AA sequence:RefSeq:NP_009465.2"
                     /note="ancestral locus Anc_7.418"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138255.1"
                     /db_xref="GeneID:59324699"
                     /translation="MTSIPVFNTLSNLGSSKTRERNAALDELTSVLKQSPDLIPTKTL
                     ASTCETLIELLDSECRKYCLLVASDDANASKLSLTENRLSLVAYVLRLFIEKTCGRFK
                     VKTMKLLLTVLPELMVAEGSNTLIEPISVHLTFALHALIKSKLFQLKMVLHQWISLVN
                     VVCSYLDQRLEVSLTDRNISNLISILNSLLSVDCVGLTQVREAIYRTLMKYLRRNEKV
                     NSNTRLVLSIINDLIIKTHCLNILDALRLVKETWKHVIAINVSTNEDIQDELCYLDIL
                     ASELIVHNIPTMIGSEGAAAECSGNSLHGICREYLLTRLTGCKASWFSTDSLEFSNDY
                     GTEESFLELGDFRLKEGADAKPGLSILSITRLSISYFKLLQRETFGEGLFKRHKCEPS
                     LSSILRNSQSMLSFLLNGLQASDADIQLVCLQMAAFTAALQDLDANDILDLKSAIEQK
                     FENVNLIKWACVALTPLFTQSNLAQIEIENSLNRILKLCLPLIKQPELCSVACTLLSC
                     VMKHSSFIVPDKATLSQISSVYELSDVNGPGLLCNEAFQFWQYLQNYGKHIDSFSLEF
                     ISRKIVTWVETKWQHIILLQSNQHLFYEFIAWLCNRKPTGPRDCVTKSSSTLYHQNMW
                     QNRYTIWTSQMEERFFMLQIEPERKTFKLCSPQTHFNSITTEKVNLNEILYRLLELIE
                     GENGLTSIAKFNWICQVSSLVEYLSGDLRYANYVLDFKKGSSTVLNSIKLQDKEAFAI
                     FFRSILRLEAPTIAHFVFEQLPIEKILADFKQLLLQGIDNRHPEAMKFDVPFERDVLS
                     NQAAADNFTTNPSVESLVSLSLRAFLKVLQHKPAISFGDILECLMGFLNGLKTDDFIS
                     CIDPVINWIGNQKESSVSVTHQLQVFTEILSEYLLQSDYNTSSVAAFCLCSFLESVST
                     VWLENSDNPLNADCSDIFDWVIARFEDTFVSGRLAIKRLSQLLLHMLKSHDLSRGHIK
                     GGKQRVFAAYSKTLKALNAVDMVSQLSSMMDYMIRVSSKNQHILFSEICSLVEIPQQS
                     IEMSALYSLAMWKISTASYLNMSLAMRDLMQYSHFEHTRVYVASALKKMALTAGLNDT
                     TQLFDVFRFDILSLWFDESFWRGQSIEDVWDIRIFGFMDLSQFVELYAAELSALYFSR
                     RQKPTILEQLTNITGCNEKQLLTKYYYLVFPLSFIEGGMNEDIHDFFHNLTGEPLLTT
                     KNRTLTFRWILRFVDLGSNYETSTIIGKSSDCRSRLQLLYSSHPNVMRYQHSIHIPLD
                     VGGRLLHQLVQKSPLCKDEINFILLSILSDLEKSFNYSEKLKYLREMKLTLAINDSGL
                     SACDFLPTFLPPLCKCLASLELHNETADIIVFILTICREHDFTVGEEFIPLFCELFLF
                     KRRFKGELSNSLKEVLNWLAESASVLKTTVKYCNDAIQGKLLSLDVYSKVEILSHTNC
                     GVDKIVLLSLLLGHAQRPSHTLNIEKPSIRSVQNLLKHEIASDFITENFQLWTAYYLK
                     AFTSEQDLKTVMLDPASLSGENYEQLFDKFGSLECVLKEFLTIAKMPPNLASCAVRLF
                     CASMVGLFLTGGPYGDEKAILVNNGGYTRCNLHCWFVTDSDFWSINNEVGLLSDMNTF
                     ITDSYLHRTISYAEWLAKFNTALILHLTPSIPKLKLFHPLCRTSSFFAQKILPILFRL
                     AICFDHPTSTNWITALFSQVGGLVVCFEAKQKVNSLLSIMNMLMTGRKLKDSLCTSCC
                     TILPLKAIYEAALKTDQITSAYMIFEMLYMGDLSNLDHDGLRLIYEALGEVDLLAGLP
                     APQTLIEALDSATKIEPTAWKTFLYSNAMVDAQLWNTGKSEKLNLLKTTECQGLYGVA
                     ARLSTTLLPFEETLCEYRWALQLGNWDLPVPKVIDSKEKGLYFALRSVSSGVQSPSRI
                     LDDAMVELVRNRSSFEERLEWAETIAEIALLKQMTEDFKSSEGMMGFIHNSFALDKRA
                     LHSYDFRDYKSNIQARFLLSQLLMDREFSASSLSAHNVKICSAALLVNNVQLSIQEKC
                     SQDALRNAILFGRFFQPENTSSVYRILGSYVSAKALWESGDSKTPVTLLKALLEEHPE
                     DSGSGPLGPLLAVSKDEIRALLVNWTSKSRLETASAIFEKYIKDFETTVKDHEVRADT
                     FYVLANFLHTQVKKMKDSGQIEERQKRCERGTQESRALEVIHKKTNLSSNERKDARRH
                     YNRVLLQLNSDREILNSLLVQRVQFVWRSLHYFINTLVFTNKYDGDVLDKFCGLWFEH
                     DGDDSINSLLKKEIGMIPSWKFLPWVNQIASKLSIEDKEFQKPLQLTMKRVLYKLPYE
                     SLYPVLSMKLYENHSFTSDSIIPQKIKAVDKILSELQAYDNGSYYRSYVLPLKEFCEM
                     SVELANFQLSVSPKGTKKIHLQNLKIGSYWLKTLPNLKLPLPTSKWQIKSSSDGKVPR
                     PYIVSVGEMVDISVTGLSLPKIVTFTISDGSRHKVLMKGSNDDLRQDAIMEKVFQQVN
                     SILQREKRMRKLNLTISTYTVIPLGPRAGIIEFVTNSLSLHQVLTALHAKDKVSFNEA
                     RNEMKKVQTKSNSERLRIYIKLTEEIKPQLRHFFFDSFPDPDQWFEAKKTYTKGIATT
                     SIVGYILGLGDRHLNNILLDHETGKPTHIDLGIAFDQGRLLPIPEMVPFRLTRDIVDG
                     FGVTGVEGLYRRSCEHTYSVLRDNYEKVMHVLNILKWDPLYSWVMSPVKKHKHLLEEE
                     SQEYSSLSFDSESSNSKVKGEEQNQESYRALKGVEEKLIGNGLSVEATVQELIQQASD
                     PQNLSLVYMGWSPFY"
     gene            complement(<830375..>831008)
                     /locus_tag="HG536_0B04450"
                     /db_xref="GeneID:59324700"
     mRNA            complement(join(<830375..830746,830967..>831008))
                     /locus_tag="HG536_0B04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282361.1"
                     /db_xref="GeneID:59324700"
     CDS             complement(join(830375..830746,830967..831008))
                     /locus_tag="HG536_0B04450"
                     /inference="similar to AA sequence:RefSeq:NP_009466.1"
                     /note="ancestral locus Anc_7.417"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138256.1"
                     /db_xref="GeneID:59324700"
                     /translation="MSGNGAQGTKFRISLGLPVGAIINCADNSGARNLYIIAVKGSGS
                     RLNRLPAASLGDMVIATVKKGKPELRKKVMQAIVVRQSKPWRRKDGVYLYFEDNAGVI
                     ANPKGEMKGSAITGPVGKECADLWPRVASNSGVVV"
     gene            <831518..>832186
                     /locus_tag="HG536_0B04460"
                     /db_xref="GeneID:59324701"
     mRNA            <831518..>832186
                     /locus_tag="HG536_0B04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282362.1"
                     /db_xref="GeneID:59324701"
     CDS             831518..832186
                     /locus_tag="HG536_0B04460"
                     /inference="similar to AA sequence:RefSeq:NP_011041.3"
                     /note="ancestral locus Anc_7.416"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138257.1"
                     /db_xref="GeneID:59324701"
                     /translation="MVIDDERGVINRGEKRLREEDDSELTTDISQVEEDQDEIDSQSD
                     GSVRVISERGRVVGDVGEDDDDDYDYLMQALNEAKEEQEVGDSKRSSEETTDVESKGS
                     SALKPRTMGGQSSEMEPIDLEAEIEEQQAVEEITDEPEPSSATKVYKAVRDYQCPICL
                     EPPENASIAPCGHIFCVACLFRMVNNSRGQRKTGLCALCRKEIQFRQVKIVILRKKRV
                     RKGS"
     gene            <832399..>832857
                     /locus_tag="HG536_0B04470"
                     /db_xref="GeneID:59324702"
     mRNA            <832399..>832857
                     /locus_tag="HG536_0B04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282363.1"
                     /db_xref="GeneID:59324702"
     CDS             832399..832857
                     /locus_tag="HG536_0B04470"
                     /inference="similar to AA sequence:RefSeq:NP_011040.1"
                     /note="ancestral locus Anc_7.415"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138258.1"
                     /db_xref="GeneID:59324702"
                     /translation="MDLVFLSPSSYRICHTEDSHFAKDDGCLLTPTSRVVQFKSAANN
                     GFTVSRRNRKRKRRLLGRRPKKTHLWCFNIRQRKSKRPRPVPSVFLSGANLVRFGAFC
                     GIRDSRATRCSLRGIRHGLFIRAGTRCACASYTLYPSPLVCLTQPIVTES"
     gene            complement(<832987..>834270)
                     /locus_tag="HG536_0B04480"
                     /db_xref="GeneID:59324703"
     mRNA            complement(<832987..>834270)
                     /locus_tag="HG536_0B04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282364.1"
                     /db_xref="GeneID:59324703"
     CDS             complement(832987..834270)
                     /locus_tag="HG536_0B04480"
                     /inference="similar to AA sequence:RefSeq:NP_009467.1"
                     /note="ancestral locus Anc_7.414"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138259.1"
                     /db_xref="GeneID:59324703"
                     /translation="MPLLNGKNKSKKPKFLLTLRINELINIPQSSGYCYVKWHLKEGT
                     GTSTSGPIVDSNGEEIHVMNQSHGATPRIMVENHRARWNYEFERPLQIKMQVDRNREL
                     ISKVLLLEVFFEFLSDSEGNKPRRSNSGSYPAKSSPNNVYTQKATGKLLLGMVSLNLA
                     EYVREDEQATTNRFLLKKSKVNSILNVMVQIKLIRGSYRDFLVSRSLVPGALRSGIND
                     ILDDSSDMGSSTSSAFQPSVSSPLRNKFSMGQRKTVGSSFASTERSKNFISASMSPLV
                     DSLYQKTFQLPWDPRPGEFTPRECVEDILQGGNGWAKNEKGICLIDLQALRLNELESD
                     YYDKHRIGQVLGSTEGDGSSVGQSATNYEHMDKREFLEKKQLWSRKSSQQRRSTQENE
                     GINSKGCPEMDGYAEDVPNDRIRDARSWSVSNVIT"
     gene            <834459..>835241
                     /locus_tag="HG536_0B04490"
                     /db_xref="GeneID:59324704"
     mRNA            <834459..>835241
                     /locus_tag="HG536_0B04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282365.1"
                     /db_xref="GeneID:59324704"
     CDS             834459..835241
                     /locus_tag="HG536_0B04490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138260.1"
                     /db_xref="GeneID:59324704"
                     /translation="MGSLSDSSSRRRDWLVSEDDSECFLKPAKFSQDDINVFHNAEAT
                     VASDGLLQLQRICDSLQQDNVLITDRVSFGKRIWDLHTYEEDPAAFPIQNVPIKCNIL
                     SSMSELLRNRRHDDLSDDSMEKVAKVLDYLRKLSEAAVFNDASKPPKAVERVRTLDPS
                     RSRRPMSGSFSHRKSNRPSAAAGGRASGQKGKELSIDNISKFHEYKPLIVSLHSRLKL
                     LDQKNRRNDLIFDFVLHNICKFILDDCKLLLIDYIEREILNL"
     gene            <835497..>838559
                     /locus_tag="HG536_0B04500"
                     /db_xref="GeneID:59324705"
     mRNA            <835497..>838559
                     /locus_tag="HG536_0B04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282366.1"
                     /db_xref="GeneID:59324705"
     CDS             835497..838559
                     /locus_tag="HG536_0B04500"
                     /inference="similar to AA sequence:RefSeq:NP_009468.1"
                     /note="ancestral locus Anc_7.413"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138261.1"
                     /db_xref="GeneID:59324705"
                     /translation="MSDKKIPRLSQLDTRITSGSSDVTPNSIQSAYSTSSTKQFPAYI
                     AINEYTKRMEDELDMRPGDKIQVITDDEEYNDGWYYGRNLRTNEEGLYPVVFTQEISL
                     EQKPSIMRAKSTKRVVSSGNGSTSNFSAMSQNGSASELPTPQPLEIAAPVTVSTKKPI
                     DRKISLKTTMSDIDRALEELRSNSVEQLENAIHNTTHDTIHSTTKGLNTSGSLGRLAS
                     STSAKSLSSEALAADSSNGIDASELDPSMAATWTPQQVTAYFIMSGFDVQSSSRFQKH
                     KVSGAILLQLELAHLKELEIDSFGTRFEIHKEIEELRKAASGSPKVASKTPEDDGQLM
                     PPAFLNQGPTYRGHVRKVSQSLDDIPRDSASLSAGYLEQPKASMGHLPTSLAETMRRH
                     NSKSRQEVEDERLFVSPRKAPKPPSYPSPVQPPRSPSVAKDAAIYGQRYSPPTIYEKV
                     TSNTLEPPDVFKFPSTNSPDLKAKPGFSFGGKSSSTSSTPTRDSQPSGAAGSTQGAGN
                     YAGNRNSVIYSAHKKTMSGTSFVDLYNRVSMLSPTSQNAREQSLAPAGDVNDVSDELP
                     NGRPSSSVYAGHSRNTSVARSKQPSQDLKKHRRASSLVSFFSGKNDERSASPMRNKSG
                     ATNSHAHSRRNSFILSPFRQPFSESAHVTPSGKSFSASNTPPPGVSISPSKTKSGSKD
                     ESKRRSVSAKESSKDAFDKKKNAYAEDDKNKRSVSDAVKSKGMRNMATRNQGKKQTSA
                     FMEGIRNISVKDAMMDADCSGWMSKKGSGAMGVWRTRFFTLHGTRLSYFGSTTDTRER
                     GLIDITAHCVVPAKEDDKLVSLYAASTGKGRYCFKLLPPQPGSKKGLTFTQPRVHYFA
                     VDSKEDMRAWMAALIKSTIDIDTSVPVISSCATPTVSLSKAQEMLTQAREATRLREQQ
                     RYLNEEDEDQMLWEKQQNPKQQPNVADDTYRYSDEEALASAVNLSSNANTTVSSNGFA
                     SPYLLASGVLSPHATSDVGRFQEKTPESSNVDEINLSSETANIISQKF"
     gene            complement(<838646..>840748)
                     /locus_tag="HG536_0B04510"
                     /db_xref="GeneID:59324706"
     mRNA            complement(<838646..>840748)
                     /locus_tag="HG536_0B04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282367.1"
                     /db_xref="GeneID:59324706"
     CDS             complement(838646..840748)
                     /locus_tag="HG536_0B04510"
                     /inference="similar to AA sequence:RefSeq:NP_009469.2"
                     /note="ancestral locus Anc_7.412"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138262.1"
                     /db_xref="GeneID:59324706"
                     /translation="MLFSNNNNNGNGDATMNADDLTTDVTTLNTIVKLQDCIQHSILQ
                     LNYETAVFLSELLFAECCPLEKNHIHRLDSVYLYSLSLYLQGEHSTAMRISNDFKESN
                     HMGIGYIYARCCLELDTDLQDAVDVLLSILNKKAVSSSSNLISMPTVATINCLLGKLN
                     FKLERTPESALFHSNALKADPYLWEAYTSLCAMRATIDLKRLYSLMTKQTQPTGPRFR
                     TRFNVSKPYNPAATPYKSYNQLSAGSSSSSSINLNTVPKQNSQQQPSHLPPHHTSIKC
                     QPTGSTLNKANVIVSTSAFSSPPPTKQPAVKPTNRSKLLTTPPSKLLHTANFKTPRTN
                     TLSRSTGHKRAEAIPSATYRSEKDGITSAALPVLSSSTYSLPDLILTFARILKASSQY
                     DSYKAIRILENRLPAHIKDEMPWCQAQLGKLHFEILNYDESLNHFTQLRKLQPTRSKD
                     IEIFSTLLWHLQDSVRLAHLSSELIEMLPNKPETWCCVGNFYSLQRNHEGAIKYFEKA
                     TKLDYNFAYAHTLQGHEHSSNDSIDTAKNCYRRALACDPQHYNAYYGLGMCCMKLGQY
                     DRALLFFEKARNINPVNVILICCCGVALEKLSYQEKALQYYELACDLQPSSSLAKFKK
                     AHLLYSMARYSAALENFEELSKLAPDEATVHFLLGQLYQVMGRKKDAVKEFTVAMNLD
                     PKGNPLIIDALEKCHSIE"
     gene            <841381..>843441
                     /locus_tag="HG536_0B04520"
                     /db_xref="GeneID:59324707"
     mRNA            <841381..>843441
                     /locus_tag="HG536_0B04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282368.1"
                     /db_xref="GeneID:59324707"
     CDS             841381..843441
                     /locus_tag="HG536_0B04520"
                     /inference="similar to AA sequence:RefSeq:NP_011038.3"
                     /note="ancestral locus Anc_7.411"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138263.1"
                     /db_xref="GeneID:59324707"
                     /translation="MILTKKRVWGYLTMLLIFVMIFRNSASWRHSAGDDKVGGGWLKP
                     NLYKWGDSVELIVNKVESDLTQLPFGYYDLPFTCPPTEGKKPLHLSLSEIIKGDRKWE
                     SDYKLWFGQDSACEGLCARKTTPEGMRRARELVRDGYVVQWLIDEELPAATTFISTTD
                     HKKYYASGFPLGFVDPDTGKSYLNNHVMLVIRYNAVNGDTFSIVGFEVYPRSVSDQHC
                     PGASKDYDQYEIVIPEDENELTYIPFTYSVYWREEFNVDWSHRWNFFLNSGEISEGSS
                     VKFHWMTLCNSVGIAFLITFIVVVNLIKVLKTGSSRTNDDFQFTFDDDDNVDSIYAVA
                     RTWLSQTDSSSWSLRMHTIATSVGVHFLFTVLGSLTISCSLNRLHNIRNSVVTMAVFC
                     FVIGAFMASYVGTRLRIEYHSFRNEACGHYRAFAVLCGSALPGLVTISTQLLNSIIRL
                     QESSSALPFRTVMIFISIYFANCIPLSLLGGEAAYRMYRKCGASFAIPSALRMRNSFK
                     PLKAPTCRTGSLSMKNVRAKLTFGSIAVLLCGLFPFAIIYVEMQYIYKSAWLEKTTFY
                     HFYGFLLANILMLCVVVCEISLLGCYVLMKMNKKDRRMTTSNSWRWNCFLMGTSCAWY
                     MELYTLYYLFHTLNITGFSSIFISVSYSLIFNIMAGIGMGSLGYLTCCWFVNKVYRTK
                     YMTA"
     gene            complement(<843504..>844025)
                     /locus_tag="HG536_0B04530"
                     /db_xref="GeneID:59324708"
     mRNA            complement(<843504..>844025)
                     /locus_tag="HG536_0B04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282369.1"
                     /db_xref="GeneID:59324708"
     CDS             complement(843504..844025)
                     /locus_tag="HG536_0B04530"
                     /inference="similar to AA sequence:RefSeq:NP_011037.3"
                     /note="ancestral locus Anc_7.410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138264.1"
                     /db_xref="GeneID:59324708"
                     /translation="MLPLYLLTNAKGQQMSVELKNGEIVEGELVNVDNWMNLTLSNVS
                     QYDTIGNSGNIAAQKEIVKSKEIYLRGTYIKYIKLQDGVIDQVKQQISSGGSSSGGGS
                     GGHYRRGNRYSSGGSGSGGNYKRGASQNKKNYNSGSVRRSYHQNRPGNGGMGGYVQQH
                     QPQRDSPSGNIEF"
     gene            <844688..>847696
                     /locus_tag="HG536_0B04540"
                     /db_xref="GeneID:59324709"
     mRNA            <844688..>847696
                     /locus_tag="HG536_0B04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282370.1"
                     /db_xref="GeneID:59324709"
     CDS             844688..847696
                     /locus_tag="HG536_0B04540"
                     /inference="similar to AA sequence:RefSeq:NP_011036.1"
                     /note="ancestral locus Anc_7.409"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138265.1"
                     /db_xref="GeneID:59324709"
                     /translation="MAGSGEEISEAGVPTTSGAGEAAGLAPVIEVATYAETDVYECYI
                     RGYESRIVMRRTQDDWVNITQVFKIAQFSKTQRTKVLEKESNDMRHEKVQGGYGRFQG
                     TWIPLENAKYMVSKYNIRDPVVNRILEFKLDPQNPPVKRSKNSVLKRSSPNGRISSPS
                     SYNKTPKKKQYPNSAVARKVKKTGTLLQPNPSPLQNLVFQTPQQPRLNSQNANATVSA
                     STDGKKHQSHSVDAPVTMGYSATQKPLQFYPVPTSISHSQKQPRNSAAFHHQGSEVPQ
                     SSFLTFIPEGPTSGTLASGDQNQTVPNIMVNGSLKQPSRKRKKVRKFSSMSAIKIEPS
                     GMQDKAQQNFKLMNRQMWQNVSPNASHPNPINTGISNTHSNTSSLEMFSTQENPTPMS
                     SRSSTPHPFGGIPTAPSTAVENDDVLENAEMQSLSVAEYKDAILQVLSLEDGSDKNYS
                     LPPQMYHPPSDFDINFLIDDQGHTPLHWATAMANIPLIKLLIALNANALLCNSKGFNC
                     ITKSVFYNNCFKAGSFPEIVSLLRICLITPDSNGRLPLHYLVELSVNKSKDPIVINSY
                     MDTIIQNLGQDDSTLLRMCLNFQDNLGNTILHLAALNLNLELCNKLCCLGSSMDITNY
                     ENETPASILAKFNLVPPTTIAQAFSPRTSNKLPLYSEMPAIVPADGKTAPRDLAEQTA
                     PALSPVENLGILGRTPQIRLTPAGPTKKTSTRNFLSGTDSATFTTLMDDLSNIDSFVT
                     SSAIRDVKTTPSRLLESSPILFKKRPNTSAMLPPPSFKKFAKLAEAMESPLGPVTMSP
                     LPGTANVKELNDVLMAADRLKDVANTLVASVNTQANSIAAEVERTEKSIAQMKNNLAK
                     TKNSEKELLAQFDGSEGTGSVDDLKKSTLGLRQLVEDSKQQFVQCIERSQALNLASLV
                     QDEESKVNDDSSQSPSSEKAQLESTMKHAIELAFLQLRRRSTLSKIIDSKCRVNTSNK
                     ISKYRRLIGMAVDNIDTKLDEIELDLRTNA"
     gene            <848140..>851487
                     /locus_tag="HG536_0B04550"
                     /db_xref="GeneID:59324710"
     mRNA            <848140..>851487
                     /locus_tag="HG536_0B04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282371.1"
                     /db_xref="GeneID:59324710"
     CDS             848140..851487
                     /locus_tag="HG536_0B04550"
                     /inference="similar to AA sequence:RefSeq:NP_011035.1"
                     /note="ancestral locus Anc_7.408"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138266.1"
                     /db_xref="GeneID:59324710"
                     /translation="MDQQFLGQLEQTLSSIVHPNANDLKEATKSLQSQFYKQPSSLPA
                     LIHILQNSSDDALKQLAGVEARKLVSKHWKSLEGSTKAQIKQSLLQTAFSEPKEIIRH
                     SNARVIAAIGTEEMGDNQWPDLVPNLIQAASGDDAQTRLTSSFILFSLLEDFTPSLTA
                     YVDDFLDLFSKTINDSASLETRSLAAQGLNHVSALIEEQEEINPQQAAKFAALIPSVV
                     SVLDDVIKAGDSVNSKLIFNCLNDFLLLDSQLTNNTIPELIKLAIQIAVNTSIDEDVR
                     VFAVQFIISALSYRKSKISQAKLGPEITMAALKVASEEIDVDEELNNEDEAAENEENT
                     PCLTAIRLLAFASSELPPSQVASIIVEHLPTMLQSSNAFERRAILLAISVAVTGSPDY
                     ILSQFDKIIPATITGLKDNEPIVKLAALKCIHHLTTDLQDEVAKFHDEYLPLIIEIID
                     TAKYVVIYNYATVALDGLLEFIAYEAISKYLEPLMNKLFYMLESNKSSKLRCAVVSAI
                     GSAAFAAGAAFIPYFKTSVQYLSQFIENCSQIEGMSEDDIELRALTFENISTMARAVR
                     SEAFAEYAEPLVNSAYEAIKTESARLRESGYAFIANLAKVYGENFSPFLKTILPEIFK
                     TLQLDEYQFNFDGDAEESAAFADDATEEDLQNKFTVNTGISYEKEVAAAALSELALGT
                     KEHFLPYVEESLKVLTEQVEESYGLKETALNTVWNIVKAVLLASKFVPESYPKGIPSG
                     SYVEPNVLAVIQTARDITLNDLADEFETSMVITVMEDLANMIKQFGSIIVMDNGNSTL
                     LETLCVQVMNVLKGDHTCQTIDLEEDAPKDEELDASETEATLQDVALEVLVSLSHALE
                     GDFAKIFENFKPVVFSLFESKSKNKRSSAVGAASEIALGMKNHNPFIHEMLEALIMRL
                     TTDKSLEVRGNAAYGVGVLCEYANFDVSAIYEPVLKAMYELLTAADQKALAAEDDEAT
                     REVIDRALANASGCAARMTLKHENFVPLEQTLPALLAHLPLNTGFEEYNSIFELIIKL
                     YQNNNNVIAGFTPKVVDLFSAVFTKENERIKLEEESTLGREENMERLKQFQSDEMRHK
                     VISLLKYLNESYDGIVAQNPVLAQVIA"
     gene            <851664..>852989
                     /locus_tag="HG536_0B04560"
                     /db_xref="GeneID:59324711"
     mRNA            <851664..>852989
                     /locus_tag="HG536_0B04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282372.1"
                     /db_xref="GeneID:59324711"
     CDS             851664..852989
                     /locus_tag="HG536_0B04560"
                     /inference="similar to AA sequence:RefSeq:NP_009471.1"
                     /note="ancestral locus Anc_7.407"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138267.1"
                     /db_xref="GeneID:59324711"
                     /translation="MVEMVEREAKRLQNAGRPKFDLWKDAKDAVRFLSFNPNGNAIVM
                     PLLLITESIALKIITAMVPYTEIDYKAYMEQIEMITIDKELDYSQITGGTGRLVYPAG
                     HVMLYKLMYKLTHGMELIPQGQMAFRYLYLATMALQMIIYYQLQLPPWCVVLACLSKR
                     LHSIYVLRLFNDCFTTFFMVLTVLLLMQGCRKRGAAISMLASLVYSIAVSIKMNALLY
                     LPAFMVSVFLINEGRLAVTLCCFATSVLWQVLVALPFLRTYPMEYLQGAFNFTRRFLF
                     KWSVNWQMIGEDGFDSSIFHRSLLISQVLGILSVILFKYPTLPRDAVKSVRHPLSKVM
                     PAVNAPDVVPFVLVTTNFIGVIFSRSLHYQFLTWYHWTIPVLLHYSRLPWFMGPLWYM
                     LHEYCWNSYPPNSQASSLLLALNAILLLLISANNLPNYSKFANVRKKEQ"
     gene            <853556..>855493
                     /locus_tag="HG536_0B04570"
                     /db_xref="GeneID:59324712"
     mRNA            <853556..>855493
                     /locus_tag="HG536_0B04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282373.1"
                     /db_xref="GeneID:59324712"
     CDS             853556..855493
                     /locus_tag="HG536_0B04570"
                     /note="ancestral locus Anc_7.406"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138268.1"
                     /db_xref="GeneID:59324712"
                     /translation="MSQRAGPYAGMNNAHAYQQPQQRERDAGFTSKQMLDAYIYDFLL
                     KSSLKNSASTFCREAGILDATGEPKTPSVLDQVKDAPQGFLYEWWQIFWDLFNARTHK
                     EGSVIAREFSRILANKQKEEHAYRSQAVQAAMLQQMAEQQGECPRGAFEFFQASGVIP
                     NPDYVNHAFHPSASSYTRNEPSNMANQAHVSSHIPHFVPSNVGTNIPGWPVYPNQIPS
                     HFVNSTTGNHIPSHAAPTTHVNQYQTSGPAPSPGSQSVGSKTKQSRPSSTKKKKHALN
                     LAGTPGSPENSTASYKGSMTGLSGKISGIEGLHNYQRQLIMSEIEYNNQNKKNSPSSS
                     TGVGGGSKKHMLPPSAAFSPHTVSPASAGIPNMNMISSSKRKITRRTSASQISGPANK
                     STRSSLSDSPCTPVTLGPVSGGDLSDKQIAPNPPTELSKQSSAGSHESSGKKSVKKVR
                     KTKKPQSITFNKNNFNFLSSNSVPTPPNESQQRPQHRTSSKSNKKPSSVRPNTKTFKS
                     AAEASPQLLVDDGSMATPTFIKSVWNSNGKAQNTPHANLTFVEDNPAHTGGAGFANVD
                     SVAGSSSGASYQYSETEADDILSMNAILPMHESAAAKDEVPSTDVVAAEQTAYENSNP
                     EFNLDLLEPSEHSFNFLSWRQ"
     gene            <855732..>856826
                     /locus_tag="HG536_0B04580"
                     /db_xref="GeneID:59324713"
     mRNA            <855732..>856826
                     /locus_tag="HG536_0B04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282374.1"
                     /db_xref="GeneID:59324713"
     CDS             855732..856826
                     /locus_tag="HG536_0B04580"
                     /inference="similar to AA sequence:RefSeq:NP_011033.3"
                     /note="ancestral locus Anc_7.405"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138269.1"
                     /db_xref="GeneID:59324713"
                     /translation="MAFFGSGSAGNSAVSTTMATEKDLANDIVINNAADDSISDIAFS
                     PQQDFMFSVSSWDNKVRIWDVQNGVPQGRAQYEHGAPVLCTRWTSDGTKVVSGGCDNV
                     VKVYDVTSGQSQQLGTHAAPVKSMRYLNFGSSGTEVLVTGSWDKTLKYWDLRQPQAVS
                     TVALPERVYTMDSKQQLLVVGTAERHIAIIDLTNPTAIFKTTQSPLKWQTRAVACYNE
                     GDGYAVGSIEGRCAIRYVDDEQQRKSGFSFKCHRQTSSNRPAGTQAQSLVYAINSIVF
                     HPIYGTFVTAGGDGSFHFWDKNQRHRLRGFPSLQASISVCNFNRQGSVLAYALSYDWH
                     QGHTANRPDYPNVIRLHPTTDDEIKEKKKR"
     gene            <857218..>858282
                     /locus_tag="HG536_0B04590"
                     /db_xref="GeneID:59324714"
     mRNA            <857218..>858282
                     /locus_tag="HG536_0B04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282375.1"
                     /db_xref="GeneID:59324714"
     CDS             857218..858282
                     /locus_tag="HG536_0B04590"
                     /inference="similar to AA sequence:RefSeq:NP_009472.1"
                     /note="ancestral locus Anc_7.404"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138270.1"
                     /db_xref="GeneID:59324714"
                     /translation="MPGQIESIPFLSQIEDVDKYLLEYRSLKLATPGHSSSYSSGGHH
                     VQGQARSLGSEVREVNVAGEPAGSYNGAVDGAGSYGNGMKGTNFSGSMGAGRKKYVGN
                     ANQYRKYGVQYSNVQQQNTMIANHFKQVYPQMGYNGSGSGSNLSLDQLSASFMMPNRM
                     SQQPNVAQTQQGYPSGASSPSPVPSRVDTTLSGGSSISSYTSNAEHASASAQFGASHA
                     SQFQNFLDPGLVSSSSIVPGISSNTNIYNLGNGDLVRGYSSSSLVAERNNSAGTPLGF
                     EPGVSTPVLGPEPISSDRVAGEVNLGGFDAPAAGISANPANNMLMSDYPVGWGSNHAT
                     TSSNTSGAFGIWNNDMSVWS"
     gene            complement(<858519..>860144)
                     /locus_tag="HG536_0B04600"
                     /db_xref="GeneID:59324715"
     mRNA            complement(<858519..>860144)
                     /locus_tag="HG536_0B04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282376.1"
                     /db_xref="GeneID:59324715"
     CDS             complement(858519..860144)
                     /locus_tag="HG536_0B04600"
                     /inference="similar to AA sequence:RefSeq:NP_009473.2"
                     /note="ancestral locus Anc_7.403"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138271.1"
                     /db_xref="GeneID:59324715"
                     /translation="MQLQFKLPLKRWYRTAVPNLSEHRPLSKYKLKCGLEIHTQLDTR
                     KKLFSQSTNDPFHSLERPNMHTSYFDIALPGTQPILNYEAVLYAIRLSLAIDAKVNLQ
                     SSFDRKHYFYGDQPMGYQITQHYRPFATGGQIKLNTDIDGVDDKNIRVIQLQLEQDTG
                     KSVYKENEGLTLIDLNRSNVPLIEMVTHPDFTDVKQIRAFIKKYQNLVRHLNVSTGDL
                     ETGAMRVDVNLSVNDFARVELKNLPNTSSIINAIKFEFHRQVQIIEDGKGPELLLHPE
                     TRGWNGEATVKLRSKETTIDYRYMPDPELPVISLSPLAVEGVAKGLPPAPEDVIKKLM
                     AAPYSLSLKDAKLLTIKGNSQDQMYTQPELLQFYVETFRCYLKDVKKSGDGKINYKLP
                     TNWIIHELLGTLNKLQMPLKKVTVIMKPEKFSEFLMLIHRKEISNATGKLLLFHVVEN
                     LDLIKDKKTLDFASLIDEYDLGKISQIDDRELEKICQDIIVQIEDKKLIENIVSGKKK
                     NSIKYLIGLGMRLSQGRISPQEFERMFKKLLGI"
     gene            complement(<860458..>863313)
                     /locus_tag="HG536_0B04610"
                     /db_xref="GeneID:59324716"
     mRNA            complement(<860458..>863313)
                     /locus_tag="HG536_0B04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282377.1"
                     /db_xref="GeneID:59324716"
     CDS             complement(860458..863313)
                     /locus_tag="HG536_0B04610"
                     /inference="similar to AA sequence:RefSeq:NP_010882.1"
                     /note="ancestral locus Anc_1.477"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138272.1"
                     /db_xref="GeneID:59324716"
                     /translation="MDLGGGIGSSETDLSFVPDAVFTDRVRRFQEFLDTFTIYRDAVR
                     SIQLYNNAINSSGDDGVEKKTSSIPEILLQRITISLDDLREFDRSYWTGILNSPAHFV
                     PPAEKALTEVAESINDVPTTSSLSAKHPWRLSFKGSFGSHALSPRTLNSHFLNKLVSL
                     EGIVTRTSLVRPKIIRSVHFAEKTGRFHYRDYTDSTTTLTTRIPTPAIYPTEDQEGNK
                     LTTEYGYCTYMDHQRITVQEMPEMAPAGQLPRSIDVILDDDLVDKTKPGDRINVVGVF
                     KSLGAGGMNQNDSNALNGFRTLIIGNTVYPLHARSTGVSARQTLTDLDIRNINKLSKR
                     PDIFDVLSQSLAPSIYGHEYIKKAVLLMLMGGVEKNLENGSHLRGDINILMVGDPSTA
                     KSQMLRFVLNTASLAIATTGRGSSGVGLTAAVTTDRETGERRLEAGAMVLADRGIVCI
                     DEFDKMTDVDRVAIHEVMEQQTITIAKAGIHTTLNARCSVIAAANPVFGQYDVNRDPH
                     QNIALPDSLLSRFDLLFVVTDDINEIRDRSISEHVLRTHRFLPPGYLEGEPIRESLNL
                     SLAVGVDNEEDNMESPGHSADQDMDEEDGVFEKFNPLLQAGAKLAKNRGNHNGTDIPS
                     IVTIPFLRKYVQYAKERIVPTLTQEAIGVIVKNYADLRNDENTKKSPITARTLETLIR
                     LATAHAKVRLSKVVNKRDALVASSLLRFALLGEDVEIDVYYEDDSEEEITPRVSPKKS
                     PKKKQRVGSLASSPIKYSTPFRSANLSSQSGTPSIAGSRRKLTFVEDDENDEESDQSA
                     EQRGDTMSPLPRTEEEDLQRRLQLGLRVSPRRKDQSTAGAGPLSEVRGTPKLPNVPAA
                     GQEEEHTQATLDFNNAEAGTISTGRLSLISGIIARLVQSDLFEDSSYPKDALLEKINE
                     DLPEEEKFSIPEYLAGLKIMADKNNIMEGDDGKIWKI"
     gene            complement(863440..863521)
                     /locus_tag="HG536_0Btrna5S"
                     /db_xref="GeneID:59324979"
     tRNA            complement(863440..863521)
                     /locus_tag="HG536_0Btrna5S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59324979"
     gene            complement(<863743..>864216)
                     /locus_tag="HG536_0B04620"
                     /db_xref="GeneID:59324717"
     mRNA            complement(<863743..>864216)
                     /locus_tag="HG536_0B04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282378.1"
                     /db_xref="GeneID:59324717"
     CDS             complement(863743..864216)
                     /locus_tag="HG536_0B04620"
                     /inference="similar to AA sequence:RefSeq:NP_010880.3"
                     /note="ancestral locus Anc_1.478"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138273.1"
                     /db_xref="GeneID:59324717"
                     /translation="MAEEEHTFETVDAGSSLTYPMQCSALRKNGFVVIKGRPCKIVDM
                     STSKTGKHGHAKVHLVAIDIFTGKKLEDLSPSTHNMEVPFVKRTEYQLLDIDDGFLSL
                     MTMDGETKDDVRAPEGELGESMQAAFDEGKDLNVTIITAMGEEAAISFKEAPKSD"
     gene            <864757..>866262
                     /locus_tag="HG536_0B04630"
                     /db_xref="GeneID:59324718"
     mRNA            <864757..>866262
                     /locus_tag="HG536_0B04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282379.1"
                     /db_xref="GeneID:59324718"
     CDS             864757..866262
                     /locus_tag="HG536_0B04630"
                     /inference="similar to AA sequence:RefSeq:NP_010878.1"
                     /note="ancestral locus Anc_1.479"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138274.1"
                     /db_xref="GeneID:59324718"
                     /translation="MKNTYSRSSIRSVVRLDPWDYHVYRALECELGPAMRYKNVVSHS
                     TLISVGGTLLTFFVVLRLLIWSSGAVSGGVGMGWLPFFKPFVPNLKNVPGVEFYDLRN
                     YQGDKDGWQRNNRILFCVPLRDAAEHLPRFFTHLSEMSYPHNLIDLSFLVSDSSDDTM
                     GVLLQHLQVAQSQKDKTKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARAR
                     NWLGSVALKPYHSWVYWRDVDVEIAPVSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQP
                     YDLNSWQESEAGIQLAETLTDEDSVIVEGYPEFATWRTHLAYMRDPDGDPEDEMELDG
                     IGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVIGLPHYVIWHIYEP
                     STEDLKHMAWMAEEEKRRLEESRLREFYNRIWEIGFDDVRMDWSDERQSILKNLDHTE
                     SYQNQIIVDWSDNDESESASQTHDSAEQQDRHNLEDHQNDEVPMDFDPDHN"
     gene            <866480..>867616
                     /locus_tag="HG536_0B04640"
                     /db_xref="GeneID:59324719"
     mRNA            <866480..>867616
                     /locus_tag="HG536_0B04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282380.1"
                     /db_xref="GeneID:59324719"
     CDS             866480..867616
                     /locus_tag="HG536_0B04640"
                     /inference="similar to AA sequence:RefSeq:NP_010877.3"
                     /note="ancestral locus Anc_1.480"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138275.1"
                     /db_xref="GeneID:59324719"
                     /translation="MVTITFKDFKKEKIPLDLELSSTVLEAKTQLCQKKDCEESQIKL
                     IYSGKVLQDAKSLQESGLKDGDQVIFMISKKKSTATKVTEPEAATESPASVTQSPAPQ
                     ESSSEPPAAQTQTQVSQASDPGFVVGAQRNEAVERIMEMGYEREQVDRALRAAFNNPD
                     RAVEYLLMGIPENLQQSQSQQQTEETQEVVEGGQTQIQTEPSGESVGEDLFAQAAQRG
                     DSGAAGGDGTAEGVSASGGAPGSIGLTMEDLLALRQVVSGNPEALAPLLENLSSRYPQ
                     LREQIMANPEVFISMLLEAVGENLQDVMTEVDETRELEGEAAAAVSQSEGQEANVEVS
                     ESDELAIGRLCELGFERALVMQVYFACGKNEEIAANMLFNEFGD"
     gene            complement(<867666..>868331)
                     /locus_tag="HG536_0B04650"
                     /db_xref="GeneID:59324720"
     mRNA            complement(<867666..>868331)
                     /locus_tag="HG536_0B04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282381.1"
                     /db_xref="GeneID:59324720"
     CDS             complement(867666..868331)
                     /locus_tag="HG536_0B04650"
                     /inference="similar to AA sequence:RefSeq:NP_010876.2"
                     /note="ancestral locus Anc_1.481"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138276.1"
                     /db_xref="GeneID:59324720"
                     /translation="MSSRVLLLDIEGTVCPIAFVKEVLFPFFSGKVPSLVSSGEPAVE
                     ELLTQFPQDKQQCLQEYILELVDRDIKDPVLKQLQGHVWAQGYEQGEIKAPVYRDAIE
                     LIRRGGEVYIYSSGSVKAQKLLFGHVADPDSDRRLDLQPFIRGYFDINTSGKKTEAES
                     YRRILKDMGREARDVLFISDNELELDAASEAGLNTLLAVRPGNAPISSNKGYEIVKDY
                     SAL"
     gene            <868844..>869179
                     /locus_tag="HG536_0B04660"
                     /db_xref="GeneID:59324721"
     mRNA            <868844..>869179
                     /locus_tag="HG536_0B04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282382.1"
                     /db_xref="GeneID:59324721"
     CDS             868844..869179
                     /locus_tag="HG536_0B04660"
                     /inference="similar to AA sequence:RefSeq:NP_010875.1"
                     /note="ancestral locus Anc_1.482"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138277.1"
                     /db_xref="GeneID:59324721"
                     /translation="MPAPYQPGSAKKGATLFKTRCLQCHTVEKGGPHKVGPNLHGVFG
                     RHSGQAEGYSYTDANIKKNIMWDEQNMADYLENPKKYIPGTKMAFGGLKKEKDRNDLV
                     TYLAKATKE"
     gene            complement(<869370..>870767)
                     /locus_tag="HG536_0B04670"
                     /db_xref="GeneID:59324722"
     mRNA            complement(<869370..>870767)
                     /locus_tag="HG536_0B04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282383.1"
                     /db_xref="GeneID:59324722"
     CDS             complement(869370..870767)
                     /locus_tag="HG536_0B04670"
                     /inference="similar to AA sequence:RefSeq:NP_010874.3"
                     /note="ancestral locus Anc_1.483"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138278.1"
                     /db_xref="GeneID:59324722"
                     /translation="MIKAAVFLLALISNVLAVEAVTCNATQSCPEELPCCSQFGECGT
                     GSTCLGGCNPMFSFNSAACMPMPICQDSSTTFKNYSSRVASHDTYLGNTSEADWVYTG
                     YLYDYDDEDSMLLAMPKYSAGTVLSSTRFMWYGKVSARLKSSHLGGVVSSFILFSNVQ
                     DEIDFEYVGADLQTVQTNFYFEGILNYNNSKNISTSDTFENYHDYELDWHEDYITWSV
                     DGVVGRTLYKNQTYNDTTKRYEFPQTPSKVQLSLWPGGNATNPPGTIAWAGGEINWNA
                     DDLKDPGYYYASLQQVNITCYDPPSYASKNGTKSYQFTKDDSFLSEDVAITDKDSFLY
                     SDEGSGLDPQKGKSSSSSSAASSSTSSSSSSSSSSSSSSAGSSSSKSTSTSKGTDKSS
                     ASTGSAAAQTTTASASKTTSLSSEQSTAFVQNMKSSSSSGAGSKQQQTSTGTNGANAI
                     SVGIPLVGILFGYLL"
     gene            complement(<871131..>872732)
                     /locus_tag="HG536_0B04680"
                     /db_xref="GeneID:59324723"
     mRNA            complement(<871131..>872732)
                     /locus_tag="HG536_0B04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282384.1"
                     /db_xref="GeneID:59324723"
     CDS             complement(871131..872732)
                     /locus_tag="HG536_0B04680"
                     /inference="similar to AA sequence:RefSeq:NP_010873.1"
                     /note="ancestral locus Anc_1.484"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138279.1"
                     /db_xref="GeneID:59324723"
                     /translation="MSLPNSTEECIDRIQETCRKVANANNKDSKEMHSSLKPERRKST
                     AHRSDPALGCKELTVIEDDREDGREQIKDLNAAKAMIRRLSGDSHPPKVTATKSHFQL
                     SSTAYGVRMLSKDLSNTKVELKVEDLMIVTKKHDLSLLYLTRELVEWLMIHFPKITVY
                     VGEDLKNSGKFGAEDICRDSKCDQKRIKYWSPKYIQEHDNLFDLVLTLGGDGTVLFVS
                     SIFQKHVPPVLSFSLGSLGFLTNYQFEYFKEDLPAVLNSRIKTNLRMRLDCRAYRRRP
                     PVTDPTTGKKICVTELVAQHQVLNELTIDRGPSPFICMLELYGDNSLLTVAQADGVII
                     ATPTGSTAYSLSAGGPLVYPSVNAIMVTPICPHTLSFRPILLPDSMTLKVRVSLKSRA
                     TAWAAFDGKGRLELRKGDFITIQASPYSFPTVESHPTEFIDSISRTLNWNVREQQRSF
                     THMLSRKNQEKYASDAGNAEFEEEDIEEVVVDRSKSRPHFDDTLNAVEDSETDDIKDD
                     LEAKSISPKTKPKDQSRLPQANFTM"
     gene            complement(<872985..>874577)
                     /locus_tag="HG536_0B04690"
                     /db_xref="GeneID:59324724"
     mRNA            complement(<872985..>874577)
                     /locus_tag="HG536_0B04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282385.1"
                     /db_xref="GeneID:59324724"
     CDS             complement(872985..874577)
                     /locus_tag="HG536_0B04690"
                     /inference="similar to AA sequence:RefSeq:NP_010872.1"
                     /note="ancestral locus Anc_1.485"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138280.1"
                     /db_xref="GeneID:59324724"
                     /translation="MVRNYRFAIFAFAAIMLLVLIRSSTPLKSAADIAKVVSPTANRP
                     EVPQDFTTLPIDDKPGYIDDEKTDKGNPGVAEAVKDQSSAGKPASSKDYSTGKKCDKD
                     HQYVLMIDAGSSGSRIHVYEFDVCTQPPTLIEETFKMLEPGLSSYDTDAVGAAKSLDP
                     LLERALEVVPKDKRKCSPVAVKATAGLRLLGNAKSEKILAAVRSHLEEDYPFPVVKKD
                     GVSIMGGDEEGVYAWITTNYLLGNIGAGSKIPTTAVFDLGGGSTQIVFEPSFAPNEKM
                     VDGEHKYELTFGGQKYTLYQFSHLGYGLNEGRNKINALLVETAIADGSITKGDTKTTH
                     KLTSPCLPPEIVAPKQVVTLEDGTKYTVDFKGPVQPAGPQCRYLADKILNKHAKCSQP
                     PCSFNGVHQPSLVTTFKERNDIYAFSYFYDRTQPLGLPLSFKLDELVDLARMVCNGED
                     VWKSVFSGIEGSIAELKKDPKWCIDLSYQVSLLHTGYDIPLYRELKTAKTIADRELGW
                     CLGASLPLIERENWNCRVDQVE"
     gene            <874780..>875493
                     /locus_tag="HG536_0B04700"
                     /db_xref="GeneID:59324725"
     mRNA            <874780..>875493
                     /locus_tag="HG536_0B04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282386.1"
                     /db_xref="GeneID:59324725"
     CDS             874780..875493
                     /locus_tag="HG536_0B04700"
                     /inference="similar to AA sequence:RefSeq:NP_012584.3"
                     /note="ancestral locus Anc_1.486"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138281.1"
                     /db_xref="GeneID:59324725"
                     /translation="MSRNVDKANSVLVRYQELQAEETGGYKDYSRYKRPTKLSSVKSL
                     GEAQQWHRQIGREIKDKTTRLYDPSLNEIQLQTLNDEVNELLDEQSKWEWYMAKVLGG
                     KRVNGKRRDALVGGKLILGKRYFGRAVELPEVQDYLKKREEEEKYGKDGKGIVDFKRI
                     PRDKKSFYYGQSPVYERLRDFEREWTAILRRKVEKGKLHTSETLDVEEIRKQVPTIRE
                     METWLVEKRKKKLLEQLDR"
     gene            complement(<875505..>878255)
                     /locus_tag="HG536_0B04710"
                     /db_xref="GeneID:59324726"
     mRNA            complement(<875505..>878255)
                     /locus_tag="HG536_0B04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282387.1"
                     /db_xref="GeneID:59324726"
     CDS             complement(875505..878255)
                     /locus_tag="HG536_0B04710"
                     /inference="similar to AA sequence:RefSeq:NP_010871.3"
                     /note="ancestral locus Anc_1.487"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138282.1"
                     /db_xref="GeneID:59324726"
                     /translation="MIVCRAVCTLVAFAWLCYRLYKFLTIPVVKIVSTLKIGTPPATK
                     VSIDRVSEDSITVHWENEPVSKTSGKRHADAISHFLLYVNNLQVAIFPNAPSSLYTCC
                     SITGLESGQEYQLDFVTVNSMGFINKLPSLYCMTKAAASGGGSGKVSGQWRRNTLSVT
                     ATLPEAVTASNGGFASPSYANLTSLKDLESFSIDDLKKILVCAQEDLHDVLSQQSSLL
                     QDFQESKLQLELELENLKNYWSHEINLRKSLRSNIKSLENSKLLSDLKLEKINKNIDQ
                     TSSKIQKMKSDIQNWSQQDEQQFNRSKLRKNFEKKLQSVNKEIDSLSDMVKACQKEIS
                     SQEEKNKELNSLKKNSSSSSSSSVDQQDASMSPAILLKKICDATMEKSGLLSVNGEEL
                     ISKLNPNSPLAKFLREQLRIDQELDSKWRSKRNKMTKRIDALQTMLNEISITNQQLRT
                     NLIIQPYAVKQSEPNSISNSTSESNSNSNLNLNASISNNHAPTANSSMNLNEQGSVIN
                     SPPVSNRSLLENTINQQGVQQGVLMSTNHSSGNEDSSNLHLILHNPSTYASNKPAQAP
                     ESLLSTHLKGEKLYNKPFSRGQPDPTTLVAPGYIPQPFPWGREQQQQQQTEIEQAFEY
                     DNASHLISGLQDMIYEETDYPESISNYSKGFTTDQLDNYWTNQRSTIKNNLGSAQPVN
                     FATPHFGNNDGYSSMSPFGSKSVARSTSTPPNLAPNQSLLAATLSDPSMANFGDTMLP
                     MEHSNSFHAMDNVISNSLHEPQSVTMQNAASSHESQQPLMINEEDQLPESQKHNLHAQ
                     DHLHAPRFNFMWHPQQSHPVTSKEDTTPRHARNGSTASNVSSNSTWSKLNWKNWSPQA
                     SAQSEADNVPQSPPPLPHSASHNQKAPVSPASSGGRRMSRLLSRSGMNNIFKLPSHEE
                     KK"
     gene            complement(<878376..>878795)
                     /locus_tag="HG536_0B04720"
                     /db_xref="GeneID:59324727"
     mRNA            complement(<878376..>878795)
                     /locus_tag="HG536_0B04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282388.1"
                     /db_xref="GeneID:59324727"
     CDS             complement(878376..878795)
                     /locus_tag="HG536_0B04720"
                     /inference="similar to AA sequence:RefSeq:NP_010870.1"
                     /note="ancestral locus Anc_1.488"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138283.1"
                     /db_xref="GeneID:59324727"
                     /translation="MSNGGGNDRLEFLRRVAGENVIPVPSRFKKHGYRKPSRRHKSAR
                     QLIADESKRISLLLQEEGGGVKRVPKVTYFNVNGPPSMRPTKKYCDITGLAGLYRSPV
                     NNLRYHNAEIYQLVVKPMAPGVDQEYLKLRGDHFVLK"
     gene            <879235..>880398
                     /locus_tag="HG536_0B04730"
                     /db_xref="GeneID:59324728"
     mRNA            <879235..>880398
                     /locus_tag="HG536_0B04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282389.1"
                     /db_xref="GeneID:59324728"
     CDS             879235..880398
                     /locus_tag="HG536_0B04730"
                     /inference="similar to AA sequence:RefSeq:NP_010868.1"
                     /note="ancestral locus Anc_1.489"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138284.1"
                     /db_xref="GeneID:59324728"
                     /translation="MTDQLPQAYATASNDLRSDTFTTPTAQMMEAAMAASIGDAVYQE
                     DVDTVRLERTVAALAGMEAGLFCVSGTLSNQIALRTHLLQPPYSILCDYRAHVYTHEA
                     AGLAILSQAMVVPVRPANGDYVTLEDIKANYIPDDGDIHGAPTKVVSLENTLHGIVTP
                     LEELVRIKAWCVENGIRLHCDGARIWNAVVASKVPLKQFGELFDSISICLSKSMGAPM
                     GSVLVGDAKFIKKANHFRKQQGGGVRQSGMMAAMALVAIEGEWKSKLQYSHGLASELA
                     AFCREHGIPLESPADTNFVFLDLSKAHMDPDLLVRKGLKYAIKLMGGRIAFHYQVSRD
                     TLEKAKCAILETYEYAKEHPFDSQGQTKIYRSESTDKIDVEGNSIHDIKTYKY"
     gene            <880862..>882358
                     /locus_tag="HG536_0B04740"
                     /db_xref="GeneID:59324729"
     mRNA            <880862..>882358
                     /locus_tag="HG536_0B04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282390.1"
                     /db_xref="GeneID:59324729"
     CDS             880862..882358
                     /locus_tag="HG536_0B04740"
                     /inference="similar to AA sequence:RefSeq:NP_010867.3"
                     /note="ancestral locus Anc_1.490"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138285.1"
                     /db_xref="GeneID:59324729"
                     /translation="MFKARRLILYLIIVFGILAIRKLSQPVSPMTSKNPVVIIGSGLA
                     GLSAGNQLVTSYKIPIVLLDKAASVGGNSIKASSGINGALTNTQKALSVQDSPEAFFQ
                     DTVESAKHKGVESLMNKLSQESSSAIQWLQQDFGLKLDLLAQLGGHSAPRTHRSSGKL
                     PPGFEIVQSLKKNLESIAEKDPNLVKILLNSKVVDISLDSDLRVSGIEYIDSEGNKQS
                     LKTDNVVFCSGGFAYSKDMLKQYAPHLVSLPTTNGQQATGDGQKILEKLGADLIDMDQ
                     VQVHPTGFIDPNDRTNQWKFLAAEALRGLGGILLNPLDGKRFFNELGRRDDVTNAIQS
                     KCPKDDNRALLVMSEDLYASYKNNMDFYIFKKLVKRISIKELVSHFNIPISATELAKD
                     LQAYSVASEDTFGRKSLLNRFGDSVNPDTEVFVAEVTPVVHFTMGGARINENSQVVGK
                     NGRALANGLYAAGEVSGGVHGANRLGGSSLLECVVFGRTAAHNIARNY"
     gene            <882511..>882972
                     /locus_tag="HG536_0B04750"
                     /db_xref="GeneID:59324730"
     mRNA            <882511..>882972
                     /locus_tag="HG536_0B04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282391.1"
                     /db_xref="GeneID:59324730"
     CDS             882511..882972
                     /locus_tag="HG536_0B04750"
                     /inference="similar to AA sequence:RefSeq:NP_010866.1"
                     /note="ancestral locus Anc_1.491"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138286.1"
                     /db_xref="GeneID:59324730"
                     /translation="MIISPCFISLVDEEDKPLLVYVPSALEKDVNTVLKYNVLCNMAL
                     DYFENQLFKWSSLDTKPDIKFLFDLEGIAAYGLVIQQVGLKVIVGFSNEIKPNGLNDD
                     NIDDVFTKIKKVYLRAKLNPFVTDTSNANLAVRLKEKFGEEFPWTNTVNPV"
     gene            complement(<882959..>884632)
                     /locus_tag="HG536_0B04760"
                     /db_xref="GeneID:59324731"
     mRNA            complement(<882959..>884632)
                     /locus_tag="HG536_0B04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282392.1"
                     /db_xref="GeneID:59324731"
     CDS             complement(882959..884632)
                     /locus_tag="HG536_0B04760"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138287.1"
                     /db_xref="GeneID:59324731"
                     /translation="MTSYHLVVLVHGLWGNAAHFDYIRTALQEHARAWSDDQDEELLI
                     YTTALNEGFKTYDGIDVCGYRVAEEITDQIEAFDSSSEVGKITKFSMVGYSLGGLISR
                     YALGLLHRRQYFKIKDIQLINFTTFCTPHVGVLAPGRNMAVRIFNSTVPWLLGNSGKQ
                     MFLKDNVSSSGNGSTRGQPLIYLMSLENTVFYKALESFKYRSLYANTINDKRTAWWTA
                     GISLNDPFFNIDEYNGLRVFQYIEGFDTVVVDRTKMIVISQATVAMKEEDEALNDVES
                     KGKYEDIGQDSARHMGQDFYFLNYWFLKISKWILVIINILIIAPLLLVWKIVQSAAEM
                     TISTVRVTRFLNKYSHQILRDFFELPGPTDFDDSLSVSVSDIGSPEPGDNEICSLKST
                     LSRASSIRSNDKGNSTFSTEYGSYLGLEESLNDQADYLMESVYDAIERKNTHGGVIEK
                     AQSGSSKPDENSLAVSIIELENRSAEQLTAKHGKQKEQLIKNLDLNLPAKQRAIIKSL
                     NKLDWEKYPIYIRKTTSTHACAIVRQMDPDFQEGKVVVDHWIKNVFRRD"
     gene            complement(<885025..>885675)
                     /locus_tag="HG536_0B04770"
                     /db_xref="GeneID:59324732"
     mRNA            complement(<885025..>885675)
                     /locus_tag="HG536_0B04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282393.1"
                     /db_xref="GeneID:59324732"
     CDS             complement(885025..885675)
                     /locus_tag="HG536_0B04770"
                     /inference="similar to AA sequence:RefSeq:NP_010095.1"
                     /note="ancestral locus Anc_7.301"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138288.1"
                     /db_xref="GeneID:59324732"
                     /translation="MPLDLSPCDVGVPSCQPTFDLTKKQFLPHKNGQHIRDMVKTKQE
                     KRADENFNQSLEISVVKWKPLLVYRKDETSTENKANEGVSLFRSIGNWWNCRKQKVPD
                     TESDGLAYFYDQEDTTQTRRLSDTVFDTVTPFACPQAAVTAADRELIAINEQMVYQQY
                     YSHPMAPEYVSSSHSPYHEDKMSPFRLQQNRGYRATLTRYVDWTNPCMACKFAQGH"
     gene            <886289..>887422
                     /locus_tag="HG536_0B04780"
                     /db_xref="GeneID:59324733"
     mRNA            <886289..>887422
                     /locus_tag="HG536_0B04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282394.1"
                     /db_xref="GeneID:59324733"
     CDS             886289..887422
                     /locus_tag="HG536_0B04780"
                     /inference="similar to AA sequence:RefSeq:NP_010093.1"
                     /note="ancestral locus Anc_7.302"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138289.1"
                     /db_xref="GeneID:59324733"
                     /translation="MDMDMDVPMHDAVEEQQAAHNEDLQTSGGNDNALTTVTTNVGNE
                     GEDEEEDFKPGSSGIADHKSVKPLELNSSSIAQLDQWIEYLGNCQILSEDDVARLCKM
                     AVDVLQFEENVKPINVPVTICGDVHGQFHDLIELFRIGGPCPDTNYLFMGDYVDRGYY
                     SVETVSYLVAMKVRYPHRITILRGNHESRQITQVYGFYDECLRKYGSATVWKMFTDLF
                     DYFPITALVDNKVFCLHGGLSPMIETIDQVRELNRKQEVPHEGPMCDLLWSDPDDRGG
                     WGISPRGAGFTFGQDISEQFNHTNDLSLIARAHQLVMDGYAWSHQQNVVTIFSAPNYC
                     YRCGNQAAIMEVDENHNRQFLQYDPSVRPGEPTVSRKTPDYFL"
     gene            complement(<887621..>888211)
                     /locus_tag="HG536_0B04790"
                     /db_xref="GeneID:59324734"
     mRNA            complement(<887621..>888211)
                     /locus_tag="HG536_0B04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282395.1"
                     /db_xref="GeneID:59324734"
     CDS             complement(887621..888211)
                     /locus_tag="HG536_0B04790"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138290.1"
                     /db_xref="GeneID:59324734"
                     /translation="MLLPSYDNFINCENFSKQAAVVEDLFEPSYSILKFTLRDDDFMH
                     QARRDASNYGEFIELIRSKLLQISHNTEKVGPSSRDVDHLADIVSAHPRLGESVKRLS
                     AHSEKEQRNLSNSNDPAEIREKLAELNEDYEQAYPGLRFVVFVNGRSRSEIIKVMQER
                     IASGNSWFGEVDIAINELCCIALDRVKKWESSGFKL"
     gene            <888508..>889113
                     /locus_tag="HG536_0B04800"
                     /db_xref="GeneID:59324735"
     mRNA            <888508..>889113
                     /locus_tag="HG536_0B04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282396.1"
                     /db_xref="GeneID:59324735"
     CDS             888508..889113
                     /locus_tag="HG536_0B04800"
                     /inference="similar to AA sequence:RefSeq:NP_010146.1"
                     /note="ancestral locus Anc_7.303"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138291.1"
                     /db_xref="GeneID:59324735"
                     /translation="MSTENGFQDLDGEQETDNYQVKAKKTVDEYKKLDAGDESLKRWK
                     ESLGLSSDVLPLEYPGDKRKVVIQRIQLLVDTEPEPITFDLTNEKTIKELASKRYKIK
                     EKSIYKLRITFKVQHEIITGLRYVQYIKKAGIAVDKIDDHLGSYAPNTKTKPFYEVEL
                     PESEAPSGFLARGNYSAVSKFIDDDKTTHLTLNWGVEITKS"
     gene            complement(<889212..>890396)
                     /locus_tag="HG536_0B04810"
                     /db_xref="GeneID:59324736"
     mRNA            complement(<889212..>890396)
                     /locus_tag="HG536_0B04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282397.1"
                     /db_xref="GeneID:59324736"
     CDS             complement(889212..890396)
                     /locus_tag="HG536_0B04810"
                     /inference="similar to AA sequence:RefSeq:NP_010092.2"
                     /note="ancestral locus Anc_7.304"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138292.1"
                     /db_xref="GeneID:59324736"
                     /translation="MVTALFHKPHDRQFIIDLENSIVSFIESNAESYELRPMNSYYRL
                     LSHQIADYHNLKHTLARAPSNYVIIFKGAGFQRLSGKPLLQELEPVSSTFESLQHSQE
                     AKSSKKYKILKRIEGQDGSTSPSLADSEISSTGPSSDFDGSKADLELQRIERERQYEQ
                     KKQEIFDTPHREEVSPDKDEEGSSPQPSQFETSRYRFHNIDSPPPPQPRYNNRRKKAN
                     HYNGNKDRRNINDSKFSHKEYRGAPGVPYNMGYMMYPTATMGSGQGHHPLLPMLYPAP
                     FPMDGNNGYVPPFMYQPVTNGMVGPKGPMPASYMAFPPPFHYSQHAPNYQTMPPEVQN
                     RKYSQVSSEEPGSSSTSSSNPDIQSRTGKQKADHNSIRAENGVIDSAIDEAANGIGNL
                     SV"
     gene            <891000..>893867
                     /locus_tag="HG536_0B04820"
                     /db_xref="GeneID:59324737"
     mRNA            <891000..>893867
                     /locus_tag="HG536_0B04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282398.1"
                     /db_xref="GeneID:59324737"
     CDS             891000..893867
                     /locus_tag="HG536_0B04820"
                     /inference="similar to AA sequence:RefSeq:NP_010091.2"
                     /note="ancestral locus Anc_7.305"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138293.1"
                     /db_xref="GeneID:59324737"
                     /translation="MSLLEDVFQVTTDPNDSRGYALLESEELNQGPIGVENIDSLLLY
                     QLTENEGLNEPFAYLNDCFQRCQQQKRLAKAQPSAEKVQKTFEEIDRLVIGYGLVAFQ
                     VENFCLKGSLVEYIREIIRNVDSYMGFLSQLIQRAIVEGSLLDLLDAFFPTLQHYVTK
                     ELPLFDLNDSVTYNAVLTLFEMFVTFKPVAAVFTQISRFFGGFDCKANEFEKKTILGP
                     ILTLSPLNPNVALRNYGENLEQTQQQKKLIHESLQTEHKVVIDRLFFIVDKILRGSAE
                     SRTGLISYFAQIVNKNHLRRGDHANQNKLASNAFMTNISIILVKFSEPFLDVSYKKLD
                     KIDVNYFNSVNLFIDLSGETRMNSDFKEADEFYDKNKKDEDSKPNFISDCFFLTLTYL
                     HYGIGGTLLYDEKITPQIKRLKQEIDRIKKLTQSQDMFASFASLELKQMEKSLKITQG
                     IKDSLHGFFSHKALQLEIFDFICGASTFLIRVMDPTHQFPFSPVKLPFIPDQVGVENV
                     DNADYLRAHAPIPFKYYPEFVVEGPVNYSLYISQYNSSPLFRNPRLHSFVELATVLLR
                     CPELLSNPHLKGKLVQLLSVGAMPLTDDSPGFMMEIFENNELVNQNFLYALLDFYVIV
                     EKTGSSSQFYDKFNSRYSISIILQQLYDRIPLYREHLVWQSKNNADFFVRFVARMLND
                     LTFLLDEGLSSLAEVHSIQIEIDYRAKGLPPTREEDDQELRSKLSSAERQANSSCGLA
                     DKSMTLFEMYSRDIPKVFVTPEIVDRLASMLNHNLESLVGPKCGELKVNNPQQYSFNP
                     KALLKSLTTVYINLGDQAEFISAVARDGRSFRKELFERAVHILARKTGLVDDEFCNKL
                     LAFSNRAQEQKIAEEEEDLNYGDAPEEFLDPLMYTIMKDPVTLPTSKVNIDRSTIKAH
                     LLSDSTDPFNRMPLKLEQVVPNEDLRQRILEFRRQKRQSSK"
     gene            complement(<893971..>894544)
                     /locus_tag="HG536_0B04830"
                     /db_xref="GeneID:59324738"
     mRNA            complement(join(<893971..894330,894542..>894544))
                     /locus_tag="HG536_0B04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282399.1"
                     /db_xref="GeneID:59324738"
     CDS             complement(join(893971..894330,894542..894544))
                     /locus_tag="HG536_0B04830"
                     /inference="similar to AA sequence:RefSeq:NP_010145.1"
                     /note="ancestral locus Anc_7.306"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138294.1"
                     /db_xref="GeneID:59324738"
                     /translation="MAGIKAYELRTKNKEQLETQLVDLKKELAELKVQKLSRPSLPKI
                     KTVRKDIARVLTVMNQQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASRTTE
                     KQRKKQIAFPARKYAIKA"
     gene            complement(<895167..>895712)
                     /locus_tag="HG536_0B04840"
                     /db_xref="GeneID:59324739"
     mRNA            complement(<895167..>895712)
                     /locus_tag="HG536_0B04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282400.1"
                     /db_xref="GeneID:59324739"
     CDS             complement(895167..895712)
                     /locus_tag="HG536_0B04840"
                     /inference="similar to AA sequence:RefSeq:NP_010144.1"
                     /note="ancestral locus Anc_7.307"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138295.1"
                     /db_xref="GeneID:59324739"
                     /translation="MGLFASKLFSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVIT
                     TIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRITE
                     AREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCA
                     TSGEGLYEGLEWLSNNLKNQS"
     gene            complement(<896462..>897520)
                     /locus_tag="HG536_0B04850"
                     /db_xref="GeneID:59324740"
     mRNA            complement(<896462..>897520)
                     /locus_tag="HG536_0B04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282401.1"
                     /db_xref="GeneID:59324740"
     CDS             complement(896462..897520)
                     /locus_tag="HG536_0B04850"
                     /inference="similar to AA sequence:RefSeq:NP_010088.1"
                     /note="ancestral locus Anc_7.308"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138296.1"
                     /db_xref="GeneID:59324740"
                     /translation="MDVISESSRLQSEDSAVGPMPTKHIPPAEAEVLKKDPTKTKLKL
                     LKAVTASALMDEDKGMEERKVRRLSRGESLLDRKASKVEYVMCKVLLVVLYLLYGLYR
                     YFQYEYNKMKLRLLGIIYNPSNTPQLIRQDVTKLKKIPRRLAAILEMKSASSVGGGVK
                     GLMNDGSELVCWTVSAGIKHLILYDYDGVLKSNVADFRKEVYNKLGRYYGPSNIPKYA
                     IRIPHLNKIYFNDKDSKTPGERNKVAIEISLLSNRDGRETIVDLTKTMADLCASHELQ
                     LTDITMKLVDKELNHLVGPEPDLLLYFGPSLDLQGFPPWHIRLTEFHWEKDNDAVVYS
                     VFIRGLQKYSACKINVGK"
     gene            complement(<897802..>899997)
                     /locus_tag="HG536_0B04860"
                     /db_xref="GeneID:59324741"
     mRNA            complement(<897802..>899997)
                     /locus_tag="HG536_0B04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282402.1"
                     /db_xref="GeneID:59324741"
     CDS             complement(897802..899997)
                     /locus_tag="HG536_0B04860"
                     /inference="similar to AA sequence:RefSeq:NP_010087.1"
                     /note="ancestral locus Anc_7.309"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138297.1"
                     /db_xref="GeneID:59324741"
                     /translation="MNNEKDTNEALDQERRGFLKRAISKVSKGVSLRRGSPETSSELE
                     QGDGVGSTPCPSEEQHEGDLQISNVTYNPSETDDASLLFSKPPAPQSNLMTIVVGVFV
                     AVGGFLFGYDTGLINSIIDMNYVKENWADNPEGFTAKEMSIIVSFLSLGTFIGALSAP
                     LLSDSYGRKMTIIFSTMFVFSIGNSLQVAARSVELLIAGRVISGLGIGLISAVVPLYQ
                     GEAANKYLRGAIISTYQWAITWGLLVSSAVSQGTHSRNNASSYRIPIGLQYVWAFVLA
                     IGMLFLPESPRYYVLKDQLDKAAQSLSFLRGVPITDAGLLEELVEIKATYDYEASFGS
                     STLLDCFRSSRRRPKQTLRMLSGIAIQACQQFSGINFIFYYGVNFFNRTGVTNSYLVS
                     FITYAVNVAFNIPGLFLVEYIGRRNVLLYGGVLMTTSNFIIAIVGCSTNSVVANKVMI
                     AFICMFIASFSATWGGVVWVISAELYPLGVRSKCTAICAASNWLVNFICALITPYIVD
                     PGSHTSSMGPKIFFIWGSLNALGVVVVYFTIYETRGLTLEEIDELYSKSPNSMQSAKW
                     NKRIRKRTINEFLDETPEGESHSEASNSAVTNNQSQASTAHDAPAYVSRYTSLPEDLG
                     TANDLAVKKTMNNNEKQHNTSSETEYDDLANAYVDLGNGLGINTYTRGPPSIASDSSG
                     EIEYAEGGSFSQRRTQGSANMASVNEYMAHLMESRSESSNTRPTESPTN"
     gene            complement(<900408..>904187)
                     /locus_tag="HG536_0B04870"
                     /db_xref="GeneID:59324742"
     mRNA            complement(<900408..>904187)
                     /locus_tag="HG536_0B04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282403.1"
                     /db_xref="GeneID:59324742"
     CDS             complement(900408..904187)
                     /locus_tag="HG536_0B04870"
                     /inference="similar to AA sequence:RefSeq:NP_010086.2"
                     /note="ancestral locus Anc_7.310"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138298.1"
                     /db_xref="GeneID:59324742"
                     /translation="MVKLAEYSRTATFAWSHDRIPSLVTGTVSGTVDANFSSESKLEL
                     WSLLAADASEPTLSLAVDAKFNDLDWSRDDKIIAGALDNGVVELFSKTEDSLKSEGSF
                     ARHNGSVKTVSFNSKQNNVLASGGSKGEIFIWDLNTCLKNSKDYTPLTPGNATTPIDD
                     VSSLAWNQSLAHVFASAGSTSYASIWDLKAKKEVIHLSYASPNTGLKPQLSVVEWHPA
                     NSTRVATATGSDSEPLILVWDLRNANTPLQVLAKGHTKGILSLDWCKQDSQLLLSSGR
                     DNTIVLWNPEKAEELTQFPTRGNWCFKTKFAPEAPDLFASASFDNKIQVQTLQNLTNT
                     FDQEQTATKQQESETDFWNHVSLEESNEKPQVMHLQAPAWYKSKSPAAQWAFGGKLVH
                     ITADGKGVIITKPTISGLEENKVLDAAIKTNDYKPLINQRLAKTIDETNEEDWNFLEK
                     LSMDGKEEFLKEALSFDDEEEKQEETQQDEGEDFFANIEGAYEPKGSFSLESDIEKQV
                     AQDVVGGNLKSAVAASLDNDSLLEAMIIALDSDDKVLKDSVKRSYFAKYGDKSSLTRF
                     LFSISNNNTNDLVQNLEVSQWKYSARAIHNFYSEDPETKDEQLGKLADRLLQSGNRQD
                     ALILYLSANSLDKVAEVWLKESQDLEEKLQKQKESLHEAHSECLTEFIERFTVLARLA
                     GDKRRITNEKLISKFMEYVNLASSSGSFDLAYSILDTLPADNQEVKMEKERVMLASGK
                     SPKTSRKQAFGSTAAKPLLNNPLGNTFNSAGSSFAASASPMLNSFVNPQFPPSVSSPV
                     SAPRANPYAPPRGSEASSGKYAPPASVSPVPVAAAAQNTFKVPANPYALRTPAATGSN
                     QSSYAPLDTKPIPNFISSPPVYGETEAAAPPPPGMTSGQTPYLNKKANDGWNDLPLPV
                     TERPSRAKAGSVAPPTLPSVPIGNVPGTPSNGYARPPLSTNPSSSSPLPPPPIRSSRV
                     TSVSSTTSMKSSKVSTTNAYTQPLGSNTSTSRANPVDLATNALPPNPYAPSTATMSPK
                     LGQPNPYAPPTQPIQTAASLPPNPYATATVPPAQPVAAQRPPVGPPPVGPPPTHSRKK
                     THSSTTVENASHLLESVQKKPDHAYGGTPTPPIPTNPPASNMAPPQPAAAAGTGTPSS
                     SAPQGVPPDQQPIVDFLKAELARVAPLIPKEYSKQLKDCGKRLNILYAHLEKQDLLTQ
                     PTIEKLSNLVQLFKEGNYQEAMQVQVDIASNHPQEAGNWLTGVKRLIGISEAISN"
     gene            <904805..>905065
                     /locus_tag="HG536_0B04880"
                     /db_xref="GeneID:59324743"
     mRNA            <904805..>905065
                     /locus_tag="HG536_0B04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282404.1"
                     /db_xref="GeneID:59324743"
     CDS             904805..905065
                     /locus_tag="HG536_0B04880"
                     /inference="similar to AA sequence:RefSeq:NP_013319.1"
                     /note="ancestral locus Anc_7.311"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138299.1"
                     /db_xref="GeneID:59324743"
                     /translation="MSDSYERLESPYYKEALDQYKELSQEEDPDAWDARISKTGCYVE
                     NLALQLCHAETNDWRQCLREMGFFRQCWDSKGNRDRVKTVDR"
     gene            <905217..>905891
                     /locus_tag="HG536_0B04890"
                     /db_xref="GeneID:59324744"
     mRNA            <905217..>905891
                     /locus_tag="HG536_0B04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282405.1"
                     /db_xref="GeneID:59324744"
     CDS             905217..905891
                     /locus_tag="HG536_0B04890"
                     /inference="similar to AA sequence:RefSeq:NP_010142.2"
                     /note="ancestral locus Anc_7.312"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138300.1"
                     /db_xref="GeneID:59324744"
                     /translation="MRTKRKPTKKAALRKLHETLRSLLDKPVREINDEKHTSGIPEIL
                     PTPKSSSAKRVKKYSLSATKGKDDSAFVLSKEDQLIPKLSDNEIMERHKLADENMRRV
                     WTNIIRKYESIEDQGDVLDLYTGELVEDNGHIRGLSNDNSAGETRYQSVLKDIIELKK
                     DRDNDKFALWGDDDVEDPEDGDYEIENDQDDGREEETDDDTDYADYKQLLKGKIEAEH
                     DNVDDV"
     gene            <906055..>907170
                     /locus_tag="HG536_0B04900"
                     /db_xref="GeneID:59324745"
     mRNA            <906055..>907170
                     /locus_tag="HG536_0B04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282406.1"
                     /db_xref="GeneID:59324745"
     CDS             906055..907170
                     /locus_tag="HG536_0B04900"
                     /inference="similar to AA sequence:RefSeq:NP_013317.1"
                     /note="ancestral locus Anc_7.313"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138301.1"
                     /db_xref="GeneID:59324745"
                     /translation="MARPKTYFDISIGGQEKGRIVFELFNDVVPKTAENFIELCKGTH
                     GMSKTKPDVPLSYKGSIFHRVIKDFMLQFGDFTNFNGTGGESIYGEKFEDENFSLKHD
                     KPFLLSMANAGPNTNGSQAFITCVPTPHLDGKHVVFGEVIQGKRLVRLIENQQTDKEN
                     DKPLRDVKIEDCGVLPEDYEVPANAEETPTDAYGDNYEDSIKDDSKVDTNDVKSVLKA
                     VEFVKQIGTEQFKKQNYPVALEKYQKCDKFLKEYVPDDLPEDDLKSINELKVSVPLNI
                     ALCALKTQDYQKVLVAGSEVLYAEAANDKAKAKALYRRGLAYNALNDPDMGIADLEMA
                     TTFQQNDPSILNAIKDARLKKKQINDKQKKSLSKMFS"
     gene            <908241..>913454
                     /locus_tag="HG536_0B04910"
                     /db_xref="GeneID:59324746"
     mRNA            <908241..>913454
                     /locus_tag="HG536_0B04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282407.1"
                     /db_xref="GeneID:59324746"
     CDS             908241..913454
                     /locus_tag="HG536_0B04910"
                     /inference="similar to AA sequence:RefSeq:NP_010141.1"
                     /note="ancestral locus Anc_7.314"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138302.1"
                     /db_xref="GeneID:59324746"
                     /translation="MVAQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDET
                     QTRAKVGGLNDPRLGSIDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKV
                     CECVCMHCGKLLLDDHNEQMRQAVKIKDSKKRFNAIWSLCKTKMVCESDVPSEDDPTK
                     LISRGGCGNAQPTIRKDGLKLVGSWKKEKISGDAEEPEQRVLTMEEILNIFKHITPED
                     SCRLGFNEEFARPEWMILTVLPVPPPPVRPSISFNESQRGEDDLTFKLADILKANISL
                     ETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRARLKGKEG
                     RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLV
                     RNGPNEHPGAKYVIRDNGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSL
                     HKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP
                     LQIVSPQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPDWDGLIPTPAIL
                     KPKPLWTGKQILSIAIPKGIHLQRFDEGTTLLSPKDNGMLIIDGKIVFGVVDKKTVGS
                     SSGGLIHVVTREKGPQVCARLFGNIQKVVNYWLLHNGFSTGIGDTIADGQTMREITET
                     IADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDSVVRFLNEARDKAGRLAEVNLKDL
                     NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKG
                     FVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDSTT
                     RNSLGNVIQFIYGEDGMDASHIEKQSVDTIGGSDAAFEKRYRIDLLNVENSLDPHLLE
                     SGSEIVGDLKLQALLDQEYRQLIEDRRFLRSVFVDGEPNWPLPVNIRRIVQNAQQTFR
                     IDHTKPSDLSIRDVIFGVRALEEKLLVLRGKSNIIQQAQKDAISLFCCLLRSRLATRR
                     IIQEYRLTKQAFEWVLNNIEVQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG
                     VASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKFIRSAIEHTTLKSV
                     TVASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDETEKSLDQQSPWLLRLELDRAAMND
                     KDLTMGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSMDIETEAEEDHMLKK
                     IENTMLENITLRGVENIERVVMMKYDRKVPSSAGEYQKVPEWVLETDGVNLSEVMTVP
                     GVDSTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQ
                     GGLTSVTRHGFNRSSTGALMRCSFEETVEILFEAGACAEMDDCRGVSENVILGQMAPI
                     GTGAFDVMIDEESLVKYMPEQKITELEDGQDGGATPYSNESGLVNAEIDVKDELMFSP
                     LVDSGASDAMAGGFTAYGGADYGTGFGEAPSSPGFGGVSSPGFSPSSPTYSPTSPSYS
                     PTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPT
                     SPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPTYSPTSPSYSPTSP
                     SYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPNYSPTSPSYSPGSPSYSPNTSEN
                     QDSKSHEDAKK"
     gene            complement(<913599..>915680)
                     /locus_tag="HG536_0B04920"
                     /db_xref="GeneID:59324747"
     mRNA            complement(<913599..>915680)
                     /locus_tag="HG536_0B04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282408.1"
                     /db_xref="GeneID:59324747"
     CDS             complement(913599..915680)
                     /locus_tag="HG536_0B04920"
                     /inference="similar to AA sequence:RefSeq:NP_010140.1"
                     /note="ancestral locus Anc_7.315"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138303.1"
                     /db_xref="GeneID:59324747"
                     /translation="MNVLVYNGPGTTPGSVKHTTQTLRHFLEPYYAVSTISSKALQTE
                     PWMSKASAIVFPGGADLPYVKECRMVIPKIRDFVERQGGLFIGFCAGGYFGTSRVEFA
                     QGDPAMEVTGNRDLKLFPGISRGPAFDGFRYNSEEGARPCPLILPDGTEFATYFNGGP
                     LFVDADEFNNTEVLARYKETPDVAYYDSSSKTAEAGPAAVVLCSVGKGKALLTGPHPE
                     FIPRLLERTDDVHFLSKVVNVLKENEAKRLSFLKMIFTKAGLNCNNDFSNVRAPNLTP
                     LLVASSEGKQDTVSEFRNNIMNASGLRKTDRYVEIDGGSDIFHFYDGLSSSYDDAAAS
                     LLHEEPDEVAKAVIFPAEGETTPSLALTSNFDVDKYFKYLSPTNNIGSLLMYGEVVTS
                     TSSLLNENKIILSCIPKNSMLHVGTIQVSGRGRGGNVWINPKGVSASTAVITLPLRSP
                     KTNKPVSIVFVQYLSMLAYCQAITSYGPGYEDLPVRIKWPNDLYALNPKYYQSSKLSI
                     LGKRMGQGSQLQVISVSDIEPAYMKIAGLLVNSNFINDSYTLLLGCGLNVSHDGPTTS
                     LNTWINLLNEEREAARLDNLEPIQIEKLQALYMNHLEAYLRKFIDYGASSILPDYYRL
                     WLHSNQIVTLMDHHNARAMITGITEDYGLLVAKELVSGSNTQFTGSIYHLQPDGNSFD
                     IFKGLISKKAA"
     gene            <916098..>916898
                     /locus_tag="HG536_0B04930"
                     /db_xref="GeneID:59324748"
     mRNA            <916098..>916898
                     /locus_tag="HG536_0B04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282409.1"
                     /db_xref="GeneID:59324748"
     CDS             916098..916898
                     /locus_tag="HG536_0B04930"
                     /inference="similar to AA sequence:RefSeq:NP_010139.1"
                     /note="ancestral locus Anc_7.316"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138304.1"
                     /db_xref="GeneID:59324748"
                     /translation="MLILHPRNFAPLRPIQLLRVRGRIVASRLSYRGSVRGTSNNAEE
                     KALNTSVFTVPNVLTMTRIACTPFIGHYIWTNNLTPALGLFAYSCLTDFLDGHIARKY
                     KLKSVAGTILDPIADKLLMIVTTISLAVPPGPQLIPLPIAGLILGRDVLLGLSALYFR
                     YASMRQKYRKISWASYWDFFHYPSAEVKPTLISKYNTLFQMVYLGLGVLVLILKNREE
                     EEERGNEAVSSKSLAECFEWMGYLVAITTIFSGGSYVFSRDAVKFLKK"
     gene            complement(<917013..>918599)
                     /locus_tag="HG536_0B04940"
                     /db_xref="GeneID:59324749"
     mRNA            complement(<917013..>918599)
                     /locus_tag="HG536_0B04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282410.1"
                     /db_xref="GeneID:59324749"
     CDS             complement(917013..918599)
                     /locus_tag="HG536_0B04940"
                     /inference="similar to AA sequence:RefSeq:NP_010138.1"
                     /note="ancestral locus Anc_7.317"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138305.1"
                     /db_xref="GeneID:59324749"
                     /translation="MAAKVSSNATFQTREKPQEVRKANIIAARAVADAIRTSLGPKGM
                     DKMIKTSRGEVIISNDGHTILKQMAILHPVAKMLVEVSAAQDAEAGDGTTSVVILTGA
                     LLGAAERLLNKGIHPTIIAESFQRAAKRSVDILLEMSHKVSLKDKDDLVRAASTSLSS
                     KIVSHFSSFLAPLAVDAVLSISSEASKTVDLTDIRLIKKVGGTIADTAMVDGVVLTQN
                     VVKTAGGPIRMEKARVGLIQFQISPPKPDTENNIVVSDYRQMDKILKEERAYLLNICK
                     KIKKSKCNVLLIQKSILRDAVNELALHFLSKLNIMVIKDIEREEVEFLSKSLGCKPIS
                     DIELFTEDRLGSADLVEEIESDGSKIVQLTGVKNDKAKPTVSVIIRGANQMILDETER
                     SLHDALCVIRCLVKQRGLIAGGGAPEIEISRRLTKESRSMEGVEAFIWQEFAQALEVI
                     PTTLAENAGLNSIKVVTELRSRHEGGELNEGISVRRSGTANTYDEHILQPVLVSTSAI
                     TLASECVKSILRIDDICFSR"
     gene            <918830..>919912
                     /locus_tag="HG536_0B04950"
                     /db_xref="GeneID:59324750"
     mRNA            <918830..>919912
                     /locus_tag="HG536_0B04950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282411.1"
                     /db_xref="GeneID:59324750"
     CDS             918830..919912
                     /locus_tag="HG536_0B04950"
                     /inference="similar to AA sequence:RefSeq:NP_013316.1"
                     /note="ancestral locus Anc_7.318"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138306.1"
                     /db_xref="GeneID:59324750"
                     /translation="MDGSYTALEPLPVSRRHVENCRYSNWYHLFPGHVPLSRVIKPLP
                     AEFVRYLEQDGIRLPDPEQVKSFYTQGVVGDEENEYSDWSENEEDESSSEKAETMDPL
                     KDFPELHETIGSIIRELGAVAPKLNWSAPRDATWILPNNTMKCSEINELYLLLNASNY
                     ISFDLQHGFDECADEGDDSEGAEFELVLRQWFDINPALEFRVFVKDGRLLGVSQRDLN
                     YYSFLEPLVEDFKDVIDEFVSDVFLTKFTEKACVLDVYIPRPFNKLYLIDINPFSRTT
                     DSLLFSWNELLSEDTDGECDYELRIVSENNVGRFASKEHSENQVPKDIVDASLDPESI
                     RELTEKWRDLLRHQEAEDSDGSEKLD"
     gene            complement(<919957..>922029)
                     /locus_tag="HG536_0B04960"
                     /db_xref="GeneID:59324751"
     mRNA            complement(<919957..>922029)
                     /locus_tag="HG536_0B04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282412.1"
                     /db_xref="GeneID:59324751"
     CDS             complement(919957..922029)
                     /locus_tag="HG536_0B04960"
                     /inference="similar to AA sequence:RefSeq:NP_013315.1"
                     /note="ancestral locus Anc_7.319"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138307.1"
                     /db_xref="GeneID:59324751"
                     /translation="MKTGYIIWLLLACLPLGNGLVLIDSTLASACIYYELQYDWGCNS
                     HGTGMKAYACRCKNINWLGTVTNCIRNNSDSTRLINHALRHVATRCLQKGHLHYSLDD
                     MYRFADNGSQYLREPTLEDKSVTVNTTLLVNQTDFDWYHRKFKDYTFSVERSQWFGWG
                     LVLYWAAIVGFATFFNLCRRLAGYSLANNWCRKHITLPSAFKDYRERTYFFAKIVPLN
                     FQTRLHGLVVAVFVVLTIISVGVGYELKLPHPYLTTRWYANLNLVSYRTDLMAISLFP
                     VIYLFGIRNNPLIYISGMPYSVFQFYHRWCAYTCAVLAFIHSIIWTVWAIADGGYEMW
                     AMDAYWKWGIAATTLIVLLVFHSEKVIRDLAYEIFLVMHQFMNIAFIISMYYHCNTLG
                     WLGWIWSMAGILCYDRFIRIVRIAISGGVRTATLIDCGNRSVIKMVMKKPKYFTYAAG
                     SHAYVYFLSPTDSWYYFFQSHPFSIILKPEEDRRNPDNLVFYFKASKSITRAMLNKVM
                     KSGRGSVTCKILLEGPYGTTIPETVKGVRKTVAVCAGLGISAVYPILRENSISQRQIY
                     HKLIWIINDLTSLDWFHEELQWLKAQGTKISIVYTKADDKDVEASSKGSQTSESGYEL
                     EKLYSRPNLLSVVESEVQQASSEAVDLTIVSCGPPSFNDELRDSVVRSIAPDLKIDVE
                     LQEESYTW"
     gene            <922460..>923521
                     /locus_tag="HG536_0B04970"
                     /db_xref="GeneID:59324752"
     mRNA            <922460..>923521
                     /locus_tag="HG536_0B04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282413.1"
                     /db_xref="GeneID:59324752"
     CDS             922460..923521
                     /locus_tag="HG536_0B04970"
                     /inference="similar to AA sequence:RefSeq:NP_010137.2"
                     /note="ancestral locus Anc_7.320"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138308.1"
                     /db_xref="GeneID:59324752"
                     /translation="MSRADLPEVIVIGAGGVGVIAALSLSLAGESRVSLVVRSDYEQV
                     REHGYEINSCDYGQLRNWRPHRFFKGVEEASESGKFFEYVVVTTKNIPDGPEGSTVPD
                     VIRPIVESNRRLCPERQTNILLIQNGIDIEKDIYAKFDCANEKIVVLSGTQLIGSTKI
                     GKGVIRQIGQDHILVGPFDVQNKAAVDAAQKFIDLYRCEDRNLVLFDDKVRYTRWRKL
                     IYNSVISTTTALVGMDVSRCLKFGVAGMGTEEEIFKPGMREIFAIAASEGIELDEECI
                     SFFCDISRKQEYKPSMCIDCENGQLMELEVLLGNPLKIARENGVETPVLSLLYNMLYM
                     VQNKLKEQKGYIKFELDDE"
     gene            <923752..>925179
                     /locus_tag="HG536_0B04980"
                     /db_xref="GeneID:59324753"
     mRNA            <923752..>925179
                     /locus_tag="HG536_0B04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282414.1"
                     /db_xref="GeneID:59324753"
     CDS             923752..925179
                     /locus_tag="HG536_0B04980"
                     /inference="similar to AA sequence:RefSeq:NP_013314.1"
                     /note="ancestral locus Anc_7.321"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138309.1"
                     /db_xref="GeneID:59324753"
                     /translation="MQRILGLFCVLICFFATINAQVDFYRPLVPIHCNSVQKCPEEWP
                     CCSPYGECGSGPVCMGGCNPRFSYNETSCAPMPALVPPNNIEYSSAPLSALDGKEDAA
                     QLESRGLLHFNKYLISDVQSDARYMLENIAFTYSGPTSIHPQTGDIVLSMPRGSSGCL
                     LAATRYFLYGRSSVRMRTGRSRGVISSVVIMSAVGDEIDFEFLGSELYQVQSTYYYRG
                     ELIYNKMLEVPVSSDTNANYHDYEIDWNEHRIHWLVDGRIVRTLYKEDTWDEELGIYK
                     YPQTPMRLEVALWPGGLASNHPGTIEWAGGLIDWDNSPDMIESGKFTAHIKSMTVVPY
                     TNRYISAINRCMRREHNIAYDYIMPPDGIFDEASFAIYCGLIPNIRKWSDSGFSIPRN
                     PIQAARWSGKVFMSGKAFTPVNTETDFVQNINDLASLPNGTMIYNKTQENTFSTEQKS
                     SGASTMAQNNPLRKIKGLASTFWVS"
     gene            <925622..>929224
                     /locus_tag="HG536_0B04990"
                     /db_xref="GeneID:59324754"
     mRNA            <925622..>929224
                     /locus_tag="HG536_0B04990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282415.1"
                     /db_xref="GeneID:59324754"
     CDS             925622..929224
                     /locus_tag="HG536_0B04990"
                     /inference="similar to AA sequence:RefSeq:NP_010136.1"
                     /note="ancestral locus Anc_7.322"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138310.1"
                     /db_xref="GeneID:59324754"
                     /translation="MKMLTKFESKSTRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGT
                     LLHRYEDHEGPVRGIDFHPTQPIFASAGDDYTIKVWSLETNKCLYTLNGHLDYVRTVF
                     FHRELPWIITASDDQTIRIWNWQNRKELACLTGHNHFVMCAQFHPTEDLVVSASLDET
                     IRVWDISGLRKRHSAPGASSFEDQIASQQNLLDAGFGDCVVKFILEGHTRGVNWASFH
                     PTLPLIVSGGDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPHQNLIISVGEDKT
                     LRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERPCSVTHQ
                     NELIFINREKQVQIFDYNKKVSSLPYVSLKNLGQAWNSFKSISFNPSQHSILVNEGND
                     RFGLVLLPKKPTGAVEPSGVIEDAGSFALFVARNRFVVYNKPSESLEVRTLDNKITKT
                     IKVDGAVTDIVNSGAGCVLLLQPKRVVLFDVQQGKKLAELAVKNVKYVAWSHDGQYAA
                     LMSKHTITTVTKRLELINSMHDTIRIKSACWDETGVLIYSTLNHIRYSLLNGERGIIK
                     TLENTLYINKAQGKLIYALDRDGEMKILTIDPTEYRFKKALANKNFPEVLRIIKNSNL
                     VGQNIISYLQKSGYPEIALQFVQDPQTRFDLALEYGNLDVALEEAKKLNNNVVWSKLS
                     KEALLQGDTSLVEMICQIQKSFDKLSFLYLITGDHVKLSKMQEIAQYRGDYASFIANS
                     FYSDSALLRAKVFSQIGSLPLAYAVAKTNGDDTAAAGFLDQAGISESDVVLPDNISST
                     GFTKAPTIEEPFKKWPLKKPDRSYFEKALANEIEEPATEAPDEINSAEESKISVDEDL
                     LENEGADAEGDAWDMGEEELELGTEQPGEEESPNDDKTQTEESITATWVSNSKLPAVL
                     IAAGAFDAAAQALNRQAGIINFEPLRKNFINIFEGCRTYMASTPTELPAIPGYICADA
                     DEEDVNAILPRTPNIAVVLNFMDEGYKYFKGNKLESAVQSFRNAIYAITLLAVRSDEE
                     EETARKSLEKAREYILGLSIELERRSLPAEDVKRNLELAAYFTKAKLSPPHRSNALQV
                     AMSQSFKHKNYLQASFFAGELLKIMPSGPRADQARKVKDKADSLAYDAVAIDFDPYAN
                     FEVCASTHTPIYKGSPMVVDPLTGAKYHASEKGKTDSIALISKVGAPASGLRIQ"
     gene            <929781..>931190
                     /locus_tag="HG536_0B05000"
                     /db_xref="GeneID:59324755"
     mRNA            <929781..>931190
                     /locus_tag="HG536_0B05000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282416.1"
                     /db_xref="GeneID:59324755"
     CDS             929781..931190
                     /locus_tag="HG536_0B05000"
                     /inference="similar to AA sequence:RefSeq:NP_013313.1"
                     /note="ancestral locus Anc_7.323"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138311.1"
                     /db_xref="GeneID:59324755"
                     /translation="MAGEIITIQVGQCGNQMGKHFWSQLAREHGIGKDGQSLDNSGDA
                     RDDDTNPFFKLNEGNRYTPRALMLDLEPSAIQDVQNAFPGFFDPRSMWISPEELGAGN
                     SWSKGYDYGLANQDALLNMIDKEVDATENFEGFQLLHSVAGGTGSGLGSSLLEAISDR
                     FPKKFLTTYSVFPSDESEVVIQPYNTILTLRRLEENSDASVVFDNNALLNLTSRVFRD
                     PYTSYLHTNQLISAAMSAITNSIRFPSYMYNSLPSIFSTLVPTPELHFLVPSFTPFTS
                     DYVTGGKEPKSNTAYDVLLDLFDGSSSLVSSSIDNPTYLNVLCSVIGTTEQNDVLRAI
                     AKAQQRLNFAPWSFSSVHVNVGRQSPYLSDQTRHSYTNGLMLANTTAITSLFTKTCTT
                     FDKIFSKGAFLNTFKDGKMFQNGWDEFVESRQVVEDLTEEYMASEQETYLDGVLLEDE
                     NMVDHIDTGFDADGDDNII"
     gene            complement(<931278..>932753)
                     /locus_tag="HG536_0B05010"
                     /db_xref="GeneID:59324756"
     mRNA            complement(<931278..>932753)
                     /locus_tag="HG536_0B05010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282417.1"
                     /db_xref="GeneID:59324756"
     CDS             complement(931278..932753)
                     /locus_tag="HG536_0B05010"
                     /inference="similar to AA sequence:RefSeq:NP_010135.1"
                     /note="ancestral locus Anc_7.324"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138312.1"
                     /db_xref="GeneID:59324756"
                     /translation="MILDPSTPHPGKHDEEEVASFWSTMEKMVELPEDGRPDENINSI
                     LVGYVKNASESYMSFINSDRDLCKMAVTLTESVAFRENLEFCLSKLLSLLNIDLLEMN
                     MKFIIAYILLWESKNNLHSLEIMLEFQGFNVFYNTLYTQFAYLNKYGEDKNIARERPT
                     DANFAELSEIELKIVDGMKQISTVLMDLIFQVLKYCKCSVRNVQIIDDFFVYYLMTSI
                     RSDTVTDMFNNTQFKLLLALNEQYMILRKEYEIENKVFVYLTNDAVTTKFTELLLLKF
                     NRVQDKSLQIMMCKILYLILTADRGRIAKSFFYLNDLNVLVDVLIRELENIAENEETL
                     RNYFLRIMEPLFVNTQLSTTHYRKDDLVRVLLYLSSVDNFCSSDKVLKEHRTTAKLAS
                     RILDRVEWLNCLATEADAFDSDTSTSRKSSVSGLGITPITTMPTTADKRSDNLYNNKE
                     LEHSAESLGRRKSRPPPPPPPSRKLGLTRTITRSTPSSPAP"
     gene            <933264..>933731
                     /locus_tag="HG536_0B05020"
                     /db_xref="GeneID:59324757"
     mRNA            <933264..>933731
                     /locus_tag="HG536_0B05020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282418.1"
                     /db_xref="GeneID:59324757"
     CDS             933264..933731
                     /locus_tag="HG536_0B05020"
                     /inference="similar to AA sequence:RefSeq:NP_013312.2"
                     /note="ancestral locus Anc_7.325"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138313.1"
                     /db_xref="GeneID:59324757"
                     /translation="METLVEIQKPVVSQHVQMPMSTLLGMNSSMQPMSKTRSWDGGRS
                     GNDTTGLQTEPFLGRILNKLQSNLTLRIEERMKDKDGKNGASVEAIVNQQLVQFRKDL
                     AVYEQRKVREYTSRLEQATKENRKLSNQIVRLRERWDSLVESAKQRRIRQQEE"
     gene            complement(<933776..>935110)
                     /locus_tag="HG536_0B05030"
                     /db_xref="GeneID:59324758"
     mRNA            complement(<933776..>935110)
                     /locus_tag="HG536_0B05030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282419.1"
                     /db_xref="GeneID:59324758"
     CDS             complement(933776..935110)
                     /locus_tag="HG536_0B05030"
                     /inference="similar to AA sequence:RefSeq:NP_010134.1"
                     /note="ancestral locus Anc_7.326"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138314.1"
                     /db_xref="GeneID:59324758"
                     /translation="MSRDAPIKAEKDYSEILKEEMPKIHQLAVDDWQGALSQLLVLEK
                     KTRQAADLVSSKQLLSDLVDMLVSRGKWDELDEQLALLSKKHGQLKLSIQHMVQRIMK
                     HLGEDKTLDLETRIKTIESIRTVTENKIFVEVERARVTRDLAHIRREQGKIEEAADIL
                     CEMQVETYGSMEMSEKIEFILEQMELSILKGDYTQATVLSRKILKKTFKNVKYESLKL
                     RYYELLIKIGLYKKDYLEVAQYFQEIYQTDSVKKDEELWRPALSHMVYFLILSPYGNL
                     QNDLIHKVQLDNNLKKLETQEALVKLFTTPELMRWTVVKRTYEPLLNKDDIAFGGSNK
                     HHWDELHKRVVEHNLRVISKYYSKIALPRLNELLDLTESETETFISDLVNQGIIFAKI
                     NRPAKVVNFEKFKHSSELLNEWSQNVDQLLEHIETIGHLITKEEIIHGLKAK"
     gene            <935388..>937826
                     /locus_tag="HG536_0B05040"
                     /db_xref="GeneID:59324759"
     mRNA            <935388..>937826
                     /locus_tag="HG536_0B05040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282420.1"
                     /db_xref="GeneID:59324759"
     CDS             935388..937826
                     /locus_tag="HG536_0B05040"
                     /inference="similar to AA sequence:RefSeq:NP_010133.1"
                     /note="ancestral locus Anc_7.327"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138315.1"
                     /db_xref="GeneID:59324759"
                     /translation="MAGSQLKQLKATLKAHNLTGQTNGGKKKKGSKRQPKQYDREERS
                     KVIAQIRETFSPFEVKKVKNKRIDDSSIPVGKPGISKQIGEEQRRKVYEAKQAHRNKS
                     NGFLDRRFGERNKHMSEEDKMLERFTRERQSQSRVKSSLFDLNDDDDDDGGMFQTGLT
                     HLGEALHDDFDEGDLGLDDEDNEVRATGRSKRSLDYGENGSLGEPAEPARKKTKAEVM
                     KEIIAKSKFYKQERQKAQEKLEDQIDELDENFGDIFSELKASSAAAQAAPELQDQTDK
                     EYDIKVKELIMEKRAAPSDRTKTPEELKKEVEEKRAQLERQRNERMSGILELEDGEER
                     GVEDLDDGFWANSDDEEELGEGSFADSDEDIELEQSPSDEAEFKRDRELRDLPCPGSH
                     EELLAFLKGQRLVDQPKQIRRIIHAHQPKLAEGNKEKLGHLTAVLLQHILFLSNQDYS
                     KNLKEFAEVQNSMLKILQSLSEQYNQALSKECRKIISTIQERFKKNQFTKVLPSDLVF
                     FNLVGVIFSTSDQYHLVVTPCSILIAEFLEQAKFNTIEKLAFGAAFARTSLQYQRIAK
                     RYVPELTFFFEKCLASLLPDPSAEILHQVKIDSTKLAIENGITLNNEQSATLHLHQFS
                     GVDKLNDGLRCTLLMNVLESVKTAISLIWKELPAFQEITFNIVKLLEEYVAKFSTLEP
                     AQQILERIEKLCGFNDHTPLTLQHHKPISIPSHAPKFEENFNPDKKSYDPDKTRSEIN
                     KMKSLLKKERKFTMKEIRKDAKFEARQRIASQKESAAQYHSKMAHIINTISTEEGSEK
                     NKYEREKKLRSIKK"
     gene            complement(<938038..>940824)
                     /locus_tag="HG536_0B05050"
                     /db_xref="GeneID:59324760"
     mRNA            complement(<938038..>940824)
                     /locus_tag="HG536_0B05050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282421.1"
                     /db_xref="GeneID:59324760"
     CDS             complement(938038..940824)
                     /locus_tag="HG536_0B05050"
                     /inference="similar to AA sequence:RefSeq:NP_010132.1"
                     /note="ancestral locus Anc_7.328"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138316.1"
                     /db_xref="GeneID:59324760"
                     /translation="MDKDSPHNKRNTRDTFLSRVFGLQSEDVGSSIPTEEMSNFAEQR
                     TIEESSRLPESNNTTETGSNSSEEEELRVPESDQGTTTDEEEQHSEDIDLNDVSIPNG
                     LLRRVDKLDNLAGMGDSSVKVGQLSSDDEYNDELTGEVGADIPLFDRSKKNNRIENDT
                     SANRLSHSLLFRRVLQQDKQKQKGQQLFTSSKDGYKRRQGDASFDYDLEAGPGNRQIN
                     NKRGENTRNKVFNTKRPNLFANVSVLNNTPASKVSALSPKERALWKWANVENLDIFLA
                     EVYKYYLGNGFFCIVLEKVLNIATLIFIVFISTYMGHCIDYTRLPTSHKLSEITVEQC
                     YSQHIAGSTKVLLWVFYLFIALKVTQLYFDIQNLKEIQNFFKHLLNISEKELQTIPWQ
                     NVIQQIMYLKDQNALTANVVEVKAKNRMDAHDIANRIMRKENYLIAMFNNDVLDLSLP
                     LPLYRTSTLTKTLEWNINLCIMGYAFNESAFIKQSFLKASQHEYLSEELRKRFMLAGF
                     LNIILSPFLVAYFVLLYFFKYFNEYKTSPGTLGARQYTPMAEWKFREYNELYHLFQRR
                     IGLSTELADRYINQFPKEGSNIFLRFVAFISGSFVALLALLTILDPENFFNFEITSER
                     TALFYITILGAIWTICRNSVSDGYNVFDPEETIQELATFTHYLPNEWKGRYHTEEVKN
                     EFCKLYNLRIVVLLRELASLIITPFILWFSLPKSADKIVKFFRETSVYVDGLGYICKY
                     AMFDMNHPEIRKKNHSSSVNLDQLSDKRETNLHNDETEEQDSDENGEEENENAINKMM
                     QSYLYFIDDYENSENAVGKHHLPQKRYDDLKKAPVFNAYSWKKQFQPGQRPELFKIGR
                     HALERRALHTEVPARTSDRDESKSSDPNRTLGESFINSVPARHYDVDERRSESGTRGA
                     GVLGLVKEFYKNQI"
     gene            complement(<941075..>942334)
                     /locus_tag="HG536_0B05060"
                     /db_xref="GeneID:59324761"
     mRNA            complement(<941075..>942334)
                     /locus_tag="HG536_0B05060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282422.1"
                     /db_xref="GeneID:59324761"
     CDS             complement(941075..942334)
                     /locus_tag="HG536_0B05060"
                     /inference="similar to AA sequence:RefSeq:NP_010131.1"
                     /note="ancestral locus Anc_7.329"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138317.1"
                     /db_xref="GeneID:59324761"
                     /translation="MSSGSGSGRLPSLNSSSGKPSLKFKPKAVARRTKEEREASAPKI
                     KTEEISRPYNDKKNNQGRSTATANKQRRMQRFLSNTHVISSGPLAAGNFVSEKGSDMR
                     RGFIKTEGGTSSLVHSGLQNIEGGEANSDDDDLDHKDKEHGAKNKSKFNMGREYAVHD
                     IDGEDEDEENSDEIGEMDEEALQARRVEELFPVRPLRIRHEDIEVVEKKVQESISDAT
                     TREATPAVKTEEGVANGTELQQALEQKQANLQDRLKELSLESQFQSLDQSETLQEMKA
                     LINDHLLIGKKLNKINNKPGRFILFQLPSKLPEFEEVTPKAEQEPATDTKEESHEADK
                     GAHKSKMKDEPAKLSEDSLIGKIGSIRVHRSGKLSVKIGNVVMDISKGADAAFLQDVV
                     AINESGETPCLENLGRIDGRVVITPRF"
     gene            <942575..>944437
                     /locus_tag="HG536_0B05070"
                     /db_xref="GeneID:59324762"
     mRNA            <942575..>944437
                     /locus_tag="HG536_0B05070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282423.1"
                     /db_xref="GeneID:59324762"
     CDS             942575..944437
                     /locus_tag="HG536_0B05070"
                     /inference="similar to AA sequence:RefSeq:NP_010128.1"
                     /note="ancestral locus Anc_7.330"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138318.1"
                     /db_xref="GeneID:59324762"
                     /translation="MARRRAKNSGSRQPASARQAAEDAYGMTEVDEFASKKDKLLFEQ
                     STLAGDDDQNGFDNPYEEEEEVLAMSNESSSEEDEEEEEELDGERAYRKVFGRKLNLR
                     EEAGEDEAESMLDNDGAWGTSKGDYYGADDIEDEETAKEVEKEALRQKKKHLEELNMN
                     DYLDEELDEDWAKSAREADVGEFKEVTKQSQKVASIEDLRNMDGEAKREYIKALFPEF
                     VPLSKELSKLSVVLEELRSQEESEVISLKICALSSYLGTLSSYFGILLHELDNNDNFS
                     TMRDHPIMETILTSKEVWRQASALTDQSEKMDEEQQHGENELTDEESKEFDVNHLGKI
                     NGETGSDNGDEEPISDEENREQDENEDEDDEEDDEEDVDLDDFEEYVKQSRVPSRKNN
                     NKDGSHIVDDADDYLEGQMADVDSQEKRARRRTLRFYTSKIDQSENKKTERYKGDDDI
                     PYKERLFERQQRLLEEARKRGQQGPSNADLDAKDYDSSDEATSKAMNKESEEDFFEMT
                     RRQKQSKKDARKQAHKDAVKAARDGKLAELAEELGEDGKRAINYQILKNKGLTPKRKK
                     DNRNSRVKKRKKFEKAQKKLKSIRAVYSGGQSGVYEGEKTGIKKNLIKSVKFTN"
     gene            complement(<946970..>948286)
                     /locus_tag="HG536_0B05090"
                     /db_xref="GeneID:59324763"
     mRNA            complement(<946970..>948286)
                     /locus_tag="HG536_0B05090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282424.1"
                     /db_xref="GeneID:59324763"
     CDS             complement(946970..948286)
                     /locus_tag="HG536_0B05090"
                     /inference="similar to AA sequence:RefSeq:NP_010126.1"
                     /note="ancestral locus Anc_7.332"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138319.1"
                     /db_xref="GeneID:59324763"
                     /translation="MHRTSHSMSSAVGFEESNRSNAVVDENYDAVANLAEKPGRETGF
                     QQHRVALSDVTSQVSNKAYSGFTNNSRKTNVDSAMTKRFKMMRNENYYTDQEFNVGNG
                     EKAQPMRRAESCPADDSLEEGEAEGEADENDDEMRQPLYPIFDSKSQKRLDLAYKECH
                     RSTPDPTDDDTYDVVMVIELSTDIFKYMRELEIKFRPNPNYMDSQPELKWSYRSTLID
                     WIVQVHSRFQLLPETLYLTVNIIDRFLSKKAVTLNRFQLVGAAALFIAAKYEEINCPT
                     LKDIIYMLDNAYSREDIIKAERFMIDTLDFEIGWPGPMSFLRRISKADDYEYDIRTLA
                     KYLLETTVMDPKLAAAPPSWLAAGAYFLSKVILGSNDWTNKHIYYSGYTQEQIFPLAT
                     VILENCRYADTRHQAICKKYSERRQHRSAQVVAKWISLAEKKVDTA"
     gene            complement(<948575..>950149)
                     /locus_tag="HG536_0B05100"
                     /db_xref="GeneID:59324764"
     mRNA            complement(<948575..>950149)
                     /locus_tag="HG536_0B05100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282425.1"
                     /db_xref="GeneID:59324764"
     CDS             complement(948575..950149)
                     /locus_tag="HG536_0B05100"
                     /inference="similar to AA sequence:RefSeq:NP_010125.1"
                     /note="ancestral locus Anc_7.333"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138320.1"
                     /db_xref="GeneID:59324764"
                     /translation="MGELSEFQKKRLENIKRNNELLRKLNLVGTAGRIKREAGVDEDH
                     HRQKRKASRHAADRKSVSPKPTRVPTRRSSRLRGQPADGESVPNVSDNYLMKMGRSSS
                     PDQELVDQMKETKVIGDVKLSDLLKGENEDDLVEKFRLFADKNFSSGDFFKEIREHQG
                     KEKPHLRQLRQEFDLELYDVFQPNEIKLTHDRISAMYFHPTVDRKLILGGDTTGNIGL
                     WSVRDQPLEENGADDLAEPEITRVQLFSKNVGRIDCFPSDTSKILASSYDGFVRSIDL
                     KTLKSDQLLALTNEYNEPLGVSDCQFSYEDMNVLFLSTLTGEFTTTDLREKPSKWNLI
                     RLSDKKIGSFNINPQRPHEIATGSLDRSLRIWDIRKLVKKPKWSQYRDFPSFEIVSTY
                     DSRLSVSAVSYSPTDETLVCNGYDDTINLFDVRKEQLSESLKPRLTLKHNCQSGRWTS
                     ILKARFKQDKDVFAIANMKRAIDIYDSQGEQLAHLPTATVPAVLAWHPLRNWIVGGNS
                     SGKAFLFTDEGRVKEE"
     gene            <950280..>950603
                     /locus_tag="HG536_0B05110"
                     /db_xref="GeneID:59324765"
     mRNA            <950280..>950603
                     /locus_tag="HG536_0B05110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282426.1"
                     /db_xref="GeneID:59324765"
     CDS             950280..950603
                     /locus_tag="HG536_0B05110"
                     /inference="similar to AA sequence:RefSeq:NP_010124.1"
                     /note="ancestral locus Anc_7.334"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138321.1"
                     /db_xref="GeneID:59324765"
                     /translation="MSSNIVSVFNPPPERSLSDEETMDCVPCQVMATMFSIGFGSYLA
                     SGQPFKYTDKERQRGITLKQFESRNPKWWRNGLRGFGGALVVFGLFRGTEGWLWNKNK
                     EYKKF"
     gene            complement(<950647..>952119)
                     /locus_tag="HG536_0B05120"
                     /db_xref="GeneID:59324766"
     mRNA            complement(<950647..>952119)
                     /locus_tag="HG536_0B05120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282427.1"
                     /db_xref="GeneID:59324766"
     CDS             complement(950647..952119)
                     /locus_tag="HG536_0B05120"
                     /inference="similar to AA sequence:RefSeq:NP_010122.1"
                     /note="ancestral locus Anc_7.335"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138322.1"
                     /db_xref="GeneID:59324766"
                     /translation="MSFGAPTLFQGKSLQKRNLKQLSIPVVPEGNKSSESVNSVSGLS
                     PTVASMKLSLPKADAGNLHLRRGFKKGLNLDGQSIPEPVFPVKNHPSNENLATAPQSF
                     VVSSPTNSSPSTSTSLTQVFTPLEDDDCVKPLGENDPPQGSFIRSNDQMSINSTIQLQ
                     DLVQLGKIGSGNSGTVVKALHVPDSKIVAKKVIAVENNNQLVVNQLIRELTIMKSVHP
                     HENIVSFYGATYTHSGNNEIVILMEYMNCGSLDKILSVYKRFCGRNATARGERWFNEL
                     VVSKISYAVLNGLSYLYEKYKIIHRDIKPSNVLINSKGQVKICDFGVSKKLINSIADT
                     FVGTSTYMSPERIQGNVYSTKGDVWSLGLMIIELVTGEFPLGGHNDTPNGILDLLQRI
                     VNEPSPRLSSDHFSREMVNFVNTCCIKDESQRSSISELLCHNFITIYKPKEKEFRHWC
                     KKVKFYLKEDKQIRREDNERAKLEKKQLERAAEAAATARR"
     gene            <952776..>954212
                     /locus_tag="HG536_0B05130"
                     /db_xref="GeneID:59324767"
     mRNA            <952776..>954212
                     /locus_tag="HG536_0B05130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282428.1"
                     /db_xref="GeneID:59324767"
     CDS             952776..954212
                     /locus_tag="HG536_0B05130"
                     /inference="similar to AA sequence:RefSeq:NP_010121.1"
                     /note="ancestral locus Anc_7.336"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138323.1"
                     /db_xref="GeneID:59324767"
                     /translation="MSEDQSWKSQLNIPKKDTRPQTEDVLNTKGNTFEDFYLKRELLM
                     GIFEAGFEKPSPIQEEAIPVAIAGRDVLARAKNGTGKTAAFVIPALERVKPKLNKIQA
                     LIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLKDDILRLNETVHILVGTPGRV
                     LDLASRKLADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPQSYQSLLFSATFPLTV
                     KEFMVKHLNKPYEINLMEELTLKGITQYYAFVEERQKLHCLNTLFSKLQINQAIIFCN
                     STNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRGIDI
                     QAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEIA
                     AIPATIDKSLYVAEDTSAVPVPFPIQQQQTVQLSQPQQYVPPQQQNHQIHPQVHPLQT
                     MSQPQRGISPQDIPPPQMQGHFAAQPQY"
     gene            <954927..>955856
                     /locus_tag="HG536_0B05140"
                     /db_xref="GeneID:59324768"
     mRNA            <954927..>955856
                     /locus_tag="HG536_0B05140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282429.1"
                     /db_xref="GeneID:59324768"
     CDS             954927..955856
                     /locus_tag="HG536_0B05140"
                     /inference="similar to AA sequence:RefSeq:NP_013310.1"
                     /note="ancestral locus Anc_7.337"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138324.1"
                     /db_xref="GeneID:59324768"
                     /translation="MSSFDIDKEREQIHITTDYLRRRIKEYFKDYKTFAPRVLIICGS
                     GLGGIANRLETSDLEPLVITYGEIPGFKKSTVAGHTGTLIFGFMKGTPVVLMNGRLHS
                     YEGHTLHEATFPIRVLNHMGDVKTLIATNAAGGINADFKPCDLMCIYDHINFPGLAGL
                     HPLKGPNYDEVGPRFLPMSDTYDLGLRKLLFQKKEELKIDRPLHEGTYMFVSGPTFET
                     RAESRMIRCLGGDAVGMSTVPEVIIARHSGWKVLALSLITNNCVIDKPPSVHEEAPKP
                     MDDGIASHEEVLENSKKVSLDVQLLVEHVVGEL"
     gene            complement(<955961..>956845)
                     /locus_tag="HG536_0B05150"
                     /db_xref="GeneID:59324769"
     mRNA            complement(<955961..>956845)
                     /locus_tag="HG536_0B05150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282430.1"
                     /db_xref="GeneID:59324769"
     CDS             complement(955961..956845)
                     /locus_tag="HG536_0B05150"
                     /inference="similar to AA sequence:RefSeq:NP_013309.1"
                     /note="ancestral locus Anc_7.338"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138325.1"
                     /db_xref="GeneID:59324769"
                     /translation="MPTIANAHNDLIHDAVLDYYGKRLATCSSDKTIKIFEVDGENHK
                     LVETLVGHEGPVWRVDWAHPKFGTILASCSYDGKVLIWKEENGRWAQIAVHAVHSASV
                     NSVQWAPHEYGALLLAASSDGKVSVVEFKDNGTIAPLVIDAHAIGVNSGSWAPSIIQE
                     GPGAQQIRRFVTGGADNLVKVWKYNQEAHTFVLEESLEGHSDWVRDVAWSPSILLRSY
                     IASVSQDRTCIIWSQEHTGGPWKKTLLQQNKFPDVLWRASWSLSGNILALSGGDNKIT
                     LWKEDLQGKWEPAGEVQE"
     gene            complement(<957039..>959504)
                     /locus_tag="HG536_0B05160"
                     /db_xref="GeneID:59324770"
     mRNA            complement(<957039..>959504)
                     /locus_tag="HG536_0B05160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282431.1"
                     /db_xref="GeneID:59324770"
     CDS             complement(957039..959504)
                     /locus_tag="HG536_0B05160"
                     /inference="similar to AA sequence:RefSeq:NP_013308.1"
                     /note="ancestral locus Anc_7.339"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138326.1"
                     /db_xref="GeneID:59324770"
                     /translation="MRAKKFTLAGIGLLTFSLTSATDPWNQANEMLRQAVKRTDPISY
                     PYPDSGNNDRLKDAALYVPMDYYREDQERHYELFWREEASEWQRTVYSLLAESSDRYD
                     NADATYTLAQLHLWGDYDFPHNKTLAFKYASRFNEMTKWSNSSILFDLGVMYSTGLFG
                     YIPVDTVKSLLCYQVSASLGDIRAKNVLAYKYYSGHNVPRDCNKALLLYKEVADEIRD
                     SFSEEEWNIRFPYIETYNVRIPDFSDGLLGKDLSSMDLTTKRVASARPDITSSFLTQM
                     NGGQIVLKFGSKSSGGAFSTEDDESEDRLVDIYYTAWDDYRGTYTKARDCEASRKLLE
                     LTFRAYDADVPYMDNLQKFFYGRCLDLLGHIYFTGEAEGSPNITLAEKYLQRSIEVIE
                     KNSNLRCRSNIDLGLINQYLYNNVTEALRYYKKVSATHSNDGTVEFQLAKLSRKYPEM
                     ELGDPFGLMQTAHLLGHCHATYEFATMTEQSMNNRYSCEDSAYLYKKFVEDNEEIMAP
                     QLKTAYGELLRGNAEVALWGYALAAEQGFEPAQVSAAYILYQLPCNLEDPPRTLPERK
                     QMAISYYIRAFKQDNVDAGVVAGDIFYRMGNFSKALSAYHSAALKFSPQAIWNLGYMY
                     EHGLGTEVDFHLAKRYYDQVLEHNSKLYLAVKLSVLKLRLKSWLTWVTNGRLKYGRME
                     DDDNVDDSDSWFERVIKSFKKAGRENSGIPTGTDAQSNGRGVPAQRQRQNQQQQEQQP
                     QQPDREQAQEHVTLWDRLENLGLQPEDLMTIAFVLFIFLFSLIIRTLAARRGWNVRNN
                     NGMRIQINGQRPRGNFDIQVFAI"
     gene            <959996..>960268
                     /locus_tag="HG536_0B05170"
                     /db_xref="GeneID:59324771"
     mRNA            <959996..>960268
                     /locus_tag="HG536_0B05170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282432.1"
                     /db_xref="GeneID:59324771"
     CDS             959996..960268
                     /locus_tag="HG536_0B05170"
                     /inference="similar to AA sequence:RefSeq:NP_878060.1"
                     /note="ancestral locus Anc_7.341"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138327.1"
                     /db_xref="GeneID:59324771"
                     /translation="MSNAIPQETIALILEVGAFEHGTTKITEETVGMLQKYMEIFVRE
                     AVLRSSVNKEQVKKEQDAVYGKREAKEVTLTHEDLENVTGLLLLDM"
     gene            complement(<960376..>961863)
                     /locus_tag="HG536_0B05180"
                     /db_xref="GeneID:59324772"
     mRNA            complement(<960376..>961863)
                     /locus_tag="HG536_0B05180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282433.1"
                     /db_xref="GeneID:59324772"
     CDS             complement(960376..961863)
                     /locus_tag="HG536_0B05180"
                     /inference="similar to AA sequence:RefSeq:NP_010120.1"
                     /note="ancestral locus Anc_7.342"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138328.1"
                     /db_xref="GeneID:59324772"
                     /translation="MSKQFVRSAKNVVKGYSSAQVLVRNATANDSDGPSVDTLDDLAE
                     KTYDSVEFFEIMDMLDKRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYII
                     KTLQEFRHEDDSGVDQGQIVRVKAKELTNLLKDEERLREERNLNRRGGREERRTRRTD
                     RSGSDPYDDDLQRALEESKLTVEEDERRRRLLNTEDEDLQAALQLSKEEEELKRLQEL
                     QRLQQQQETQQQSLYYDIFGNPISPEEYLQYQQQQELLAQQQREQELLAQQEQQRLAE
                     QQMYWQMQQDALAQQQALAQQQALAQQQAALQQQQQAAYYQQPMATGSNNPFALNNMQ
                     LQQNVPAKASPLPDLTGFAPMQAQSPKPQTQQQPEQHAPPPQQQAPIKPVRTGDLAIS
                     EKFGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYKQVTNEPKKNPFL
                     SGQYTGLPSSNVVPSYTGYGFGNQPPPQQTQQSQSADQGISLIDL"
     gene            <962278..>964380
                     /locus_tag="HG536_0B05190"
                     /db_xref="GeneID:59324773"
     mRNA            <962278..>964380
                     /locus_tag="HG536_0B05190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282434.1"
                     /db_xref="GeneID:59324773"
     CDS             962278..964380
                     /locus_tag="HG536_0B05190"
                     /inference="similar to AA sequence:RefSeq:NP_010117.1"
                     /note="ancestral locus Anc_7.343"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138329.1"
                     /db_xref="GeneID:59324773"
                     /translation="MFQSLGRSVSTSLARSGMSSGAKKQVTLARFFSQVKQDDTKNAA
                     VDDEKAEVQPQPADIDSEEQPAKRLKPSWPVKSAPVKAERTVSKAAYYSKVPYSEVCN
                     VFQEIEGTSSRLAIIRICSEFFSRIMRDNAQNLVPATYLFINKLGPDYEPGLELGLGE
                     GLLMKTISEACGKSLAQIKSRYREIGDLGRIALEARNVQPTMFKPSPLTVGEVFENLR
                     AIAHSQGKDSQTRKVKLIKRMLTACEGLEAKFLIRSLESKLRIGLAEKTVLISLSKAI
                     LTNESAAGKEPPMDLVESAEAKIREAFCQVPNYEIVINACLEHGIMELDKHCQLRPGI
                     PLKPMLAKPSKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTE
                     RYPEIHIRDFVADLSTTKSLILDCEAVAWDKEQQRILPFQVLSTRKRKDVEAKDVKVK
                     VCLFAFDILCHNGERQINKSLRERRALLRAVTKPVTGEFEYAVELTTSTVEELQRFLD
                     QSVKEFCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLDGIGDSVDLCVLGAYYGRG
                     KRTGTYGGFLLGCYNEDTGEFETCCKIGTGFSDEMLQQLYDRLKTTAIDGPHATYVFE
                     PSAEPDVWFDPTTIFEVLTADLSLSPIYKAGASYYDKGISLRFPRFVRTRDDKSVEEA
                     TSSTQIIELYQNQSHVGS"
     gene            complement(<965610..>965918)
                     /locus_tag="HG536_0B05200"
                     /db_xref="GeneID:59324774"
     mRNA            complement(<965610..>965918)
                     /locus_tag="HG536_0B05200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282435.1"
                     /db_xref="GeneID:59324774"
     CDS             complement(965610..965918)
                     /locus_tag="HG536_0B05200"
                     /inference="similar to AA sequence:RefSeq:NP_013305.1"
                     /note="ancestral locus Anc_7.345"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138330.1"
                     /db_xref="GeneID:59324774"
                     /translation="MFGQSFRQLCTVAARSVSRPNVVRMEIGLFRTTWKSQLSITPRP
                     WIPTLPWDGALQQPEGPGEVKMELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGR
                     "
     gene            <966213..>967493
                     /locus_tag="HG536_0B05210"
                     /db_xref="GeneID:59324775"
     mRNA            <966213..>967493
                     /locus_tag="HG536_0B05210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282436.1"
                     /db_xref="GeneID:59324775"
     CDS             966213..967493
                     /locus_tag="HG536_0B05210"
                     /inference="similar to AA sequence:RefSeq:NP_013304.1"
                     /note="ancestral locus Anc_7.346"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138331.1"
                     /db_xref="GeneID:59324775"
                     /translation="MMLSTTNRISTLRVNRCYKILNQRRFIIGFVRNSLGLDPPPSPD
                     DPTPENRFYPWDQSPAGDLRERAARIRTLARCPVTGKEINYTCPLSGIPTHHSREAWE
                     QDKQYHSSKKYELLKKVNIYEHDLRSGRPFPEFDFPLGQDFDRAVNMTNWDLFFYTRQ
                     FYSMDTEFQLAAVTKMLSYPISIASVLHQFSPYSLNPKGPITLEGLKSLAALRYTLYP
                     LEHRTVSTSNKDRPMRIFILGARAEAQLPGHVWKQLQFLFPDQMFELHFIGPECLLNK
                     EKHQYVVSSTPVVKRVDETLAFVYHTDYFHVFHEAQDFFPYDPYLDVFFCFHPGFGAP
                     ESSKSWMDETMKGLLETKCAIFTTGFNQTDLLRDVEAVKGKFGKEVDVLMEPVKNVFG
                     STKWELNDMNPQEVYQFNMYIAGFRGKRYHAIEV"
     gene            complement(<967651..>968226)
                     /locus_tag="HG536_0B05220"
                     /db_xref="GeneID:59324776"
     mRNA            complement(<967651..>968226)
                     /locus_tag="HG536_0B05220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282437.1"
                     /db_xref="GeneID:59324776"
     CDS             complement(967651..968226)
                     /locus_tag="HG536_0B05220"
                     /inference="similar to AA sequence:RefSeq:NP_010116.1"
                     /note="ancestral locus Anc_7.347"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138332.1"
                     /db_xref="GeneID:59324776"
                     /translation="MEKFGLKALVPLIKLDDRQSANVYDHSITLGADLSSMLHSLGIP
                     RDSKRHKVLDTFQSPWAETSRSEVEPGFFIPDSFTNIPQVLQSQTTPPCFNSVQQDQQ
                     RVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSD
                     GLSERGSYVFFDPQRWEKCQREFLLFYNAIM"
     gene            <968390..>969046
                     /locus_tag="HG536_0B05230"
                     /db_xref="GeneID:59324777"
     mRNA            <968390..>969046
                     /locus_tag="HG536_0B05230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282438.1"
                     /db_xref="GeneID:59324777"
     CDS             968390..969046
                     /locus_tag="HG536_0B05230"
                     /inference="similar to AA sequence:RefSeq:NP_010115.1"
                     /note="ancestral locus Anc_7.348"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138333.1"
                     /db_xref="GeneID:59324777"
                     /translation="MEARRFKPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAK
                     EHDCHDGYDEARKSYIVDEDRLLDELEPLLRQGASIVDWHVNDVFPERLIDLVVVLRC
                     DNAILYDRLKSRGYHDSKIEENLDAEIMGVVLQDALDSYEHEIVVELRSDTTEQMEAN
                     VDRIVSWVQLWLKQHKEGVTNELERQADGHGADDGEQDSEQDSDDSSFGHSVADEQDD
                     "
     gene            <969272..>971053
                     /locus_tag="HG536_0B05240"
                     /db_xref="GeneID:59324778"
     mRNA            <969272..>971053
                     /locus_tag="HG536_0B05240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282439.1"
                     /db_xref="GeneID:59324778"
     CDS             969272..971053
                     /locus_tag="HG536_0B05240"
                     /inference="similar to AA sequence:RefSeq:NP_010114.1"
                     /note="ancestral locus Anc_7.349"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138334.1"
                     /db_xref="GeneID:59324778"
                     /translation="MYYVVLEVETIHRAEAPKDHGRVKKLAYQFVDAETLKAHYEDGK
                     IPCLDMDAEGLPSFQESISSFEKELQSVVGSDEFVLCSLNSTWHIRVTIPRQARDDGF
                     MLPSYLQHPKVFDVWKEYDRWCANHPEVLTMRKNCSGGTRRAKNQAEILKVLDISSEE
                     IVPQPVLGHTVHILMQLRRKCTTKEDLADVLTRPYDSHLDIRNFLQEKSKVLYLNNLP
                     PDTTQSELESWFTQFGARPVGFWTVKNIVEETANINNNWSMNNSPYVEEQDSISGFVV
                     FQTHEEATEVLVLNGRSILSNMANTKQPRVVEHIVEIQPSSTRVLDRAQEILSPFPQS
                     KNKPRPGDWNCPSCGFSNFQRRTACFRCSFPAVSAVKQYLNYNGVLGATQNSNGSYTK
                     SNGIPTQSYYQTNSPTAQNSTAKTNTTFGDPNSLKQSNSGYRFGGNSAYGSNTSLANY
                     SNNRYISQQSNNSNGGSNVPFRAGDWKCPACTYHNFAKNLVCLRCGAAKMTTLESNGN
                     QSSNAVKPTGGNNNGGDNGNNGKGGCKRYDNGSLGNLTQSGSTASLIEHNTNSKGNGY
                     FTRSINNVSGGELGVKLNTRSASEPKW"
     gene            complement(<971129..>972301)
                     /locus_tag="HG536_0B05250"
                     /db_xref="GeneID:59324779"
     mRNA            complement(<971129..>972301)
                     /locus_tag="HG536_0B05250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282440.1"
                     /db_xref="GeneID:59324779"
     CDS             complement(971129..972301)
                     /locus_tag="HG536_0B05250"
                     /inference="similar to AA sequence:RefSeq:NP_010113.1"
                     /note="ancestral locus Anc_7.350"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138335.1"
                     /db_xref="GeneID:59324779"
                     /translation="MSGASTEGKPITCVAAVAYEAGKPLTVEEIIVEPPKAHEVRIRV
                     EYTAVCHTDAYTLSGVDPEGAFPSILGHEGAGVVESVGEGVTNVKPGDHVIALYTAEC
                     QKCKFCLSGKTNLCGAVRATQGKGVMPDGTSRFKNKKGETLFHFMGCSTFSQYTVVAD
                     VSVVAVDPSAPLESICLLGCGVTTGYGAAVKTADVQEGDTVAVFGGGTVGLSVIQGAK
                     LRKASKIILVDINDEKKKYAKEFGATDFINGRTDLKEGQTIVEKLIEMTDGGLDYTFD
                     CTGNTKVMRDALEACHKGWGTSIIIGVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGR
                     SEMGGLIEDYKKGKLKVDEFITHRKPFAEINEAFENLHSGECLRTVLDLQNSPCIC"
     gene            <973319..>974101
                     /locus_tag="HG536_0B05260"
                     /db_xref="GeneID:59324780"
     mRNA            <973319..>974101
                     /locus_tag="HG536_0B05260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282441.1"
                     /db_xref="GeneID:59324780"
     CDS             973319..974101
                     /locus_tag="HG536_0B05260"
                     /inference="similar to AA sequence:RefSeq:NP_013302.1"
                     /note="ancestral locus Anc_7.351"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138336.1"
                     /db_xref="GeneID:59324780"
                     /translation="MSVNRFFGGVRLFRRSYHPAGFEYVKASNKRGPLAYGKESSQYA
                     VLSHALQRSVPLYGFNERAIVHSLNELGYSSTMLSVIGSSNPPSFLHSSPALMELIKF
                     HLADKRISLTENISSETPAEELPTLEELFIKRLEMNLPVAEHLSQLLSQLAIPGPFLL
                     DVSMPELHRLSDDLIYYSSEKDSHDFAWYSKRLAVSCAYMSSELFMAQDKSPNYRETF
                     DFARDKLHRVFTLGEYYNNTEEFAWYTLLSTINLVKSQLARG"
     gene            complement(<974150..>974473)
                     /locus_tag="HG536_0B05270"
                     /db_xref="GeneID:59324781"
     mRNA            complement(<974150..>974473)
                     /locus_tag="HG536_0B05270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282442.1"
                     /db_xref="GeneID:59324781"
     CDS             complement(974150..974473)
                     /locus_tag="HG536_0B05270"
                     /inference="similar to AA sequence:RefSeq:NP_013301.1"
                     /note="ancestral locus Anc_7.352"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138337.1"
                     /db_xref="GeneID:59324781"
                     /translation="MSDLAAKYQALQSELEDLVIARQKLETQLQENKIVNEEFDQLKE
                     DTQVYKLTGNVLLPVEQDEAKANVAKRLEFIKGEITRCENNLKAKQQEQEKLRTELIK
                     LRGSS"
     gene            <974629..>975521
                     /locus_tag="HG536_0B05280"
                     /db_xref="GeneID:59324782"
     mRNA            join(<974629..974634,974700..>975521)
                     /locus_tag="HG536_0B05280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282443.1"
                     /db_xref="GeneID:59324782"
     CDS             join(974629..974634,974700..975521)
                     /locus_tag="HG536_0B05280"
                     /inference="similar to AA sequence:RefSeq:NP_013300.2"
                     /note="ancestral locus Anc_7.353"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138338.1"
                     /db_xref="GeneID:59324782"
                     /translation="MLFKQWNEIAEPRHQLDSPVGIADEGTLQPSALPKVTLPVIDFK
                     RYRRVVLSSAIMNPLFPERLLKLACVGDMEATLDITTINTTEDHAVHSWSFDENFPNE
                     MDPERAEQEKSRSFRVSTPIVAFDDTLIISLKENFLKDSPIFTNIIAEQIVRELASCG
                     APSGIEVVVLGTSDQVAEMKRVDDSSTTLNPPEFVTGFAGAVLTQLIGCRIPFQGIIA
                     PSEGPIGYEKLNLVTMQELVNLCHQWVTVDREVYKNECYRRWRLEGAAIGAQSGLYI"
     gene            complement(<975598..>977142)
                     /locus_tag="HG536_0B05290"
                     /db_xref="GeneID:59324783"
     mRNA            complement(<975598..>977142)
                     /locus_tag="HG536_0B05290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282444.1"
                     /db_xref="GeneID:59324783"
     CDS             complement(975598..977142)
                     /locus_tag="HG536_0B05290"
                     /inference="similar to AA sequence:RefSeq:NP_013298.1"
                     /note="ancestral locus Anc_7.354"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138339.1"
                     /db_xref="GeneID:59324783"
                     /translation="MAPIDYLLFEEPTGYAIFKVKLQQDDIGSRLSEVQQQINDFGSF
                     TKLVELVSFAPFKGAAEALENANDISEGLVSESLKAILNLNLPKGSKKQSVTLGISDR
                     NLGPSIKEEFPYVDSVSNELAQDLLRGVRLHGEKLFKGLQSGDLERAQLGLGHAYSRA
                     KVKFSVQKNDNHIIQAIALLDQLDKDINTFAMRVKEWYGWHFPELAKLVPDNYTFAKL
                     VLFIKDKASLNEDSLHDLAAILNDDAGIAQRVIDNARISMGQDLSETDMENVCVFAQR
                     VVSLADYRRQLYEYLCEKMHTVAPNLSELIGEVIGARLISHAGSLTNLSKQAASTVQI
                     LGAEKALFRALKTKGNTPKYGLIYHSGFIAKASTKNKGRISRYLANKCSMASRIDNYS
                     DEPSNVFGSVLRKQVEQRLEFYSTGKPTLKNELAIKEAMELYNDGKPQEEQKKPEDEA
                     KKSKKRSKEESEEDEEEEDKKKVKRDKKEKKEKKDKKEKKEKKEKKEKKEKKDKKEKK
                     DKSKKN"
     gene            <977761..>978357
                     /locus_tag="HG536_0B05300"
                     /db_xref="GeneID:59324784"
     mRNA            <977761..>978357
                     /locus_tag="HG536_0B05300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282445.1"
                     /db_xref="GeneID:59324784"
     CDS             977761..978357
                     /locus_tag="HG536_0B05300"
                     /inference="similar to AA sequence:RefSeq:NP_010112.1"
                     /note="ancestral locus Anc_7.355"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138340.1"
                     /db_xref="GeneID:59324784"
                     /translation="MSRCFLSEQMIGSEALMVYSGAYHSSVQNTNNFTVGSSQSQGFT
                     WNQDLFASQYQQMCKVVYDGHEDSIGGLVESIKEKYKMLELSRQRSSFSKTSGEEVDC
                     DEEMEDDDEALVDCDGYYISHRRARGVRFFNRSDSGSSTHPHFAEEFNRPRRISERSI
                     SFVSDSKNGNYNRSDIAVIEVESDTPENNHLRWLISSS"
     gene            complement(<978424..>980136)
                     /locus_tag="HG536_0B05310"
                     /db_xref="GeneID:59324785"
     mRNA            complement(<978424..>980136)
                     /locus_tag="HG536_0B05310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282446.1"
                     /db_xref="GeneID:59324785"
     CDS             complement(978424..980136)
                     /locus_tag="HG536_0B05310"
                     /inference="similar to AA sequence:RefSeq:NP_013297.1"
                     /note="ancestral locus Anc_7.356"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138341.1"
                     /db_xref="GeneID:59324785"
                     /translation="MISATTWVPRGYASEFPEKYELDDEEMERINQLAQLNLEDARAD
                     LEDAEQEEESNGRTAVNTSKLNDEWAMDDDLKEYDLENYDNDEEEGGLQVSMFPGLSN
                     EDVKFHEAEDGKDAYISLPTQEETAEERAELQVYPTDNMILATRTEDDISYLDVYVYD
                     DGAGFHDESIPVEEGDEADPDVGRGLVRDSSLYVHHDLMLPAFPLCVEWLDYKPGSNS
                     EDPANYAAIGSFDPQIEIWNLNCVEKAFPDVILGEPENQSGATSSKKKKKSKKGRQHV
                     TTHHTDAVLSLSHNRQFRTVLASTSADATVKLWDLNNATAARSMASIHGGKNVSSSEW
                     HRVNGSVLLTGGYDSRIALTDVRIPDDSAMSKYWSVSPGEEVETVTFADDNILLCGTD
                     AGNIYSFDIRNNENSKPVWTLKAHDAGISSLCANRFVPGLMSTGAMGEKAVKLWKFPV
                     SDTSSSKGPSMVLSRDFGVGNVLSVSYATDIEVAGNMVIGGVNKGLKLWDVFTNRAVR
                     KVFSNELSELQRRARDEAAQLNRSSRIARKYTKNDNPETVITVDDQRDDDPDEAEEGD
                     WETM"
     gene            <980394..>981767
                     /locus_tag="HG536_0B05320"
                     /db_xref="GeneID:59324786"
     mRNA            <980394..>981767
                     /locus_tag="HG536_0B05320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282447.1"
                     /db_xref="GeneID:59324786"
     CDS             980394..981767
                     /locus_tag="HG536_0B05320"
                     /inference="similar to AA sequence:RefSeq:NP_013296.1"
                     /note="ancestral locus Anc_7.357"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138342.1"
                     /db_xref="GeneID:59324786"
                     /translation="MSGEQNEKLTELLKLLKLNNGDLSKLTQEQRKEMKDYKFWKTQP
                     VTRLDESVQKEGPIDRKKTPDEISDQPLPLLGDFEWCTVDVTDQKQLEDVFLLLNENY
                     VEDRDATFRFKYTREFFNWSLRSPGWKQDWHVGVRVGSTKKLVAFISAIPVNLRVRDN
                     TVRSVEINFLCVHKQLRGKRLTPVMIKEITRRVNRCDIWYALYTSGTILPSPVSVCRY
                     THRPLNWSKLHDVGFTHMPSHATRNQMIAKYTLPKATSTEGLRPMEEKDLDEVRLLFE
                     KYQSRFDLVQNFDEAEFKHWFLGNDEKTASNPSSKVIYSYVVENQNGQISDFFSFYSL
                     PFTILNNSVHKELGIGYLFYYASDADLEYADRFSPEATAALKERLCGLMNDACILARD
                     AKMDVFNALTSQDNALFLEPLKFGPGDGFLNFYLFNYRAFPITGGIKDDKSYDTVKRS
                     NVGVVML"
     gene            <981964..>982569
                     /locus_tag="HG536_0B05330"
                     /db_xref="GeneID:59324787"
     mRNA            <981964..>982569
                     /locus_tag="HG536_0B05330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282448.1"
                     /db_xref="GeneID:59324787"
     CDS             981964..982569
                     /locus_tag="HG536_0B05330"
                     /note="similar to Saccharomyces cerevisiae YLR194C;
                     ancestral locus Anc_7.358"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138343.1"
                     /db_xref="GeneID:59324787"
                     /translation="MGSNRSILEALAPVEYNQHNSRLKKRMRLIALLALAPWLPAIAA
                     INYGSLEGEEESPVKSVKPKATKMTSNSHFPTSKPNTKSSSVKMSTSTLTSMTTQKTI
                     TYAEDPLTTVTTTNELGSTTVKPLWWIPSEASTDLATTTATEAQSGLATESYTTHAAL
                     AKQASLSNTTSGVITQSNAAKNAMANLGLAGSMAVVLMNLI"
     gene            <982704..>983234
                     /locus_tag="HG536_0B05340"
                     /db_xref="GeneID:59324788"
     mRNA            <982704..>983234
                     /locus_tag="HG536_0B05340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282449.1"
                     /db_xref="GeneID:59324788"
     CDS             982704..983234
                     /locus_tag="HG536_0B05340"
                     /inference="similar to AA sequence:RefSeq:NP_013294.1"
                     /note="ancestral locus Anc_7.359"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138344.1"
                     /db_xref="GeneID:59324788"
                     /translation="MVLWHKNAHVFDNDFGTVSLAFFNRYPNPYAVHVLSIDTLSRET
                     DSEGLLHTTRLIKKTGKLPRWSKTLLGKITDSWIIEHSIVDPSKMVMKTFTKNLDHTG
                     IMQVEEYTTYQSTRDTQKTLVTSQVKFSSGFGVGIKNKIEEWSRTKFDENVKKSRLGM
                     TFVMQQLQNRSDVCAC"
     gene            complement(<983304..>985049)
                     /locus_tag="HG536_0B05350"
                     /db_xref="GeneID:59324789"
     mRNA            complement(<983304..>985049)
                     /locus_tag="HG536_0B05350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282450.1"
                     /db_xref="GeneID:59324789"
     CDS             complement(983304..985049)
                     /locus_tag="HG536_0B05350"
                     /inference="similar to AA sequence:RefSeq:NP_010111.1"
                     /note="ancestral locus Anc_7.360"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138345.1"
                     /db_xref="GeneID:59324789"
                     /translation="MLYIWCRISRRVSQVMGDMRRRKRFMLDVGPGSVSMAGFTVVSS
                     RKHSRTGCITCKVRKKRCSEHKPVCNDCRRLGFSCVYLPRCVDRRVMLQCRSQVEREL
                     LGHKGGRRRPAALDETIEPPAMDDYVSLDQQRALTAPVLLELEPAGVHLYNYYRSHLA
                     QIVSIAPMRQNYYLQVFLPMAHQHSGILYGIMAWSAHHLSISAENGEAEGSRDQKYLE
                     LANKYTLESLRRLREDQANGPNFLWSLAQLLILCAAEICQGDVNKWKILLKFGAELIE
                     QHVGRDICKVFSHRSLTGTMPGLDSTTRYWLLANFIYHDIMCSQGTFFPTEQYRRALC
                     RRDGENSVPSVLAVGEDPQSEKLHLDPLNGINRPILLYLGDINNLTRKMKLGPLPFNR
                     DHPHFKTYMQEALSLEAGLHQLVPNTVDLKLYQECPEDHELCLQLFRLMQTAALVHLK
                     TSCLKYSKYCMEIQYLWMRLSESLERVLGTKLEGSLCFPMFICGITCTDQQQRDLMEA
                     RFNDMMKRYKCYNFQRARTIVRKIWKYEYTDLPSRRSSGASSTSSGDDNMSFDLSIKD
                     WYDIVDEMGWDISFA"
     gene            <985591..>991992
                     /locus_tag="HG536_0B05360"
                     /db_xref="GeneID:59324790"
     mRNA            <985591..>991992
                     /locus_tag="HG536_0B05360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282451.1"
                     /db_xref="GeneID:59324790"
     CDS             985591..991992
                     /locus_tag="HG536_0B05360"
                     /inference="similar to AA sequence:RefSeq:NP_010110.1"
                     /note="ancestral locus Anc_7.361"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138346.1"
                     /db_xref="GeneID:59324790"
                     /translation="MILKSDCFDPLQEAYEGGSPQDYSRNHSHKSWANVIPDRCGLYE
                     PEYEKDACGVGFVANIKGEQSHKIVSDGRFLLCNMTHRGAVSSGGNGDGAGILVGIPH
                     EFMQREFKADLGVEIPGRGEYAVGNVFFKKEQEHEALQRAKTVFEEMAGALELAVLGW
                     REVPRDSSILGEVALSREPTILQPMVVSTREAFDEREFQTALYVLRKQVSERIGIENW
                     FYACSLSNRTIVYKGQLTPAQVYNYYHDLTNAHFKSHMALVHSRFSTNTFPSWDRAQP
                     LRWIAHNGEINTLRGNKNWMHAREGVLVSETFKDQLDQLYPIIEEGGSDSAALDNVLE
                     LLTINGVLSLPEAIMMMVPEAYHKDMDSNLKAWFDWAACLMEPWDGPALLNFTDGRYC
                     GAMLDRNGLRPCRYYVTSDDRVICASEVGVIHIDNSIVIQKGKLKPGEMFLVDTGKAE
                     IVDTKKLKLEFARRKDFKSWLSKVIKLDDLLVKNKKYIPAEFVSEVSSFKVQTDPRLL
                     ANGYTFEQVSLLLTPMAMTGKEALGSMGNDAPLACLNEDPVLVYDYFKQLFAQVTNPP
                     IDPIREANVMSLECYVGPQGNLLEMHPSQCDRLLLKSPILHWNEFNALQHIEKVHPSW
                     SISNIDITFEKSEGLLGYTATIERITQEASDAIDQGKKILIVSDRKLGPQRLAISSLV
                     AVGAIHHHLIRNKQRSQVAIILETGEAKEVHHFCVLLGYGCDGIFPYLAMETLVRMNH
                     EGLIRNNEDDDIKIDDKTLLENYKHAVDGGILKVMSKMGISTLASYKGAQIFEALGVD
                     NSVIDVCFAGTASRIKGVTFEYLAQDAFSLHERGYPSRPIVKKSAGLPEAGDYHWRDG
                     GFKHVNDPTAIASLQDSVRNKNEAAWDMYVKKEMEAIRDCTLRGLLELDFENSTEIPV
                     EQVEPWTEIARRFATGAMSYGSISMEAHSTLAIAMNRLGAKSNCGEGGEDAERSLVHE
                     NGDTMRSAIKQVASARFGVTSYYLSDADEIQIKIAQGAKPGEGGELPAHKVSKDIAKT
                     RHSTPYVGLISPPPHHDIYSIEDLKQLIYDLKCSNPRAGISVKLVSEVGVGIVASGVA
                     KAKADHILVSGHDGGTGAARWTSIKNAGLPWELGLAETHQTLVLNDLRRNVVVQTDGQ
                     LRTGFDIAVAVLLGAESFTLATVPLIAMGCVMLRRCHLNSCAVGIATQDPYLRSKFEG
                     QPEHVINFFYYLIQDLRKIMAKLGFRSIDEMIGHSEKLKKRENVNTKSINIDLSPILT
                     PAHVIRPGVATRFLKKQDHKLHTRLDNKLIDEAEVTLDRGLPVTIDAEIINTDRALGS
                     TLSYRISKRFGENGLPQDTVVVNIRGSAGQSFGAFLTKGITFILDGDANDYVGKGLSG
                     GILVIRPPKDSKFKSDENVIVGNTCFYGATSGTAFISGNAGERFAVRNSGATIVVERI
                     KGNNAFEYMTGGRAVVLSQMESLNAFSGATGGIAYCLTSDYDDFVGKINRDTIELESL
                     SDPVEIAFVKNLILEHHNYTRSELAAKILNNFNHYLKNFVKVIPTDYKKVLLKEASDK
                     LKEKEKLNNEYLKRFQRTTNSSVDATNGEVDAMVSAKKQNGTVSFRSTVVEPKVVDLE
                     DSMPDAEQHEKKVEKLEKLEKNRGFMKYKVRYESKRSPATRSKDWKEFSNSLSKKDAK
                     YQTARCMECGTPFCQSDTGCPVSNVIPKFNDLVFKDQWKLAYYKLIETNNFPEFTGRV
                     CPAPCEGACTLGIIEDPVGIKSIERLIIDNAFKEGWVKPSPPETRTGRSVAIIGSGPA
                     GLACADQLNKAGHHVTVYERADRCGGLLMYGIPNMKLDKSVVERRVELLAAEGIEFVT
                     NTEIGKDISVETLKSQFDAVVYAIGSTIPRDLPIKGRELKNIDFAMTLLKNNTEAFLR
                     KDMEAIRQSIAGKKVIVIGGGDTGNDCLGTSVRHGAASVLNFELLPQPPKQRAKDNPW
                     PQWPRVMRVDYGHAEVKEHYGRDPREYCILSKEFIGNDQGEVTAIKTVRVEWKKSESG
                     VWQMVEIPGSEETFEADIVLLSMGFIGPELIDDPSVVKTKRGTIGTLNDASYRVDGDK
                     VYAAGDCRRGQSLIVWAIQEGRKCATSVDENLMGDSNLPGSGGIVRRDYRLLEELAAT
                     V"
     gene            complement(<992089..>992658)
                     /locus_tag="HG536_0B05370"
                     /db_xref="GeneID:59324791"
     mRNA            complement(<992089..>992658)
                     /locus_tag="HG536_0B05370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282452.1"
                     /db_xref="GeneID:59324791"
     CDS             complement(992089..992658)
                     /locus_tag="HG536_0B05370"
                     /inference="similar to AA sequence:RefSeq:NP_010108.1"
                     /note="ancestral locus Anc_7.362"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138347.1"
                     /db_xref="GeneID:59324791"
                     /translation="MVDGPKQSEGEQASMATYRISTGRGGAGNIQNSSSKASPKLIPQ
                     GSQTPNILQPVFSTGRGGAGNMRRNVDAKLTRRAQDVDGELEEDVIEPSREEDYIGPF
                     SGSEVERALSGGVISRGTGSHETGKSHVRNGRSRRNSLDDRPMAIAVGRGGAGNIISP
                     KPSGSGARKNKTGKQQKQGVWSSLKKLFS"
     gene            <993193..>993993
                     /locus_tag="HG536_0B05380"
                     /db_xref="GeneID:59324792"
     mRNA            <993193..>993993
                     /locus_tag="HG536_0B05380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282453.1"
                     /db_xref="GeneID:59324792"
     CDS             993193..993993
                     /locus_tag="HG536_0B05380"
                     /inference="similar to AA sequence:RefSeq:NP_013293.1"
                     /note="ancestral locus Anc_7.363"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138348.1"
                     /db_xref="GeneID:59324792"
                     /translation="MSWDEDVIGGSAAAGGDDKVLMESWEDGLADEPVMESWDAEETV
                     APTVEKGNGKKANGKKVSETDKKLLAIDTLDEKTRKELIKKAELESDLNNAADLFAGL
                     GVAEEHPRAAALRKQQEEAAARAASAMTRDTPIEKHPLFQTAETKTDYQELRKALATA
                     VVSMHEKSSLNYASSLAIDLIRDVAKPMSIESIRQTIATLNILMKDKERQERQARLAR
                     VKGGTAQGGAGKKKAKGAKANLGGAFKKDQQFDMGEVEFDDFGDDDFM"
     gene            <994236..>995969
                     /locus_tag="HG536_0B05390"
                     /db_xref="GeneID:59324793"
     mRNA            <994236..>995969
                     /locus_tag="HG536_0B05390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282454.1"
                     /db_xref="GeneID:59324793"
     CDS             994236..995969
                     /locus_tag="HG536_0B05390"
                     /inference="similar to AA sequence:RefSeq:NP_010107.1"
                     /note="ancestral locus Anc_7.364"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138349.1"
                     /db_xref="GeneID:59324793"
                     /translation="MVLRRSLFNAYRTSSRMVSGGAGKKRFYSGSGGKWLGYSLAGAA
                     GYVVAGDSLDIKGKVSRGFGADVNVGPVEKNGKSKSTLPLSDLESPEYCMDRKELDRV
                     VEELKRVVGNDQDHFSESQSDLDSHSDTYFNTHHPAADQRPRIVLFPSSTEEVSRIMK
                     ICHDNNVPVIPFSGGTSLEGHFMPTRSASTVVLDVSKFMNRIVKLNQTDLDVEVQAGV
                     PWEDLNDFLGEHGLLFGCDPGPGAQIGGCVANSCSGTNAYRYGTMKENVVNLTVVLPD
                     GTVVKTRGRPRKSSAGYNLNGLFTGSEGTLGIVTEATVKCHVKPVMETVVVASFPTVG
                     DAAACSSNITQEGIQLNAMELLDDEMMKLINSSGATFRTDWKEQPTMFFKIGGRNDNI
                     IQQVIAELERIAKKHKASSFEFATDEEKKMELWEARKVALWSVIDAGRSKNEKANIWT
                     TDVAVPLSNFARVIEETKEEMSNSPLINAVVGHAGDGNFHSFIVYNNDEEKKICEEIV
                     DNMVRRAIEAEGTCTGEHGVGVGKRKFLLEELGDAPVDLMRKIKLAIDPKRILNPDKI
                     FKIDPNEPDLH"
     gene            <996240..>996719
                     /locus_tag="HG536_0B05400"
                     /db_xref="GeneID:59324794"
     mRNA            <996240..>996719
                     /locus_tag="HG536_0B05400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282455.1"
                     /db_xref="GeneID:59324794"
     CDS             996240..996719
                     /locus_tag="HG536_0B05400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138350.1"
                     /db_xref="GeneID:59324794"
                     /translation="MLWRSTQCAPRMVLYRPSMVIAQRSALHTTAITNKSATEVVKEN
                     LEKLNKKIGKAAAEGIEKTQEATHKASEFAHEAAKAADQKMGQVEELTKSSKEQLKGN
                     AQSTMGKAGEKASDMGEKVEDKARNFGEKAEELTEDAKKTASRNIEDAQDYVDRKTK"
     gene            complement(<996800..>997960)
                     /locus_tag="HG536_0B05410"
                     /db_xref="GeneID:59324795"
     mRNA            complement(<996800..>997960)
                     /locus_tag="HG536_0B05410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282456.1"
                     /db_xref="GeneID:59324795"
     CDS             complement(996800..997960)
                     /locus_tag="HG536_0B05410"
                     /inference="similar to AA sequence:RefSeq:NP_013292.1"
                     /note="ancestral locus Anc_7.365"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138351.1"
                     /db_xref="GeneID:59324795"
                     /translation="MSTSTKQRPKPWESSGPLDDQVSSTDGGSMTRATSGANQPVDSS
                     PDAPPRPAGLSPETLNDPMSSYRNSQYGSGAYGGAMYGNSMLGSGLYGGNSMFGGGYG
                     SMYGGGYGSMYGGSAYGSLYGNGYGGGYMGGMNGGPGGLGESTQATFQLIESLIGAVA
                     GFAQMLESTYMATHNSFFSMISVAEQFSYMKEMLGSFFGIFAMIKVLRRGLFYITRGR
                     IGSPPRVNNGNNGDGKENEMVKEFEKFNNGHNEQRKRKRISWKPLIFFLAAVFGFPYL
                     LNKFIARMQNMQNNRIGAHANRQIDPSKLEFARALYDFTPENPQIEVTLKKGDLMAII
                     TKQDPMGRDSDWWKVRTRSGEVGYVPFNYLEIIKRQNKIERIQERADGDQQE"
     gene            complement(<998458..>999942)
                     /locus_tag="HG536_0B05420"
                     /db_xref="GeneID:59324796"
     mRNA            complement(<998458..>999942)
                     /locus_tag="HG536_0B05420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282457.1"
                     /db_xref="GeneID:59324796"
     CDS             complement(998458..999942)
                     /locus_tag="HG536_0B05420"
                     /inference="similar to AA sequence:RefSeq:NP_013291.1"
                     /note="ancestral locus Anc_7.366"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138352.1"
                     /db_xref="GeneID:59324796"
                     /translation="MNSPPVRPEQLSPALSPIAFSLDDPNHHNNGFQHLLASPTKLKL
                     DKGVNARTNNNGGSNGQSLIYRTSLSKLSELSRSGRSRQRSNSDTLRSASPIRFQLFN
                     NAPKMLKPEYMSQQAPSLPLLSTLMKTPATGIPTGTKQESKNNQTEPAAWMSIRETLE
                     KLQRDQRQAERQKVESKDRRQEEPANVGRQPVSITEPQISSDRKVSESTSATSGVTLC
                     DKQRDPNETVKFGPSRQRTNEEIRLVSNSSLASSTVSIDFNELPKDIDLEALATDKNG
                     FAHSDDFKSNRCSFISSTSTDYDADWCNQQVVAHEETAKLDHRIKQLEVEIAELKLQN
                     EKLIHSITASRTVEDMFMLDALKEIRASKREAQKGMERKVKQLEKKVENYRNAIKTRG
                     DSPPEEIASKDKRATYPTGESIQMSTLKRRIARISSLELRKIDEQGDSTSSSSSDDEM
                     DVKLDKPESFGGNMLTNQSRHPNDLQSMSMRRKAGLQLNIHVKR"
     gene            <1001525..>1003231
                     /locus_tag="HG536_0B05430"
                     /db_xref="GeneID:59324797"
     mRNA            <1001525..>1003231
                     /locus_tag="HG536_0B05430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282458.1"
                     /db_xref="GeneID:59324797"
     CDS             1001525..1003231
                     /locus_tag="HG536_0B05430"
                     /inference="similar to AA sequence:RefSeq:NP_011009.1"
                     /note="ancestral locus Anc_7.367"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138353.1"
                     /db_xref="GeneID:59324797"
                     /translation="MQFTQVGALTRSQFRKPLLLQLRAKFHQQQTSPTLVKLHSDLKL
                     DELQPDNTPDYVRLILRSSVYDVIDETPITKAVGLSSRLNTNVQLKREDLLPVFSFKL
                     RGAYNMLAKLDDTQKNQGVIACSAGNHAQGVAFAAKHLNIPATIVMPVSTPSIKYQNV
                     SRLGSQVVLYGNDFDEAKLECARLAEERGLTNIPPFNHPYVIAGQGTVAMEILRQVRN
                     SSKIGAVFVPTGGAGLIAGIGAYLKRIAPHIKIIGVETYDAAALHDSLKKGSRVNLPS
                     VGTFADGTSVRLVGEESFRICQDVVDEVVLVGTDEICAAVKDVFEDTRGIVEPSGALA
                     VAGLKKYVTQLHPEIDHSKHTYIPILSGANMNFDRLRFVSERAVLGEGKEVFMLVTIP
                     DIPGSFKKLQKVIHPRAVTEFSYRYNEHRHESTSEVPKAYIYTSFSVVDREKEIKQVM
                     QQIHALGFEAVDISDNEMAKCHGRYLVGGASKVPNERVISFEFPERPGALTKFLSGLT
                     DSWNLTMFHYRNHGADIGKVLVGISVPPRENLTFQKFLEDLGYRYQDESDNMVYQKFL
                     KY"
     gene            <1003377..>1005086
                     /locus_tag="HG536_0B05440"
                     /db_xref="GeneID:59324798"
     mRNA            <1003377..>1005086
                     /locus_tag="HG536_0B05440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282459.1"
                     /db_xref="GeneID:59324798"
     CDS             1003377..1005086
                     /locus_tag="HG536_0B05440"
                     /inference="similar to AA sequence:RefSeq:NP_011010.1"
                     /note="ancestral locus Anc_7.368"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138354.1"
                     /db_xref="GeneID:59324798"
                     /translation="MLKRCVPCRFYHAFQPRKISRDIIETLPSHELLQHLGFLRQTQS
                     GLVNWLPIGLRSLNKIENIVRNRMNGAADAMEVQLSTMSPKNLWETTGRWSNTELFKL
                     RDARKAEFCLTPTCEEDITNLMKNYISTYKDMPLLVYQITKKYRDELRPRGGLLRGRE
                     FLMKDAYSFTGNKEDALKMFAQMNAVYEMIFTDLGIPFVSAWADSGDIGGDLSKEYHY
                     IHSSGEDTLLTCDHCGTSSNIEKCESFPQEGNTHMGEVNVKYALNKARDTLICFYYPK
                     DRSLNWNLAIEAAGHDVDGSMRDKREDEVLKIFRESNEDLIFSRILRIMDCRLNSRSN
                     FPDFPLRQYLKSNFGQIDDVSIVEAREGEICGLCSEGLLKANKTIEVGHTFHLGTKYS
                     QALEAQFTDRENKSSAIEMGCYGIGVSRLLGAIGEITRDKHGFRWPSRVAPYQASICV
                     APGNNEIKQRIKQEIQETMGSEVMDKFSEKVGLGARISYSHAIGIPLCIIAGPKNWPN
                     VEIEVRGKNWFNDDTPSWREAHKELRNALQWQVIEGDSKPEKHIVPIEHLSRVITLLF
                     EDL"
     gene            complement(<1005170..>1005436)
                     /locus_tag="HG536_0B05450"
                     /db_xref="GeneID:59324799"
     mRNA            complement(<1005170..>1005436)
                     /locus_tag="HG536_0B05450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282460.1"
                     /db_xref="GeneID:59324799"
     CDS             complement(1005170..1005436)
                     /locus_tag="HG536_0B05450"
                     /inference="similar to AA sequence:RefSeq:NP_011011.3"
                     /note="ancestral locus Anc_7.369"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138355.1"
                     /db_xref="GeneID:59324799"
                     /translation="MSVTPPGGQRTLQKRRQAQNAKDKQLKQTPASTRQAGHGGSSSS
                     ILKIYTDEANGLRVDPLVVLFLAVAFIFSVVALHVIAKVTGKLF"
     gene            <1005959..>1007833
                     /locus_tag="HG536_0B05460"
                     /db_xref="GeneID:59324800"
     mRNA            <1005959..>1007833
                     /locus_tag="HG536_0B05460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282461.1"
                     /db_xref="GeneID:59324800"
     CDS             1005959..1007833
                     /locus_tag="HG536_0B05460"
                     /inference="similar to AA sequence:RefSeq:NP_009502.1"
                     /note="ancestral locus Anc_7.370"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138356.1"
                     /db_xref="GeneID:59324800"
                     /translation="MGDIDNVLSGREVDALGRSGEGKTAQTGSNDNSEQQPSFGTDEA
                     SSNEEDVIPTAIVIKNIPFAIKKEQLLDVIAKLDLPLPYAFNYHFDNGVFRGLAFANF
                     TNTTETTQVLNSLNGREIGGRKIRVEYKKMLPQAERERIEREKREKRGQLEEQHKSLS
                     NLSLHSLGKVSTTANMTSSSNSQLFATFLNESGNASANNSKNGMMNHSNLLQNQDFPV
                     KAPYFTQQNVSQHQTGSVQQSQQSTRLAAAPNALSGERLFAPLPSSAGSPLPPQQLDF
                     NDPDTLEIYSQLLLFKDRERFYYELAYPLGLSATHKRIINVLCSFLGLVEVYDPSFIL
                     IRRKLLDQATLQSHLQQQGQGSMLSSLQPNSTGGSMNRSHSYTSLLQAHAAASVAATA
                     NPNAVASPNPNNHNPTSSQNCSAATSKLPGQPPIPPQPIAQPQSQGTQLVSSPSQLMQ
                     PTALHNAESQQSQQQSFMRQQASLTPSSRIPSGYLTNNSQLNSVNPLLRNSNISPPNN
                     NVQPNTAQHRVPPSFYSNATTSLQIPEQQSQQQQTNVQLLPQHTNGSLHSNFSIQSFH
                     EDLPSSVNGQEVVYTSLGHAGFGNGLEEGLSRSLSGLDLQANASGALNNNLNARKALW
                     "
     gene            <1008674..>1010656
                     /locus_tag="HG536_0B05470"
                     /db_xref="GeneID:59324801"
     mRNA            <1008674..>1010656
                     /locus_tag="HG536_0B05470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282462.1"
                     /db_xref="GeneID:59324801"
     CDS             1008674..1010656
                     /locus_tag="HG536_0B05470"
                     /inference="similar to AA sequence:RefSeq:NP_009501.1"
                     /note="ancestral locus Anc_7.371"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138357.1"
                     /db_xref="GeneID:59324801"
                     /translation="MEKVRDSQSRGSQVSQDGSLGLINGFANGRVNNKLLKNLEISDN
                     IHSEYARKALEDPNGTRSTRSHRDVRYVYKAPRFVPRRQEVENSKNQRPAEELGPPQD
                     IEAANRLNPHVQFMADQYETDETPLPFDFSKVKIRYDPVKLLNFRRLLSASIEPLDGS
                     KNLQYGHGEDFDVHEPEDLAYMIDNDCAVPYRYAIANKSDYSTLRTAPTIEDRELFQQ
                     LLVQSSTAAYYNSNVSLTVRDAVDNDDEDQPARSKVRRRADFVQQAKTQPKKTTRASG
                     IESIYIRGYEIETWYTTPYPEEYNRNKILYICEFCLKYMSSRYVFYRHQLKCRVFRPP
                     GNEVYRDGKLSVWEIDGRENVIYCQNLCLLAKLFLNSKTLYYDVEPFIFYVLTEREDH
                     LDQAPHFHLVGYFSKEKLNSTDYNLSCILTLPIYQRKGYGQFLMDFSYLLSRREFKWG
                     TPEKPLSDMGLLSYRSYWKVKCAQALMELKKLQPSDPNLCLQISLEDISNLTGMSPTD
                     VVLGLELLKVLQQKEGTPPSPRYIIKVDSWDRIEQISKSWETRGYQTLDSSKLVWKPM
                     IFGPSCGVNAVGTMLETASGATRIAASHPASEDFFNKSISMLTNFLQDDLADPRPMEV
                     GAWQTIAKRNLLCISKRANHESEELPKAHGIQHGAP"
     gene            complement(<1011037..>1012812)
                     /locus_tag="HG536_0B05480"
                     /db_xref="GeneID:59324802"
     mRNA            complement(<1011037..>1012812)
                     /locus_tag="HG536_0B05480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282463.1"
                     /db_xref="GeneID:59324802"
     CDS             complement(1011037..1012812)
                     /locus_tag="HG536_0B05480"
                     /inference="similar to AA sequence:RefSeq:NP_009499.1"
                     /note="ancestral locus Anc_7.372"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138358.1"
                     /db_xref="GeneID:59324802"
                     /translation="MTLAKSTAGSSVSSHLSILGTHPHPHLHPHHLKSSSSSASVSVT
                     AVETTSTMGNASSGEKSSSVSENKTKNPSSWDPQDDILLRHLKEVKKLGWKDISQYFA
                     NRTPNACQFRWRRLKSGNLKSNKTANVDVTDFPGSGNAAAEDEKKSRGGSPAMAIPVS
                     VPPKLQPGVASAPNSVAATPSLPCLRSTFSLTSSNAQNNYPSINSTNGAGSNFFKARS
                     NSHSFSLGHYSTANHSTGGLVSGAKIPAEEENVGFIPKIIVKSRRNSFAQPLAAATNS
                     TTSHLTAALNTTLNTTKTRKNSFAARSRRSSFNVSSNTPSRRGSMITAPTSLTGMFGM
                     STASSTPKGPRRDSTVKSRTRRSASSSSTSSAASFMDLPPGAVQHMPRAHTRIHPKLQ
                     QQKLHQLHPHQPFAQNIAMPESLSWSTEEDQLLNESGSRNLSMMELSILLPNRTDKEI
                     QWRLDTLSLTNSPAASNEASESPLHSPRKSITPEDTAIDEDTCDEAEHNHHDGYDEGV
                     DPLHQSIPLPSMSKENTPASIISSTTTNDDAPTSADNRLRIEGINENKNDFRSYHAQK
                     PRTQHPHTSTTTPLPGISSILNGTL"
     gene            <1013268..>1014497
                     /locus_tag="HG536_0B05490"
                     /db_xref="GeneID:59324803"
     mRNA            <1013268..>1014497
                     /locus_tag="HG536_0B05490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282464.1"
                     /db_xref="GeneID:59324803"
     CDS             1013268..1014497
                     /locus_tag="HG536_0B05490"
                     /inference="similar to AA sequence:RefSeq:NP_009498.1"
                     /note="ancestral locus Anc_7.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138359.1"
                     /db_xref="GeneID:59324803"
                     /translation="MVRWCARAGVICQRAAGVAGEVICEKRYGVRRMCSYYDIGLNLT
                     DPMYRGVYNGKQYHESDVKEVLARASERGVKCALLTGSSLVESRDAVELAHSDELSGS
                     GTQLKYTVGVHPCCVNEFANQDATIDNPSHDEALNQALGRKVWENPQQSHLKLRELYD
                     LIEERLASKDARFGAVGEIGLDYDRFYYSGKEMQRIFFEEQLKLSCLISNPKMPLFLH
                     MRNCCDDFVAIMKKFIDGFQDEEDRFGLASIAGVERPVFYKFDPERMFVTHSFTGSVG
                     DLEKILALSPHSYIGMNGCSLKSEENIDCAEAVPIERLLLETDAPWCDIRRTHSSFRF
                     LTGYEPPYRSVKRDKLSKVSQDDRLKTMVKGRNEPCTMEQVAIVVANVKNIPLKHLVE
                     TVWDNSCRVYGGVSTSG"
     gene            complement(<1014619..>1016046)
                     /locus_tag="HG536_0B05500"
                     /db_xref="GeneID:59324804"
     mRNA            complement(<1014619..>1016046)
                     /locus_tag="HG536_0B05500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282465.1"
                     /db_xref="GeneID:59324804"
     CDS             complement(1014619..1016046)
                     /locus_tag="HG536_0B05500"
                     /inference="similar to AA sequence:RefSeq:NP_009497.2"
                     /note="ancestral locus Anc_7.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138360.1"
                     /db_xref="GeneID:59324804"
                     /translation="MGQILSNPVIDKEHHSGEDRLTAFGLCAMQGWRMSMEDAHVVQP
                     NVLNASDKDHIALYSIFDGHGGASVAQYCGEKIPSILQRQKSFKSGNLSQALIDTYLQ
                     TDEDLLKDPVLRNDYSGCTATSILVSKLQKKLVCGNSGDSRTVISVKGRAKALSYDHK
                     PTLASERSRIIAAKGFVEMGRVNGNLALSRAIGDFEFKSNSELAPHEQIVTAVPDIIE
                     HELNYDDDEFVVLACDGIWDCLSSQDCVDLVHYGISKGDMTLNDISSRIIDVCCSPTT
                     EGTGIGCDNMSISVVALLKDGETVGQWFERIRAKNYNIEVSFEKRRRQVFTYYHFPKD
                     DASIFEVTTKHPQDRFSQENSAQNLRSAGGSGNNNDHDNMEIDDTDTDSDAVTSNINR
                     RGPQQAGSSANGPVDLFSLEALLGAGGIQISQGPNNVSYIHGSALTDMLASLSNAAAG
                     EMVPEEDEDKDPQDSAKNDKKIEEI"
     gene            <1016450..>1017967
                     /locus_tag="HG536_0B05510"
                     /db_xref="GeneID:59324805"
     mRNA            <1016450..>1017967
                     /locus_tag="HG536_0B05510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282466.1"
                     /db_xref="GeneID:59324805"
     CDS             1016450..1017967
                     /locus_tag="HG536_0B05510"
                     /inference="similar to AA sequence:RefSeq:NP_011014.1"
                     /note="ancestral locus Anc_7.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138361.1"
                     /db_xref="GeneID:59324805"
                     /translation="MVSFKVQPDVESLRQLQSQNDASVNMYPVYAFLTGVDLTPHVAY
                     LRLAQLNNPERSPSFLLESAKSTTELDRYSFIGVSPRKVIKTGPTEGVEVDPLVVLEE
                     EMSNYKVAENVPGLPKLNGGAIGYISYDCVRYFEPKTARPLKDVLKVPEAYLMLCDTI
                     VAFDHVFQRFQIIHNINTKETSLEEGYQAAADVIRDIVKRLTDLESPIPYPHQPPIKL
                     EQDFKSNIGQEGYENHVRTLKAHIKEGDIIQAVPSQRVARPTSLHPFNIYRRLRTVNP
                     SPYLFYIDCLEFQIIGASPELLCKSDNKNKVVTHPIAGTIGRGSTADEDDVLAEQLKG
                     SIKDRAEHIMLVDLARNDVNRVCDPKTTSVDKLLTVEKFSHVQHLVSQVSGTLRKDKT
                     RFDALRSIFPAGTVSGAPKVKAMELIAELEGERRGVYAGAVGHWSYDGKTMDTCIALR
                     TMVYKDGVAYLQAGGGIVYDSDEYDEYIETMNKMMANNTTIVQAEEIWAGRVGSA"
     gene            <1018211..>1018846
                     /locus_tag="HG536_0B05520"
                     /db_xref="GeneID:59324806"
     mRNA            <1018211..>1018846
                     /locus_tag="HG536_0B05520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282467.1"
                     /db_xref="GeneID:59324806"
     CDS             1018211..1018846
                     /locus_tag="HG536_0B05520"
                     /inference="similar to AA sequence:RefSeq:NP_009496.2"
                     /note="ancestral locus Anc_7.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138362.1"
                     /db_xref="GeneID:59324806"
                     /translation="MNQSNSNFPVFFVIAAASLVTGYYLGQILPSASRTGQVQQILRQ
                     CKQKAESDSNGSENENNDYDDDEGYEEEEDDEFEINSLSLNDVPGEVRMALVIRQDLG
                     MQKGKIAAQCCHAALSCFRMIACDPNRESYNPQMVQRWLRRGQAKITLKCPDKETMDE
                     LYAKAISLGVNACVIHDAGRTQIAAGSATVLGVGPAPKAVLDQITGELKLY"
     gene            complement(<1018922..>1020085)
                     /locus_tag="HG536_0B05530"
                     /db_xref="GeneID:59324807"
     mRNA            complement(<1018922..>1020085)
                     /locus_tag="HG536_0B05530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282468.1"
                     /db_xref="GeneID:59324807"
     CDS             complement(1018922..1020085)
                     /locus_tag="HG536_0B05530"
                     /inference="similar to AA sequence:RefSeq:NP_009495.1"
                     /note="ancestral locus Anc_7.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138363.1"
                     /db_xref="GeneID:59324807"
                     /translation="MSGVSDDRIQQFMALANCSFGVAQRYLEEFGDLGEALNAYYAAQ
                     SGSPAENPASQSPVPERTPVSGTSSTVSGQSGNAASAGSGSRPKFMSFSDMVRGQAAE
                     DDEDDQNRNTFAGGETSGLEVTDPNDSNSLIRDLFEKARRGAQQQAEGSSEEGPVHHF
                     TGRGYKLGSSVDSPNQVVEDLKEEELPSRPQKVTREITFWKEGFQVGDGPLYRYDDPA
                     NSFYLNELNQGRAPLKLLDVQFGQEVDVNVYKKMEESFRPPKRKLGGFQGQGQRLGSP
                     IPGESETSSVEPASPRDGIEQKSAVDDAERQPTPRGDSSVQIRYASGKREVFRCNATD
                     TVQHLYDHVKENTQDKARKFTLNYAFPVKPLENFDATLKEADLINTVVLQRWL"
     gene            complement(<1020727..>1023033)
                     /locus_tag="HG536_0B05540"
                     /db_xref="GeneID:59324808"
     mRNA            complement(<1020727..>1023033)
                     /locus_tag="HG536_0B05540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282469.1"
                     /db_xref="GeneID:59324808"
     CDS             complement(1020727..1023033)
                     /locus_tag="HG536_0B05540"
                     /inference="similar to AA sequence:RefSeq:NP_011015.3"
                     /note="ancestral locus Anc_7.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138364.1"
                     /db_xref="GeneID:59324808"
                     /translation="MVQSAILGFPRIGPNRELKKITESYWKGKASVEELFNVGREIRS
                     ANWKLQKDSGVDIIPSNDFSFYDQVLDLSLLFNVIPERYAKYNLAPIDTLFAMGRGLQ
                     RKATETEKAVDVTALEMVKWFDSNYHYVRPTFSHSTEFKLNGQKPVDEFLEAKELGIQ
                     TRPVLLGPVSYLFLGKADKDSLDLEPLSLLEKLLPVYVEILSKLKAAGATEVQLDEPI
                     LVLDLPQQAQEAIRKAYQFFGSKAASLPQITLATYFGTVVPNLDSLKNLPVAALHFDF
                     VRAPAQFDDVLSIVGENQKLSVGVVDGRNIWKNDFAKSSALVNKAIEKLGADRVVVSS
                     SSSLLHTPVDLENETKLNPEIKDWFSFATQKVKEVVIIAKNVSGEDVSAELKANAQSV
                     SSRASSKITNDEAVQKRVASIDEKMAKRAVPFEERLAEQSKRFNLPLFPTTTIGSFPQ
                     TKDIRINRNKFAKGTITAEEYEKFINSEIEAVIRFQEEIGLDVLVHGEPERNDMVQYF
                     GEQINGYTFTTNGWVQSYGSRYVRPPIIVGDLSRPKPMSVKESVYAQSITTKPVKGML
                     TGPVTCLRWSFPRDDVDQKTQALQLALALRDEVNDLESAGIRIIQVDEPAIREGLPLR
                     AGAERSAYLKWAAEAFRVATSGVANDTQIHSHFCYSDLDPNHIKALDADVVSIEFSKK
                     DDPNYIAEFKNYPNHIGLGLFDIHSPRVPSKDEFISKIQTILKSYPAEKFWVNPDCGL
                     KTRDWEETKLSLTHMVEAAKYFREQYKK"
     gene            <1023784..>1024149
                     /locus_tag="HG536_0B05550"
                     /db_xref="GeneID:59324809"
     mRNA            <1023784..>1024149
                     /locus_tag="HG536_0B05550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282470.1"
                     /db_xref="GeneID:59324809"
     CDS             1023784..1024149
                     /locus_tag="HG536_0B05550"
                     /inference="similar to AA sequence:RefSeq:NP_011017.3"
                     /note="ancestral locus Anc_7.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138365.1"
                     /db_xref="GeneID:59324809"
                     /translation="MVSSRGSISVEAEYRKLLSRNDELTKQEATLKKEYTTLLRKISS
                     LARVLSKMEPDMGCSSDEPRLISEAALVRAPRLRWYNEQISLVESLSRENQEIPIPDE
                     LMESYRLSKDTPLLHRDSN"
     gene            complement(<1024146..>1028279)
                     /locus_tag="HG536_0B05560"
                     /db_xref="GeneID:59324810"
     mRNA            complement(<1024146..>1028279)
                     /locus_tag="HG536_0B05560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282471.1"
                     /db_xref="GeneID:59324810"
     CDS             complement(1024146..1028279)
                     /locus_tag="HG536_0B05560"
                     /inference="similar to AA sequence:RefSeq:NP_011018.1"
                     /note="ancestral locus Anc_7.380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138366.1"
                     /db_xref="GeneID:59324810"
                     /translation="MSSMKGSPNDDRLRSRLDTATNDSMMVGNYNSGNKRNRQNLVLS
                     TSFVSTQKLANAPTSPASPLQARRPRTSVSKALLALRNEINELQQQLVQARKGKENAE
                     RIRDSATSEIYKGAYSTDHLHKHSMRIRANSQIRDMDKVIRKLERQIADLKHQHEQSK
                     RLKDLGKLPDRLQVKMMNHGSLENVGRQQSSSSLSTFGNGDAADSKRDHVADEEDEED
                     EEDEEDEEEEEVQLRHAHKNDEARSLGSSSARISSAASTTFNTSHIETATWLVSDYMQ
                     SLQDTSLSPGLVLKKANGLVSLLKEQPEIRKNLVLHSFMPSMQALLLSGDKIIAAAAY
                     RVCRYLITDAAFVEWLFQLHFDAFIVVSLAKENVYHVEREQALKFVRAFIDINARIPK
                     EILQAVISCIEKQDDKLRHAALETLLELCFIAPDAVNDCQGMRVLEAALRDYSHFSVA
                     SIILDTVLQLMSSNSTRQYVLKDFDISVLITVFSDTNTKASFQVERMRNASLLLAKAL
                     KDYNGLMLFSIDNFKPLKALLSFFQIPFCAQYLIDVFLDVLRIKKIFYKDPKGSFDLV
                     PSQFVEESMLVNQHTALLVLILHRSGFVEQVMKLIDKNKENDVRAMLVSKVRYLLSEF
                     LNLAMNLLGMNVSFANEVAPPCNAALYEEAFEFCKMSSNVNKSRNTLGMATIDYRKNV
                     KNFSQNIKGSKMGRKFDDLKFRKMVYDSKVLQTKDFSKWNWNLILELVEGPLRNVKQL
                     DELARSTKFIRRLLVFYRPLRMRFSAINKGTRQSQRYVEVGCQFFRMLTATGVGTKIL
                     MDDTKIISQLASLLYRAMEGHTTGNIINNSTLDTKLISGYFKFIGVLTQSSNGIMVLK
                     RWNFFTVFYKMFDCDSPLSLRFLQLTLPELGLKYSGHCKTIIGKALVISNEEIRVRAT
                     ENLADKLKEVYDSNQDSGNFGIIHDRKSLQKYVIDMLTRQLYDLSPKVVAAADQALYD
                     CIMAEECSQETISSLKTSLKQMVFIRSPLLFELLGTPYGFKLLNSIDFVEAERKSWLE
                     SKNREFVSYIEGFLTIDDYDPSTYASHKDHQTKRLPQHFYGSLAKTEDGIALISKGGD
                     LLTFISTIKKYTSDSDAQKPENQDQAMDVKSALWCAGYIGSTTLGIGLLDNFEVVKEI
                     IKISYQASETTVRFTAFFALGLMSRTQEGCEILDEMGWCCCLNVQGNAMGITYPKRLD
                     KFLSFKEMPWSMQDNYKEEMIEFDAVHGELVGEVEPINFNLDLLLTEKDMIDNPLNDD
                     TTEEPTGNAERLLLQEQAYRTKQLHTAEEDKILSEILEAVSQLGNHILSNNAIKEITN
                     MNHRYGPKLFESEVVFFKIMEMMAQFRFKPHVRKFLCGLFINEKALENVIRHDRKRA"
     gene            complement(<1028476..>1029004)
                     /locus_tag="HG536_0B05570"
                     /db_xref="GeneID:59324811"
     mRNA            complement(join(<1028476..1028780,1028839..>1029004))
                     /locus_tag="HG536_0B05570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282472.1"
                     /db_xref="GeneID:59324811"
     CDS             complement(join(1028476..1028780,1028839..1029004))
                     /locus_tag="HG536_0B05570"
                     /inference="similar to AA sequence:RefSeq:NP_009494.1"
                     /note="ancestral locus Anc_7.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138367.1"
                     /db_xref="GeneID:59324811"
                     /translation="MSDSGTTEGFTIRQISTLSNEYKQRRKQQMLRFFGATALTLLSC
                     RLAYRGIKSRKYVPHMFQLNYKSPPFSYQAEAASALVLGTGLAVGGFSMLLFGSCWIW
                     DISTIPEFSLKAKRLMGQDLTSEEALINMPLDDDTAKVVDQIESLLKENSSNKS"
     gene            <1029164..>1029544
                     /locus_tag="HG536_0B05580"
                     /db_xref="GeneID:59324812"
     mRNA            join(<1029164..1029197,1029261..>1029544)
                     /locus_tag="HG536_0B05580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282473.1"
                     /db_xref="GeneID:59324812"
     CDS             join(1029164..1029197,1029261..1029544)
                     /locus_tag="HG536_0B05580"
                     /inference="similar to AA sequence:RefSeq:NP_031358.1"
                     /note="ancestral locus Anc_7.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138368.1"
                     /db_xref="GeneID:59324812"
                     /translation="MHPQLEARRFNSCYELIQALDKCHQQEYYKRIFGLCNNEKEALS
                     QCLHEARLAGEREAIKQRRQERKTMEEKWKKIDEEEYGEDAILKKIIERYQAKKNGSN
                     GSE"
     gene            complement(<1029631..>1030248)
                     /locus_tag="HG536_0B05590"
                     /db_xref="GeneID:59324813"
     mRNA            complement(<1029631..>1030248)
                     /locus_tag="HG536_0B05590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282474.1"
                     /db_xref="GeneID:59324813"
     CDS             complement(1029631..1030248)
                     /locus_tag="HG536_0B05590"
                     /inference="similar to AA sequence:RefSeq:NP_011020.3"
                     /note="ancestral locus Anc_7.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138369.1"
                     /db_xref="GeneID:59324813"
                     /translation="MSDPSSINGGIVVAMAGKDCVAIASDLRLGSQSLGVSNKFEKIF
                     HYGHVFLGITGLATDVTTLSETFRYKTNLYKLRENRPIEPETFTQLVSSTLYERRFGP
                     YFVGPVVAGINSKTEKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEA
                     EDLFETISQALLNAADRDALSGWGAVVYIIKKDKVVKRYLKTRQD"
     gene            complement(<1030459..>1032339)
                     /locus_tag="HG536_0B05600"
                     /db_xref="GeneID:59324814"
     mRNA            complement(<1030459..>1032339)
                     /locus_tag="HG536_0B05600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282475.1"
                     /db_xref="GeneID:59324814"
     CDS             complement(1030459..1032339)
                     /locus_tag="HG536_0B05600"
                     /inference="similar to AA sequence:RefSeq:NP_009493.1"
                     /note="ancestral locus Anc_7.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138370.1"
                     /db_xref="GeneID:59324814"
                     /translation="MASDSVPPVPMGQQLIESPKITDIHSLVADEQDCERIAKKMLKG
                     TFEEVSYEEYANLLGNKEMSGTLRAFVGMLGPLPESLLSTLQLLVSKLHFVAEAQNID
                     RILEELSQRWVECHPDTFWEDHYKLCHIVLFSLLILNSDLHNSDGVSGHAKFSLQEFV
                     ENTIYALKKEAKATGYTLEEVEPMIAEQLGSFYDKLKAKSLPLASRPAGIYREASRPQ
                     SILNTKSSSFSRQRFSVRSVTSASLETTLSNGASVHSGSSSQRGRKESNYTSNWKFHH
                     NKQLPQLYNPEDFDAEWNSRNNSLWFMDSVIKLCENGLVSTKDEDESAESLLAEEQRR
                     RAPKRFFKWLTKSKPRSIFEDVKSPIAFLDGNAKWIRTRVRVSEGRIFVFKLKSSNLA
                     KVDANQDLDALKENCSQYFVRNLFEAVATLVQDNVIQGNQPDSAHLAKEHLRGNFTVV
                     VPSGPNGQSTTLEFQTATVEEAANFVHSINFWAARITSVPSAQFEVVSNQEYGWSEKV
                     MSSEMDQEYLDKVNLSVWRPLLSIEALYDELQTLGEQPNFRDRLEELTEFTQQIEGRI
                     DLHNSRKPVIVATWTKSAQFEAAMDNWNNKYLYLHEISGRNSKYLKAMQMADRVLKEI
                     NQ"
     gene            <1033402..>1034616
                     /locus_tag="HG536_0B05610"
                     /db_xref="GeneID:59324815"
     mRNA            <1033402..>1034616
                     /locus_tag="HG536_0B05610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282476.1"
                     /db_xref="GeneID:59324815"
     CDS             1033402..1034616
                     /locus_tag="HG536_0B05610"
                     /inference="similar to AA sequence:RefSeq:NP_011021.3"
                     /note="ancestral locus Anc_7.385"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138371.1"
                     /db_xref="GeneID:59324815"
                     /translation="MSQVQDQVFQDTQLENPQLSLMSTAPADPSSLSESQVQFAGAQR
                     AGSEEYVESSEAVEQPGSVGGGAGGETEGVEEDDVALVSFVPLEKLQINGITSGDLRK
                     LRESGLHTVEAVAYAPRKQLMEIKGISEAKADKLLNEAARLVPMGFVTAADFHMRRSE
                     MICLTTGSKNLDTLLGGGIETGSITELFGEFRTGKSQLCHTLAVTCQIPLDIGGGEGK
                     CLYIDTEGTFRPVRLVSIAQRFGLDPDDALNNVAYARAYNADHQIRLLDAAAQMMSES
                     RFSLIVVDSVMALYRTDFSGRGELSARQMHLAKFMRALQRLADQFGVAVVVTNQVVAQ
                     VDGAMSFNPDPKKPIGGNIMAHSSTTRLGFKKGRGCQRLCKVVDSPCLPEADCVFAIY
                     EDGVGDPREEDE"
     gene            <1034895..>1036865
                     /locus_tag="HG536_0B05620"
                     /db_xref="GeneID:59324816"
     mRNA            <1034895..>1036865
                     /locus_tag="HG536_0B05620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282477.1"
                     /db_xref="GeneID:59324816"
     CDS             1034895..1036865
                     /locus_tag="HG536_0B05620"
                     /inference="similar to AA sequence:RefSeq:NP_009492.1"
                     /note="ancestral locus Anc_7.386"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138372.1"
                     /db_xref="GeneID:59324816"
                     /translation="MSAAADGRSQNVETVAMHPYKKHFLDSQNHKLVEPGSSRPDANV
                     SDRPTLASSPVGSDEQSSTYGSVVSLNNSSQPSDVRSQWIQQMGPPSNAHLRQLRVSP
                     ESTNSSSEDIQRASLSPSNVSSQTNGTQVNKRKSRSVDLSHMYLMNGSHDTQLTSTNE
                     SVADMSHQLISRYLGQNGNTSLVPRLKTIEMYRENVKKSKDANLLFQFAQYILQTALT
                     MEFNDTPATTASKTDAIDPAELKRSFLKEAQHYLRKLSVKGYADAQYLLGDVYASGAL
                     GKTENKEAFTLFQAAAKHGHIESAYRTAYCFEEGLGTTRDSRKALEFLKFAASRNHPS
                     AMYKLGLYSFYGRMGLPTDVNTKQNGIKWLSRASARANELTCAAPYELAKIYEEGFLD
                     IIIPDEKYATELYIQAASLGHVPSSTLLGQIYESGNKAVPQDTSLSIHYYTQAALKGD
                     PVAMLGLCAWYLLGAEPAFEKDENEAFQWALRAASAGYPKAQFTVGYFYEKGKGCEAN
                     IESAYKWYGKAAKNNDSRAIAKLKQREPPKDKLEVSSKKRQKKSMSVSTLNIFKSLES
                     GSSKEYFNSEDYSQLKPTNGLFTDAPVESGIFTQAPNCSNTKISQTPGAEASKAPKDS
                     KEQPHTQKSNVKSSSGKGKKKSEKNGKSCILM"
     gene            <1037537..>1038295
                     /locus_tag="HG536_0B05630"
                     /db_xref="GeneID:59324817"
     mRNA            <1037537..>1038295
                     /locus_tag="HG536_0B05630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282478.1"
                     /db_xref="GeneID:59324817"
     CDS             1037537..1038295
                     /locus_tag="HG536_0B05630"
                     /inference="similar to AA sequence:RefSeq:NP_009489.1"
                     /note="ancestral locus Anc_7.388"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138373.1"
                     /db_xref="GeneID:59324817"
                     /translation="MFSRVLFQSRRSLIQGQQQQPFKVAVRTLRTFKQEDQPRLRINS
                     VAPNFDADTTHGKINFHDYLGNSWGVLFSHPADFTPVCTTELGAFAKLKPEFDKRNVK
                     LIGLSAEDVESHRKWIKDIEEVNKLDKFTFPIIADVDKEIAFLYDMVDEEGFKQLGKA
                     PPVATIRSVFIIDPSKKIRISFTYPPSVGRNTSEVLRVIDALQKTDAKGVVTPINWQE
                     GEDVIIPPTVSDAEASKKFGQFKKIKPYLRYTEA"
     gene            <1038649..>1042143
                     /locus_tag="HG536_0B05640"
                     /db_xref="GeneID:59324818"
     mRNA            <1038649..>1042143
                     /locus_tag="HG536_0B05640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282479.1"
                     /db_xref="GeneID:59324818"
     CDS             1038649..1042143
                     /locus_tag="HG536_0B05640"
                     /inference="similar to AA sequence:RefSeq:NP_009487.2"
                     /note="ancestral locus Anc_7.389"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138374.1"
                     /db_xref="GeneID:59324818"
                     /translation="MSTPTGLKEEGRPIAKNPEPIPSSTETELRHIKRPSTPELDSEL
                     VRLNKQQKCKLEEIPSTPSGQAELRSTNGSGAHQGSTGHRPVTSCTHCRQHKIKCNAS
                     ENYPSPCSRCERMGLHCEIDPQFRPKKGSQLQNLRRDVDELKLKIEYLTRKESLITRA
                     LQESDMGRKLIKTLEAIDVSKLSQLSNKKPEKLRQRPLRNNVLQHQQVDRKVSVQTYL
                     ASEPQLLQDDPKSSAEASLKDSHSITSDKTAKQPFLLNDSAPANNNRDSLPPVLQMAL
                     QRNTSAIGTPSEYSVSHNVSPSLSPLNSSHSISKKSEASKYRDEIEGNIAHNDNDPLP
                     QKKLPVVATTNAMPLLPSPYASIDEFVIGDVRISIEKANELHHIFVTRYLPYFPILSS
                     NSATELYSQSQFLFWTAILTACLSDVDPSLYMKLSSLIKQLAIETCWIRTPRSTHISQ
                     ALLILCIWPLPNQKVLDDCSYRFVGLAKSLSYQLGLHRGKFIAEFTRTQTSMPDAEKW
                     RTRTWLGIFFAELCWASILGLPPTSQTDYLIENARFGQDEEEDDNPVSNNPSKDIADK
                     EQAQAENGKEGSASSGSRETDYHDDKKGLEDNSRQKSERLPRSFRRLICLANFQAKLC
                     KVMGSSVVSPDGLMEPRDRASSLAILERELELLDRKLNFEEDICVHIYYLYVKLMVCC
                     FAFLPDTPTEDQSQYVTEAYLSATKIVTLLTNLLDKQQLIELPIYIRHSATFAALILF
                     KLQLTPLLLNKYLDSARQSIVTVHRLFRNQLSAWATAVENDISRTASVLEKLNFVLIT
                     HPTVFVEEEGIISRMRSHLTDSLFYDLVWCIHEARRREMDPKYNEEAMLRAAEKQKKK
                     GNGGRWTLDRKLHPLPFYNQISKEDFETIIQTTPNGTTITKLVPTKTALRHAKKLAKT
                     KKDSNGAIVEINGIPLSMLDETGSVSLENFSSNPNSDSLAFKADKLSQASKISQAREA
                     NIAALGSKGAARQFASSYANDRLAESDNEDNHPSKIDTPTISSFLNDTTMQRSNSTPP
                     VQPTARLSRVGTNSLFVMNNSLASNLSLNRSFSLSQKMQTPDAAAAALTNSVTEAKPP
                     LRGQDSFPNLNLFLHSGSPNFDPAGVSSSANTNKSAIGQLSDLENFFQQQSTGWIEGN
                     SINDDFLGWFDMNMEPEF"
     gene            <1042566..>1044806
                     /locus_tag="HG536_0B05650"
                     /db_xref="GeneID:59324819"
     mRNA            <1042566..>1044806
                     /locus_tag="HG536_0B05650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282480.1"
                     /db_xref="GeneID:59324819"
     CDS             1042566..1044806
                     /locus_tag="HG536_0B05650"
                     /inference="similar to AA sequence:RefSeq:NP_009486.3"
                     /note="ancestral locus Anc_7.390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138375.1"
                     /db_xref="GeneID:59324819"
                     /translation="MLKRWLSRSSKRKSSAKDDSDTSSNSVVEVNYHHEAVQSTDSFL
                     KPVRGKSMSKSKIPSAVGYNQTQSSQSSDKRSVSEQYTGNDTAISLLSTSLDTAFDAS
                     SPGLLFTNVTESMPFGDGSNKVFGYENFGNTCYCNSVLQCLYNLTEFRLQLLQYPERD
                     PTAKRKRKSEMPGNKPRYFTESSFQHVNFGHESGGNGHHHHHHDARSVDANHGTLNGN
                     NRINGKDNEHNGGPDGEDSNERPDSKNSNDGHKPNFLQRRNSSFLFRKLDNTTKENSE
                     TQSKEATGPVHATLMASDAMSEKLHEESRNVIVGRPLTVTSSYPEGNQTATGTGTAIK
                     HPGSEHVANNIEATQDTATQQKTHKVFSSEQRKKAALIRGPVLNIDHQLDESNVSNLY
                     YGLKDIFESITENLSLTGVVSPICFVDTLKRTNVLFNTTMHQDAHEFLNFLLNELSEF
                     IQQDIDKTTDPARTYTNFINSLFQGTLTYRIKCLTCDNTTSRDEPFLDFPIEVHEEEE
                     TDIQALLQSYQQREMLSGSNKFYCNECCGLQEAERMVGLKQLPHILALHLKRFKYSEE
                     HNSNIKLFNKIHYPLILNVCSSFCSSVRKKYELAGIVVHMGGGPQHGHYVSLCKNDKF
                     GWLLFDDETVEVVSESTVLKFIGDKESLTTAYVLFYKELIDEEKYAKEDDKNEFEENI
                     EQLISCDDLIRLTSQKANAQKMASAAVEEAQEHDKDEIHSERKGSSSSSKKSRPKSKL
                     FNFMRS"
     gene            complement(<1044896..>1045873)
                     /locus_tag="HG536_0B05660"
                     /db_xref="GeneID:59324820"
     mRNA            complement(<1044896..>1045873)
                     /locus_tag="HG536_0B05660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282481.1"
                     /db_xref="GeneID:59324820"
     CDS             complement(1044896..1045873)
                     /locus_tag="HG536_0B05660"
                     /inference="similar to AA sequence:RefSeq:NP_009485.3"
                     /note="ancestral locus Anc_7.391"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138376.1"
                     /db_xref="GeneID:59324820"
                     /translation="MDTERKEMSSNSIKLLAGNSHPELAEIIAKRLGIPLSKVGVYQY
                     SNRETSVTIGESIRDEDVYIIQTGTGEQEINDFLMELLIMIHACKTASVRKVTAVIPN
                     FPYARQDKKDKSRAPITAKLVANLLQTAGCDHVITMDLHASQIQGFFHIPVDNLYAEP
                     SVLNYIRTKTDLANAILVSPDAGGAKRVASLADKLDLNFALIHKERQKANEVSRMVLV
                     GDVTGKSCLLIDDMADTCGTLVKATNTLLDHGAKEVIAIVSHGIFSGAARERLKNSRL
                     SRIVCTNTVPVDLDLDILDQIDISPTLAEAIRRLHNGESVSYLFTHAPM"
     gene            <1046277..>1047032
                     /locus_tag="HG536_0B05670"
                     /db_xref="GeneID:59324821"
     mRNA            <1046277..>1047032
                     /locus_tag="HG536_0B05670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282482.1"
                     /db_xref="GeneID:59324821"
     CDS             1046277..1047032
                     /locus_tag="HG536_0B05670"
                     /inference="similar to AA sequence:RefSeq:NP_011026.3"
                     /note="ancestral locus Anc_7.392"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138377.1"
                     /db_xref="GeneID:59324821"
                     /translation="MATQQAQKRLTKEYKLMVENPPPYILARPNENNILEWHYVITGP
                     ADTPYFEGQYHGTLTFPSDYPYKPPAIRMVTPNGRFRENTRLCLSMSDYHPNTWNPSW
                     SVSTILNGLLSFMTGEEATTGSITTTDQQKRVLAERSMEYNTYQNLRFKMVFPDVVQE
                     NIKELEKRRASGRTREVEATKDKGDAIMQAAKEKAIALEEILDPEDRIRAEQALKTID
                     GKPRKDTKESYRSSSMLYIGLALLLFCLGLSMK"
     gene            complement(<1047090..>1048331)
                     /locus_tag="HG536_0B05680"
                     /db_xref="GeneID:59324822"
     mRNA            complement(<1047090..>1048331)
                     /locus_tag="HG536_0B05680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282483.1"
                     /db_xref="GeneID:59324822"
     CDS             complement(1047090..1048331)
                     /locus_tag="HG536_0B05680"
                     /inference="similar to AA sequence:RefSeq:NP_009484.2"
                     /note="ancestral locus Anc_7.393"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138378.1"
                     /db_xref="GeneID:59324822"
                     /translation="MSSDHSTPAPKELPVEPTTLKRVARPIRHVKYVPLKSLIFFSKD
                     GPMEFSYERKIKTPISKDKLVVEVHHVGLNPIDMKIRNGYKSGVYGEIGLGREYSGVV
                     SMVGEKLQSQWQVGDKVFGIYFHPHSGNGCLQSSILVDPSEDPILLKPENISSEEASG
                     SLYCLGAAFNILDKLQRAGKLKPDANVLINGGTSSVGLFAVQLLKNYFHLVKKIVIIT
                     TSTGPEVYAKQFPELVDDMIFINYLNCRGKTSKPLRKMISEQKVIEYDEQTGSDVPVE
                     YNQGKFDVVLDFIGGYDILAHSSSLIHSGGAYVTTVGDYVENYKTDVYDSWDNPSANA
                     RKMFGSMLWSYSYTHFHFDTNAKSASKNDWVNRCGEFLEKGVVKCVIDKTYHWKEHKE
                     AFSYMATQRAQGKLIMEVERF"
     gene            complement(<1048660..>1048908)
                     /locus_tag="HG536_0B05690"
                     /db_xref="GeneID:59324823"
     mRNA            complement(<1048660..>1048908)
                     /locus_tag="HG536_0B05690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282484.1"
                     /db_xref="GeneID:59324823"
     CDS             complement(1048660..1048908)
                     /locus_tag="HG536_0B05690"
                     /inference="similar to AA sequence:RefSeq:NP_660100.1"
                     /note="ancestral locus Anc_7.394"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138379.1"
                     /db_xref="GeneID:59324823"
                     /translation="MSTYDQVEIEDMTFDPDTQLFTYPCPCGDRFQIYIDDMYDGENI
                     AVCPSCSLMIEVIFEKEDLQEYYKEAGSQPPEPVAVAT"
     gene            <1049664..>1050272
                     /locus_tag="HG536_0B05700"
                     /db_xref="GeneID:59324824"
     mRNA            <1049664..>1050272
                     /locus_tag="HG536_0B05700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282485.1"
                     /db_xref="GeneID:59324824"
     CDS             1049664..1050272
                     /locus_tag="HG536_0B05700"
                     /inference="similar to AA sequence:RefSeq:NP_009481.1"
                     /note="ancestral locus Anc_7.395"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138380.1"
                     /db_xref="GeneID:59324824"
                     /translation="MGISRDSRHKRSATGAKRAQFRKKRKFELGRQPANTKIGGKRIH
                     AVRTRGGNKKFRALRIETGNFSWASEGVAKKTRIVGVAYHPSNNELVRTNTLTKSAIV
                     QIDATPFRQWYEGHYGQTLGKKKNAKAAEEEAVAASKSTQKKWASRAGAAKIESSVES
                     QFGAGRLYAAISSRPGQSGRCDGYILEGEELAFYLRRLTAKK"
     gene            <1050756..>1051808
                     /locus_tag="HG536_0B05710"
                     /db_xref="GeneID:59324825"
     mRNA            <1050756..>1051808
                     /locus_tag="HG536_0B05710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282486.1"
                     /db_xref="GeneID:59324825"
     CDS             1050756..1051808
                     /locus_tag="HG536_0B05710"
                     /inference="similar to AA sequence:RefSeq:NP_009479.1"
                     /note="ancestral locus Anc_7.396"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138381.1"
                     /db_xref="GeneID:59324825"
                     /translation="MGAILFNSDVLKFDVTVGIDQFSFQVKAGSPFCGIKNLPDGLHV
                     IHISSSSNDDGDGIRYGYWFQDSRGLYMRYDEESGMYQMSREPDDAKYERMLQLGSHL
                     MVSFPKLDEANWLELTRFISYEQIETILDARYPYVDSSMTAMEESRVLNKRLRIPNDS
                     TCKHFKYTEIHFKSPDAIRPNHEMQDYMDKSHYLNHVIVARDMRGHINRLLGELQFAF
                     CNAMLFGNYGSSLQWHNIIELISFSSKLSLTFVERFDKVLALQLQTLPPEYTEALMNT
                     EMWERCLTKSYQSNKLELTKKAYESKFDLEEENEEFESVARLETGTLPNIDSDYGDDI
                     DENKPSVASGVYYVRP"
     gene            <1052184..>1054127
                     /locus_tag="HG536_0B05720"
                     /db_xref="GeneID:59324826"
     mRNA            <1052184..>1054127
                     /locus_tag="HG536_0B05720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282487.1"
                     /db_xref="GeneID:59324826"
     CDS             1052184..1054127
                     /locus_tag="HG536_0B05720"
                     /inference="similar to AA sequence:RefSeq:NP_009478.1"
                     /note="ancestral locus Anc_7.397"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138382.1"
                     /db_xref="GeneID:59324826"
                     /translation="MSKAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTD
                     TERLIGDAAKNQAAINPHNTVFDAKRLIGRKFDDPEVINDAKHFPFKVINKEGKPVVQ
                     VEYKGETKTFTPEEISSMVLGKMKETAEGYLGTKINDAVVTVPAYFNDSQRQATKDAG
                     TIAGLNVLRIINEPTAAAIAYGLDKKGRAEHNVLIFDLGGGTFDVSLLSIDEGIFEVK
                     ATAGDTHLGGEDFDNRLVTHLANEFKRKNKKDLTQNQRSLRRLRTAAERAKRALSSSS
                     QTSVEIDSLFEGIDFYTSITRARFEELCADMFRSTLEPVEKVLRDSKLDKSQIDEIVL
                     VGGSTRIPKIQKLVSDFFNGKEPNKSINPDEAVAYGAAVQAAILTGDQSTKTQDLLLL
                     DVAPLSMGIETAGGIMTKLIPRNSTIPTKKSETFSTYADNQPGVLIQVYEGERTKTKD
                     NNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVEKGTGKSNKITITNDKGRL
                     SKEDIERMVSEAEKYKAEDEKEAERVQSKNSLESYAFSLKNSAAESGFKEKVGEEDAK
                     KVEAAAQETINWLDASQAASTDEYKDKQKELEGIANPIMSKFYGAGGAAGAAGAGGPM
                     PGAGPSSGGPTGAESGPTVEEVD"
     gene            <1054417..>1057638
                     /locus_tag="HG536_0B05730"
                     /db_xref="GeneID:59324827"
     mRNA            <1054417..>1057638
                     /locus_tag="HG536_0B05730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282488.1"
                     /db_xref="GeneID:59324827"
     CDS             1054417..1057638
                     /locus_tag="HG536_0B05730"
                     /inference="similar to AA sequence:RefSeq:NP_009477.1"
                     /note="ancestral locus Anc_7.398"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138383.1"
                     /db_xref="GeneID:59324827"
                     /translation="MSENSSSHFSFPREEEKVLAFWDEIDAFRTSLKLTEDKPEFSFF
                     DGPPFATGTPHYGHILASTIKDIVPRYATMTGHHVERRFGWDTHGLPIEHIIDKKLNI
                     TCKEDVYKFGIDNYNNECRAIVMTYAEEWRKTIGRLGRWIDFDNDYKTMYPSFMESEW
                     WSFKQLFNKGQVYRGFRVMPYSTGCTTPLSNFEAQQNYKDVNDPAVTIGFNVIGQEKT
                     QLVAWTTTPWTLPSNLALCVNPDFEYVKIYDEKKDRYFILLESLIKTLYKKPKDEKFK
                     VVERIQGKDLVGLKYEPLFPYFVEKMGATAFKVVGDGYVTSDSGTGIVHNAPAFGEED
                     YNVCLNHGIFEEGGFFPNPVDDAGKFTSEVTDFSGLYVKDADKEIIKFLTATGNLLLA
                     SQIRHSYPFCWRSDTPLLYRTVPAWFVRVKEIIPQMLESVMNSRWVPRTIQEKRFANW
                     IANARDWNISRNRYWGTPIPLWVSDDLEEIVCIGSVAELEELSGVTGIKDLHRDFIDK
                     ITIPSKQGKGQLKRIEEVFDCWYESGSMPYASQHYPFENQDKFKYRVPANFISEGLDQ
                     TRGWFYTLSVLGTHLFGQVPYQNVIVSGLILAADGKKMSKSLKNYPDPNIVLSKYGAD
                     ALRLYLINSPVLKAETLKFKEEGVKEVVSKVLLPWWNSYKFLEGQIALLKKTSGIDFK
                     YNPSIQSDNVMDRWILASMQSLVQHIHTEMELYELFAVVPRLLHFIDELTNWYIRFNR
                     RRLKGENGVDDCLKALNSLFEALFTFVRAMAPFTPFLSDSIYLRMKEFIPEEVLAMFG
                     KDARSVHFLSYPEVRRELFDEAIEKSVARMQSVIDLGRNIREKKTISLKTPLKSLVIL
                     HSDKNYLKDIEDLKDYIVEELNVHDIIITSDEAKYGVEYRAVADWPVLGKKLKKDAKK
                     VKDALPSVSSDEVQQYLETGKLQVAGIDLITGDLNVVRGLPESLAQAGLETRSDQDVL
                     IILDTKIYPELKTEGLARELINRIQKLRKKCGLEATDDVLVQYELIKDTMDFEVVVKQ
                     HRETLTKTCRSDIVAFDGANDGAIADEEQSINDTIFKLKIFRL"
     gene            <1057832..>1058380
                     /locus_tag="HG536_0B05740"
                     /db_xref="GeneID:59324828"
     mRNA            <1057832..>1058380
                     /locus_tag="HG536_0B05740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282489.1"
                     /db_xref="GeneID:59324828"
     CDS             1057832..1058380
                     /locus_tag="HG536_0B05740"
                     /inference="similar to AA sequence:RefSeq:NP_011030.3"
                     /note="ancestral locus Anc_7.399"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138384.1"
                     /db_xref="GeneID:59324828"
                     /translation="MSNRQDNELVVGRLLNSSSSRSNESPRRAETPVQSPERQSGATQ
                     LIEADSGHESVTDSILAKRKQICQENRPGHSPTTSKSRIDTHNRIAQRQRTHKRHQRA
                     TQVRGGLEKMEQFVMTGEHLQELQRLSLQAQENTMTPDLAQLFEQEAQEDLEDDELIE
                     YVEHQEQLDQELQRILSELSIG"
     gene            <1058573..>1058929
                     /locus_tag="HG536_0B05750"
                     /db_xref="GeneID:59324829"
     mRNA            <1058573..>1058929
                     /locus_tag="HG536_0B05750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282490.1"
                     /db_xref="GeneID:59324829"
     CDS             1058573..1058929
                     /locus_tag="HG536_0B05750"
                     /inference="similar to AA sequence:RefSeq:NP_009475.1"
                     /note="ancestral locus Anc_7.400"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138385.1"
                     /db_xref="GeneID:59324829"
                     /translation="MKSTFKSEYPFEKRKAESERISQKFSNRIPVICEKAEKSDIPEI
                     DKRKYLVPADLTVGQFVYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHRDRD
                     GFLYVTYSGENTFGSL"
     gene            complement(<1059236..>1063609)
                     /locus_tag="HG536_0B05760"
                     /db_xref="GeneID:59324830"
     mRNA            complement(<1059236..>1063609)
                     /locus_tag="HG536_0B05760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282491.1"
                     /db_xref="GeneID:59324830"
     CDS             complement(1059236..1063609)
                     /locus_tag="HG536_0B05760"
                     /inference="similar to AA sequence:RefSeq:NP_009474.1"
                     /note="ancestral locus Anc_7.401"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138386.1"
                     /db_xref="GeneID:59324830"
                     /translation="MYSTPLKSRVDYNSGPFSGLSRLVSGNNGNTRDSSGEKGDGVNT
                     LDSQKDNNVQGVNSDSSLPLGASLLMPAGSLAPDLSAVDEHLRVTNLGGSKPLELASQ
                     YIDHLERRDANSPVLDERSYYNNGVNYNFSKEVGGLGAFTPFERQQVINIPDEILREA
                     SKSEIKSDMGIFPELGRCWITIDNKLILWNLKDSTDYQSIDEIKHTILKVALVKPKKD
                     MFVDYVNHLLLIATPFDIYLLAVSHNEETRELSVFNAGLSVSVHGLDVSQITCYDKTG
                     QIFFAGRTSGQNVWGLQYSGSDDWFNSKCNKVCLTQSAWSSLLPANLVSKLPGSGYIR
                     SFFEEDSKYAQETVVQLKIDQSRGIVYTLSSKSNIRAYLINGNHLENPMSIEPAYIRR
                     IMGTTTARGAAILGPKFLKISQIVPVSRQENHNLFLVAITVGGVRLNFNGSIGRSGIE
                     ALRLESIKFPPSSVTPEVIRQELQNQQLEQQKKGLRFYSNLNYSESVHLKFQKKSSVF
                     LETTSASTIISPGIFFSAVRKSTSPQDSKQTTDSKVSQSNNQAVQHKLFVSVPDYGVL
                     KNHGKYVENATLLDSTGNIKEIVLLTPTFNATQTPEGYANEFATQYSSENLKVAVLTN
                     SAVEIYRYRTPDEVFEALVDNPLPFLINYGVPEACSTALFVTCKLNKSEMLRSAALTF
                     FTVGIPGIVDIKPRYNKYMVSTVSSFFDKPSFDATPKKSLHTTPSGGAISMPDSKASF
                     SLDDVTLSARFYGIALLITRLLRDIWSKQIFVTYRPERFNSKVKEGSSEGGTIAGMSV
                     SKADVEYYLSSIAILNEFFNMYGNSLTVVYPSIISGSDISGKPIDKSEEVANQAENIA
                     INSMMKLVQSIMEALSFLNVLYEESEVEGFEQQYVAFKDIIKSLSPEIQVDLTKLKFK
                     DLFAPNEHTKVLVREILSSIINRNITRGASIEYTATALQERCGSFCSSSDILGFRAIE
                     HLRKAKEIGLRDYETLKYHLNNAIKLFERIVDDLSFDKLKEAVSIMLELNYFPKTIGF
                     LLNIANSVDKAKLAYQYVADGSLEHDGRKVYYDKRVLIYDLVFETLVMVDNLAARGPS
                     NGTANIPVPNDISSLREESYSVALKYNDKLFHYKLYDWLASQKCEEKLLELDTEFILP
                     NLQEQSKSSLELSNLLWVYLSRRSKYFEAAEILYSLANSDFELNLGERIEYLSRANGF
                     CNGVCNPSHKQRMVELSTMIQEIFDVAAVQDDLLSLVTTDQRIESNTKQDLIKQLDGK
                     VLPVSDLFNDFAVPLGYHEICLVIFKVSDFRNQEEIKAKWDELFESLKKELSDSQSLE
                     DSINFINLLSNVVIKVGKQVHSSEFVFPISDLFSTICTLFYEALPHEHIERGSIASIF
                     LSAGVSYGKLYYILKDLIETSDSPNALFTAEMTWLIKEWYKNDRKLRDIITYDEVSSL
                     DQYSIQSDPIEQYTRRTGNCV"
     gene            <1063882..>1064715
                     /locus_tag="HG536_0B05770"
                     /db_xref="GeneID:59324831"
     mRNA            <1063882..>1064715
                     /locus_tag="HG536_0B05770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282492.1"
                     /db_xref="GeneID:59324831"
     CDS             1063882..1064715
                     /locus_tag="HG536_0B05770"
                     /inference="similar to AA sequence:RefSeq:NP_011032.1"
                     /note="ancestral locus Anc_7.402"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138387.1"
                     /db_xref="GeneID:59324831"
                     /translation="MKPKIGGRVWRGKTLGDKDINTASAAAYLDKKQFKGFKNDWDGK
                     ENTEPNIAQKSDIFSEEADLTAILEQKFDERSGPFLTSENLATLQNELIKREVEQYCC
                     GHPLCSINNRRQIPLRLWFLFELEMLEDSGTNFRNLCYHNQVYREIDREWKMQNLLQN
                     QHIPSDCEFFPIQQLKIHDIELDRNHEESTTGKLQAGVENLIEKDDRKLLPTLLSKRN
                     MRSVFDHTPVRASKILSTELPSDSADLQETSTAQKERKCMLLNKLSLLHGCDSTKHPD
                     K"
     gene            complement(<1066139..>1066807)
                     /locus_tag="HG536_0B05780"
                     /db_xref="GeneID:59324832"
     mRNA            complement(<1066139..>1066807)
                     /locus_tag="HG536_0B05780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282493.1"
                     /db_xref="GeneID:59324832"
     CDS             complement(1066139..1066807)
                     /locus_tag="HG536_0B05780"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138388.1"
                     /db_xref="GeneID:59324832"
                     /translation="MILQPISIEIPALGPWLEQCFERNITARQLEAMAWLLGFWIGDG
                     HRKGAKIALNSEDHDVNARLRENAKVWGMTLRAERGNGLGAQGYLHTYNGAVRNLNKN
                     NPLVKVLEGLRFWENGEKNGLKSVPLFMRTEQIVVREAFLAGLIDSDSSCNIQGGSIR
                     AEIATVYPPIGDGVNFIGRSLGLTVSVHFRGANFSERHGLKESDLWTFHYMVGQIMKH
                     SGRY"
     gene            <1067733..>1071383
                     /locus_tag="HG536_0B05790"
                     /db_xref="GeneID:59324833"
     mRNA            <1067733..>1071383
                     /locus_tag="HG536_0B05790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282494.1"
                     /db_xref="GeneID:59324833"
     CDS             1067733..1071383
                     /locus_tag="HG536_0B05790"
                     /inference="similar to AA sequence:RefSeq:NP_010883.3"
                     /note="ancestral locus Anc_1.476"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138389.1"
                     /db_xref="GeneID:59324833"
                     /translation="MAPKSFVSSPLVRDSRLLVPKPVFSRPYVLFFFPLYATFAHLYL
                     QQYDRYIQGPEWTFVYLGGIISLNVLVMLMPAWNVRIAAGFNYSTAGDLEEATHILIH
                     TTANNGSDGIVEIQRVQEVGELQIFFQFQKKRFLWHQDEGVFSSPKFLIDESPKIGEF
                     QDFKGHSGDLTHLRRLYGENSFDIPIPTFVELFKEHAVAPLFVFQVFCVALWLLDEFW
                     YYALFNLFMIVSMEGAAVFQRLTTLKEFRTMGIKPYCINVYRNGKWSEIQTDQLLPMD
                     IVSITRTAEDSAIPCDLILIDGSCIVNEAMLSGESTPLLKESIRLRPKDDFLQIEGVD
                     KNSVLHGGTKALQVTAPETESHIPLPQDGGALAIVTKTGFETSQGSLVRVMIYSAERV
                     SVDNKEALYFILFLLIFAIVASWYVWVEGSRMGRTQSKLILDCILIITSVVPPELPME
                     LTMAVNSSLAALAKFYVYCTEPFRIPLAGRIDVCCFDKTGTLTGEDLVFEGLAGLSND
                     VSQIRHMFTAEDAPARTALVIGAAHALVRLDDGEIVGDPMEKATLRALDWKVEPKDTV
                     TKTGVGKIEILRRFQFSSALKRSSSIASHKNEFFAAVKGAPETIRERLVNVPENYDKI
                     YKSFTRSGSRVLALASKSLPRLSQKELDDITREAIEHELEFNGFLIFHCPLKEDAIET
                     IKMLNESSHRSIMITGDNPLTAVHVAKEVGIVDRETLILDRAGKDGEDALVFRNVEET
                     IAIPFDPATDKFDRVKLFDKYDLAVTGHSLGALEDHHQLKDLIRHTWVYARVSPSQKE
                     FILNTLKDMSYQTLMCGDGTNDVGALKQAHVGVALLNGTEEGLKKIADTRRTENMRAM
                     YLKQCGFFEKWGQPQPPVPEPIAHLFPPGPKNPHYLKALEKNGKKITPEIRKLVTEAN
                     NKPIEKLVANKGTTSGKDGNDLASMLLNNAGQSQEDEAPTLKLGDASCAAPFTSKLAN
                     VSAVTNIIRQGRCALVNTIQMYKILALNCLISAYSLSVIYLAGVKFGDGQATVSGLLL
                     SVCFLSISRGKPLQKLSKSRPQAGIFNVYIMGSILSQFAVHIVTLIYITLEIYKLEPR
                     EPQVDLEKKFEPSLLNTGIFIIQLVQQVSTFAVNYQGEPFRENIRNNKGMYWGLLGVT
                     GLALAGATEFVPELNEAMKFVPMEESFKIKLTLTLLIDFFGSWAAEHFFKYFFMDARP
                     ADIAVRTVEIVG"
     gene            complement(<1071506..>1073254)
                     /locus_tag="HG536_0B05800"
                     /db_xref="GeneID:59324834"
     mRNA            complement(<1071506..>1073254)
                     /locus_tag="HG536_0B05800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282495.1"
                     /db_xref="GeneID:59324834"
     CDS             complement(1071506..1073254)
                     /locus_tag="HG536_0B05800"
                     /inference="similar to AA sequence:RefSeq:NP_012580.1"
                     /note="ancestral locus Anc_1.475"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138390.1"
                     /db_xref="GeneID:59324834"
                     /translation="MSKGYSVPVVDLDQICDETELLPVVKRILRDNDTFLLKNYANKK
                     ALDDLLGELKEDDFPDAEEGFDANFTGVLQLTGDVLMEQYIFSTDQTLKFDRECRNET
                     LRKVYARLFKVALFFAQICLKSVGAEVPLTETSYSAVLNRFFHGGSDTSMSIDGETFQ
                     YASFGGYRDLLPTGVLTVFPAARGIKYKPPTMGSGDSFWVAIDEPDCLLFHTGTLLAH
                     YSGGSHSTSTIRISSESNILHLTLAPPLATVVDSSGERLADRLLRQQIVELPEVAKSY
                     YPREAALIQLEKTIAFYKELFSTCETVLPLYAMSRSTHSAPRLGSLLPQISNMMRGKV
                     SQQDFLKMVSLWPDCYVLQADSKGELTVKQPKLDQQQLLINKSRRLEFVERADSWLSR
                     IRSLEDIPTDVPAWKVSKRRGSGGSEPDPNNRIRRTAAPSPRKRNYVFNSAERFNYAE
                     KEKDSQSNLLERLRERERRSAALLSQRQRNYDQFLAVKMKQVFEILYSLPQGKPYTVT
                     HLGTLIVDSLQDSNNPIGFEEADTILSKLQGLLNKEVTVQTADGGLKVYRWKNLNRDL
                     LLERIDRELSSSQRLI"
     gene            <1073587..>1075533
                     /locus_tag="HG536_0B05810"
                     /db_xref="GeneID:59324835"
     mRNA            <1073587..>1075533
                     /locus_tag="HG536_0B05810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282496.1"
                     /db_xref="GeneID:59324835"
     CDS             1073587..1075533
                     /locus_tag="HG536_0B05810"
                     /inference="similar to AA sequence:RefSeq:NP_010884.1"
                     /note="ancestral locus Anc_1.474"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138391.1"
                     /db_xref="GeneID:59324835"
                     /translation="MLAAKNILRKSAIATPVRVASRFQSTSKVQGSVIGIDLGTTNSA
                     VAVMEGKIPKIIENAEGARTTPSVVAFTKDGERLVGIPAKRQAVVNPENTLFATKRLI
                     GRRFEDAEVQRDIKQVPYKIVKHSNGDAWVEARGQTYSPAQIGGFVLNKMKETAEAYL
                     GKPAKNAVVTVPAYFNDSQRQATKDAGQIVGLNVLRVVNEPTAAALAYGLEKSDSKVV
                     AVFDLGGGTFDISILDIDNGVFEVKSTNGDTHLGGEDFDIYLLREIVSRFKSESGIDL
                     TNDRMAIQRIREAAEKAKIELSSTVSTEINLPFITADASGPKHINMKFSRAQFETLTE
                     PLIKRTVDPVKKALKDANLSTSDVSDVLLVGGMSRMPKVVETVKQLFGKEPSKAVNPD
                     EAVAIGAAIQGAVLAGEVTDVLLLDVTPLSLGIETLGGVFTRLIPRNTTIPTKKSQIF
                     STAAAGQTSVEIRVFQGERELVRDNKLIGNFTLSGIPPAPKGVPQIEVTFDLDADGII
                     NVSARDKASNKDASITVAGSSGLSEAEIEQMVNDAEKYKSQDEARRQSIETANKADQL
                     ANDTESSLKEFEGKIDKAEAQKVQDMITSLRETVARVQAGEEVSADDLKTKTDELQNS
                     SMKLFEQMYKNDSSNNTQSGEPKQ"
     gene            <1075792..>1076211
                     /locus_tag="HG536_0B05820"
                     /db_xref="GeneID:59324836"
     mRNA            <1075792..>1076211
                     /locus_tag="HG536_0B05820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282497.1"
                     /db_xref="GeneID:59324836"
     CDS             1075792..1076211
                     /locus_tag="HG536_0B05820"
                     /inference="similar to AA sequence:RefSeq:NP_012578.3"
                     /note="ancestral locus Anc_1.473"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138392.1"
                     /db_xref="GeneID:59324836"
                     /translation="MEFKVSPLTKIISLSGFLALGFLLVILSCALFHNYYPLFDILIF
                     LLAPLPNTLFSKSGADNANFMSDAPSNAQDTGNFLTGVFVTSGIALPVVFYHCQLIGA
                     LSCVMSTIGGLIIYSSIVVFSWFFHSSWDQEEDTLFG"
     gene            complement(<1076592..>1077536)
                     /locus_tag="HG536_0B05830"
                     /db_xref="GeneID:59324837"
     mRNA            complement(<1076592..>1077536)
                     /locus_tag="HG536_0B05830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282498.1"
                     /db_xref="GeneID:59324837"
     CDS             complement(1076592..1077536)
                     /locus_tag="HG536_0B05830"
                     /inference="similar to AA sequence:RefSeq:NP_010885.1"
                     /note="ancestral locus Anc_1.471"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138393.1"
                     /db_xref="GeneID:59324837"
                     /translation="MPRLLATQSHVVHGFVGNKAATFPLQCYGWDVDCCNSVQYSNHT
                     GYGMHKVFGNITEEKDLDQLLSGVLANFANDYEALLSGYLPKKESVRCMGQHYTAYKR
                     ENPNSVWLMDPVMGDEGQLYVEEDVIEEYRKLALSSHSDVDIMTPNHFELEIICGKSI
                     DTVDQLKSVLQELHETVPVVIVTSCDEKIFSDPHHVYCVASMKGNAPVVLRVPLIKSY
                     FTGVGDLFSALLLDRVYKLLSLSDEGLKLEHQVNDVLNVIQGVLKITLAYAPKNHTAK
                     IGNAVDMKNAELRIIESRHLFSEDVATESKQNFIYREL"
     gene            1079926..1079996
                     /locus_tag="HG536_0Btrna5G"
                     /db_xref="GeneID:59324978"
     tRNA            1079926..1079996
                     /locus_tag="HG536_0Btrna5G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59324978"
     gene            <1080285..>1081199
                     /locus_tag="HG536_0B05850"
                     /db_xref="GeneID:59324838"
     mRNA            <1080285..>1081199
                     /locus_tag="HG536_0B05850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282499.1"
                     /db_xref="GeneID:59324838"
     CDS             1080285..1081199
                     /locus_tag="HG536_0B05850"
                     /inference="similar to AA sequence:RefSeq:NP_011354.3"
                     /note="ancestral locus Anc_8.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138394.1"
                     /db_xref="GeneID:59324838"
                     /translation="MSGNADSYNRRDSFTELDDGLEGVDDFTHEPNPFDDVISDDYDA
                     KKKPPGYGNVADTVSLPPGYEETMEVPQRPAEGPSSNQAAAGTLPPGLFNYLSQYFEL
                     DDQELKKRLYSAIAFKLESIADLENRAPDDAKPDLYSPVWIFGTIVMTNFIGSRLFEV
                     IVNGVIRGVYWQEDSNKVFGGARFIRSFWLYLIYGFLVPLVIAKTYLHRKDSVAELIS
                     TYGYSLLVWIPLGLLIDLSNAFQTLLPKYVLSLIKWVFVTIAFMKSSLFLYRKMNTED
                     ESDQLVKWPVIGLNAIMCIVARFLLYHS"
     gene            complement(<1081273..>1082187)
                     /locus_tag="HG536_0B05860"
                     /db_xref="GeneID:59324839"
     mRNA            complement(<1081273..>1082187)
                     /locus_tag="HG536_0B05860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282500.1"
                     /db_xref="GeneID:59324839"
     CDS             complement(1081273..1082187)
                     /locus_tag="HG536_0B05860"
                     /inference="similar to AA sequence:RefSeq:NP_011353.1"
                     /note="ancestral locus Anc_8.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138395.1"
                     /db_xref="GeneID:59324839"
                     /translation="MSTSIPVINRNQTLPPLLLPDLRFLNERQYQKISFDVPTCSPVA
                     MSEGSSKRFSTLESLANVATKRLKLSSEKTSLSHMMTPPPTAPVSAPISPSPSYVAFQ
                     ENASSGASSVKSTSPSPSSSTPASASAAPASSRSDRKNSTLNTAKRQRIGPSCDGCRL
                     KKIKCDASIEILLQDESIIPLFARELHHVFTRQEVLDHSDTLFKKLGLPDSILEETAQ
                     DAADDEQNSTAGRTPILIKHIDKIVLFRCCSSCRKRRISNGHSHDCCVFSKGFTRADI
                     NVFSKISSKVPGKSMAEMDITDYRNAGF"
     gene            <1083157..>1085757
                     /locus_tag="HG536_0B05870"
                     /db_xref="GeneID:59324840"
     mRNA            <1083157..>1085757
                     /locus_tag="HG536_0B05870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282501.1"
                     /db_xref="GeneID:59324840"
     CDS             1083157..1085757
                     /locus_tag="HG536_0B05870"
                     /inference="similar to AA sequence:RefSeq:NP_011352.1"
                     /note="ancestral locus Anc_8.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138396.1"
                     /db_xref="GeneID:59324840"
                     /translation="MAKRKLPDRPPNGIGAGQRPRLVPRALNVQGSLATLTKPFKVPY
                     KVDKRRNEQDVGGGGGRSLRRRSQTVSYAGLDVATEVEMEGPDGLPPISSVVRKDALS
                     SRRLAEDPVRLSQIESVLKRSFTVPIRGYIQRHSLPLTLGTKKKIALEPRPLHDPTDE
                     FAIVLYDPSVDGDMVIQDTNDVPLQEVSQNTQAEQGAEHKKGLHPRFLSNGLKNKSLK
                     ELLGEDDDLGTKAKKFPNIPVVIDPKLAKILRPHQVEGVRFLYRCVTGLVMKDFLDKQ
                     TVENGSNSAAEVNEELVINRGAYGCIMADEMGLGKTLQCIALMWTLLRQGPQGKRLID
                     KCIIVCPSSLVNNWANELVKWLGPNTLSPLAIDGKKTNSVSESVRSWAQAQGRNIVKP
                     VLIISYETLRRNVEALRNTKVGLMLADEGHRLKNADSLTFTSLDSIDCPRRVILSGTP
                     IQNDLSEYFALLNFSNPGLLGTRSDFRKNYENPILLSRDADATDDQIKKGEEQLQKLS
                     YVVSKFIIRRTNDILSKYLPCKYEHVIFVNLRPFQRELYEKLVKSREITKMVKGNNTG
                     SQPLKAIGLLKKLCNHPDLLDFNEDLENFNDLQIPDDYEIPSKVNTRKAVQTKFSGKF
                     AILERFLATIKSQSDDKIVLISNYTQTLDLIERLCRYKHYASLRLDGTMTINKRQKLV
                     DRFNDPEGQEFIFLLSSKAGGCGINLIGANRLILMDPDWNPAADQQALARVWRDGQKK
                     DCFIYRFISTGTIEEKIYQRQSMKMSLSSCVVDAKEDVERLFSTDNLRMLFKFNGETI
                     CETHETYHCKRCDSKSGKQKIKSPAMLYGDATTWNHLNHDALQKTNDHLLRNEFNSPD
                     ISYVFQYISH"
     gene            <1085915..>1087192
                     /locus_tag="HG536_0B05880"
                     /db_xref="GeneID:59324841"
     mRNA            <1085915..>1087192
                     /locus_tag="HG536_0B05880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282502.1"
                     /db_xref="GeneID:59324841"
     CDS             1085915..1087192
                     /locus_tag="HG536_0B05880"
                     /inference="similar to AA sequence:RefSeq:NP_011351.1"
                     /note="ancestral locus Anc_8.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138397.1"
                     /db_xref="GeneID:59324841"
                     /translation="MDDILAKAGSQAVTFAIKSGISIASTYALRTITKFVIQIPKSDA
                     RRIEQQKAKLENRIAIVTSAIDLIKLVAARGNTNLESTLRLTKDLKNELDSFDERMRE
                     LITKVEESRSAKSQKEAIDSVELYINDLLQRIEEVTPFINLSLTTSGANLNSSLPQQV
                     SPGLLLKASNYINSSNGKPAGQVGPAFEISLYSVFYHLDKANSSSNVRVDWKEDMKKA
                     FVRVVRIESSESSYNYQLLIEQSFDDGRYHNFEEEKLQKLTVNLRSIVKLFFSVSGNL
                     LKLAEQENPVLVLKVDKNIAGEHPETSMEDIAWYAFGQYDGVEDEEEEEEAEEGEEEG
                     EGPDEYKDREKQEEKELTEKQKDGSGTSSSIALLEYIIRLASLQESDNQSILEVSDER
                     LSVYLNDENPNSIREKKANVDQVTHGLSKVTLD"
     gene            complement(<1087362..>1089278)
                     /locus_tag="HG536_0B05890"
                     /db_xref="GeneID:59324842"
     mRNA            complement(<1087362..>1089278)
                     /locus_tag="HG536_0B05890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282503.1"
                     /db_xref="GeneID:59324842"
     CDS             complement(1087362..1089278)
                     /locus_tag="HG536_0B05890"
                     /inference="similar to AA sequence:RefSeq:NP_011349.3"
                     /note="ancestral locus Anc_8.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138398.1"
                     /db_xref="GeneID:59324842"
                     /translation="MVLINNVKYACERCIRGHRVTTCNHTDQPLMMIKPKGRPSTTCD
                     HCKELRKNKKANPTGVCTCGRLEKKRLAQKAKEEARAKAKEEKRLHDCRCDKQEPCKC
                     HSTRRRSRKVSVNHEGVRRSNSNSNVMVGQGHVASPVSMETFNDNSYVESDVSGKISK
                     DYHHVPSLASISSFHSTQSLDHKFALPQSPTLGNFVTGTNTNGNGHWDNSSICSSVRS
                     DSRANLSDAVSVGLDPLNNTKRVTPMTRTRVGEVTVPLEEYIPSDINGIGKINDTSSL
                     IDDWSFENPAGNRNVSASATYANSNANSFLQSHDINGTRNDTNNGLLDMFLDSSNIPF
                     SYDRNNSAPLGLGKRYSVHSPQSGTHHYSNVSDNANAEPASNTNNMNNSNTKQWDAPE
                     TSLDNESVRSVEVLSLTPSFMDIPERVPNHQQQQHSRPSIESRKSKQRSSSLHRNHRY
                     PPTNGASQSYNVRPAPITINPSMVSSVDDNVSTNSLQSPTGSLNENGLMTGLTDAALS
                     KYLPDRMKFPRSTEPQDKSSSQNPQGFQRLQQPQRQSPQDLRSSTGMNLDIDKLMGFD
                     GASIGGMIDNRTLDKENGRPLFQENFMSYANPSAKTEIQDSPRIGSNQTSSSPSQLLT
                     EKSFADLDNFMSIL"
     gene            complement(1089797..1089867)
                     /locus_tag="HG536_0Btrna6G"
                     /db_xref="GeneID:59324981"
     tRNA            complement(1089797..1089867)
                     /locus_tag="HG536_0Btrna6G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59324981"
     gene            complement(<1089977..>1090993)
                     /locus_tag="HG536_0B05900"
                     /db_xref="GeneID:59324843"
     mRNA            complement(<1089977..>1090993)
                     /locus_tag="HG536_0B05900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282504.1"
                     /db_xref="GeneID:59324843"
     CDS             complement(1089977..1090993)
                     /locus_tag="HG536_0B05900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138399.1"
                     /db_xref="GeneID:59324843"
                     /translation="MTEPAPPFAKLSVLSGLWQGIWPKKPTFLPDQYPDLSGISAIVT
                     GANTGIGYEVAKLLYGKNCDVIAVVRSELKGKEAREKILSEVNGSGGSIEVISGCDFL
                     DLSTVKPAAEKIKAVLGDRPLGIIIHNAGLMAPNSNGTSKQGFEAMFSVNVLGPQLLQ
                     HFLDPLFLKKDAAIKRIVWVSSAAHLYGFKEYGINWDNPTFRDVPVNRRPHHQTLYGQ
                     SKAANVLQANAWAVKNQKAVDEISCVSVSCFPGVLYTQLVRDWGFLANKLMPLLTYGG
                     VYGAYTELYSALSPDLTRKDQGAYTIPFGQIGEPRADIKAGMRNGSDLKLWDIAEDII
                     SDYF"
     gene            <1091530..>1094586
                     /locus_tag="HG536_0B05910"
                     /db_xref="GeneID:59324844"
     mRNA            <1091530..>1094586
                     /locus_tag="HG536_0B05910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282505.1"
                     /db_xref="GeneID:59324844"
     CDS             1091530..1094586
                     /locus_tag="HG536_0B05910"
                     /inference="similar to AA sequence:RefSeq:NP_015316.1"
                     /note="ancestral locus Anc_8.75"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138400.1"
                     /db_xref="GeneID:59324844"
                     /translation="MKQRISALDLQILARELRNNLEGYRLTNIYNIADSSRQFLLRFN
                     KPESKVSLVVDCGLRIHLTDYDRPIPSTPSGFVVKLRKHLRGKRLSALRQVENDRILV
                     LQFADGMFYLVLEFFSAGNVILLDENKKILSLQRIVHEHENKVGEVYNMFDDRILAAD
                     FVGNAGLMVEPRQYSRDDVKSWLDEAITKFSLQSKLAAVEQAMGSKTEGKKKNPKPTT
                     IHKLLLSKEPHLSSDLLSKNLKGRKIDPSTPCIEFSDKEQALVDLLLDTEAEYLHLLQ
                     SKDVGGFIVAKKNAHYQAENDSSDLEFIYENFHPFQPLVEEKDADKIKVIHVPGDYNK
                     TLDTFFSTIESSKYALRIQQQEQLAKKKLEDARQENDRKIQALLDVQSSNEQKGHTII
                     ANADLVEEAKFAVQGLVDQQMDWKTIEKLIKHEQRKGNKIALVIDLPLKLEENKINLL
                     LPHNPDHTDQSESRSQLSSSDDEATETSDDEEAEDSDASEVSDFETENTLERANVKKP
                     VNKDKIKIEIDLDLSAYANASKYFTVKKSSVEKQKKVEKNVEKAMKNIEQRIDKQLKQ
                     KLKESHNVLRKVRVPYFFEKHFWFYSSEGFLVLMARSPMETDLIYSKYIEDDDIYMCS
                     SFDTQVWIKNPDRTEVPPNTLMQAGVFCLAASEAWSKKISSSPQWCFAKNVTKFDQTD
                     EGILEPGMFRLKKESEMNHLPPAQLVMGFGFLWKVQGDDEDMAEDDKNKDSEDEDNQD
                     ESGDEGEEKDEHETENTIIEGASETKPEAEFQEVRELSVELKHLQVEATSEPSEAHKN
                     TGTGTASVTDVTEVLPQMNKNVRGKKGKLKKIQKKYADQDEDERLRRLEALGTLKGLE
                     KNQLKAQEELARQQNREYKKARRERQKELQTLRFTKNEKVQINYGKIASEIKARTDKD
                     DQIVDAIPVFAPWSALQKCKYKAKIQPGSGKKTKTVTEVLNYFCNRDVDPSMTDREAD
                     WPKEHEIIRQMKPQDLVLIICSDKLKVSLPGGSNTQKGKAKSKKKK"
     gene            complement(<1094666..>1095235)
                     /locus_tag="HG536_0B05920"
                     /db_xref="GeneID:59324845"
     mRNA            complement(<1094666..>1095235)
                     /locus_tag="HG536_0B05920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282506.1"
                     /db_xref="GeneID:59324845"
     CDS             complement(1094666..1095235)
                     /locus_tag="HG536_0B05920"
                     /inference="similar to AA sequence:RefSeq:NP_015315.1"
                     /note="ancestral locus Anc_8.76"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138401.1"
                     /db_xref="GeneID:59324845"
                     /translation="MSRLSLYSVQAILILDNTGSRIHAKYYQSPHVAEDKRKGSLQSV
                     KRQKEFEKQLAQKTHKQDSDILIFEDHLVFYKEYMDVTLYLLGSMDENEIVLQQAFSA
                     FKDSLDLILNSGIDKKNIQEHYDMVLLAIDETVDNGIILETDPATIASRVTKPPSNEP
                     QVSLDLDKGLLGAWGFAKSKLQERLQQSM"
     gene            <1095483..>1096556
                     /locus_tag="HG536_0B05930"
                     /db_xref="GeneID:59324846"
     mRNA            <1095483..>1096556
                     /locus_tag="HG536_0B05930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282507.1"
                     /db_xref="GeneID:59324846"
     CDS             1095483..1096556
                     /locus_tag="HG536_0B05930"
                     /inference="similar to AA sequence:RefSeq:NP_015314.1"
                     /note="ancestral locus Anc_8.77"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138402.1"
                     /db_xref="GeneID:59324846"
                     /translation="MAATSDFYFGLLRVSMIQLLKSHGFDRAKPSTIDIITDLYIRYL
                     RVLTSEIIKSAQSRLDWDDTLALQDLTLGLQNLGIIKPVDVLDVYDENPNLVSDEGMR
                     KLKEWCVRDRQPADARKVALPSGSLLRSNSKGSKPPSLIPEYINQLQHGGQGAGDTNG
                     NEEDKLVEELINNGDVDDWIRLVLSRQRINHAKRATGKEPQTLDDLSSVPGFKHSVLN
                     ANNISASGNQTVPDCALANSGEEASIARKGTELLQKLPVMRPEWKLENLSLSFDKDEG
                     SENNEDLESLQNDSAVDDIPTSLPPEEDFDDLGTNGSNFILGDNTDTQIAEMEDMDNT
                     FQRRESLDFGNTPHALNFEYNGF"
     gene            complement(<1096665..>1100336)
                     /locus_tag="HG536_0B05940"
                     /db_xref="GeneID:59324847"
     mRNA            complement(<1096665..>1100336)
                     /locus_tag="HG536_0B05940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282508.1"
                     /db_xref="GeneID:59324847"
     CDS             complement(1096665..1100336)
                     /locus_tag="HG536_0B05940"
                     /inference="similar to AA sequence:RefSeq:NP_015313.1"
                     /note="ancestral locus Anc_8.78"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138403.1"
                     /db_xref="GeneID:59324847"
                     /translation="MEADQAARWLELEEKLAKIRQQISSKLENQKHVAIILSAVEENI
                     ESSQDQNISSNIVKYLIALMSLLDQVIVRETGEIGNLQLATSSCYLLDLIFHYAPKTL
                     LRSKFAEILTKIAPFITDENAEAPLIRSAIGCLEALLIAQDAQAWNNTQDLSITPNRG
                     LQGLLQLSLDPRPKVRKRAVEGVSAILSNPPAAPTAGHVAAVPVTIFAVNSLQKALDT
                     AANTSSKKLKAQGAASETNNDIIRALRLINAVVSTGQWPSQQIEVLCDLLLAVTKSSD
                     QYLVKAAFECFENLFKIISELSSDSTLAESKSLKLLDVIFSLTPSSSDANLVGSWIAV
                     LVKGLSAYAMHQPLKCLSKIPDVFKLMSQYLASETPEVYHSASQCLVATVADAVKDEL
                     LLYPPAMDENTFEAVDQVLSDLSEIFVELLSVRYIHCAKEVLNVLRTAITKFRYRSYP
                     ELIAPLEIVGGWRTSEEEFLELRSEAEAVIAAAITSIGPKKVLSSLPLNLVEPSDSKP
                     GRAWLLPLIRDNTRNTELAVFIEELVPLIEIYQAKCEQLPKESVQLKIFQTVLDQIWS
                     TLPHFCELPVDLEKAFTDKFAADLSSLLYQKVELRTTICHSFKNLVETNLAYINGVYA
                     DDILLQQHFPVGKATEGLEFLKGKTANLLAVLFNVYTQTAANARGYILETIESYLKIA
                     SAEDLRKMFDNVCALLKKAMDEETGRPSKGQPQLSATLLDIVVCMSKYLPVSAYPALF
                     SLFGATVSSKDALTQKRAYRIITRLAEPQAGAEALAGYISDVEKVMLVNSGTVQTSSK
                     SARLAAIRTVVDILPSNHLDFIVQVIAEVILATKDVNEKSRELSFETLIAMGKKMNDP
                     NGVISLSKVPGYNPETPDQPSSISEFFKIIAAGLIGESQHMVSSTITAFACLIFEYKD
                     QVDHSVLLDIYDTIELYLTSNSREIAKSAIGFAKVCVLGLPDELMREKVPALIVKLLR
                     WSHEHTGHFKAKVKHIIERLIRKYGYEFIEANFPADDLRLLANIRKTKNRSKRKEEES
                     EGAAVSTTSNKGSRFMNAFDEAIYEMSEEEEEGEDEEDETRNGRRSQAKQFIVESNDN
                     PLDLLDSQTLAHISSTRPKKFTNDQKKKLLQDDMFNFDSEGRLIMKNDRKVSGDDEDP
                     LKSVTSGINAYLDAVKQGPIRGQKNRLKFKKGARAGAALNDDEDDGVKDIPKRAATNK
                     NKINKSGKKGPKYKSKRKL"
     gene            <1100574..>1100933
                     /locus_tag="HG536_0B05950"
                     /db_xref="GeneID:59324848"
     mRNA            <1100574..>1100933
                     /locus_tag="HG536_0B05950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282509.1"
                     /db_xref="GeneID:59324848"
     CDS             1100574..1100933
                     /locus_tag="HG536_0B05950"
                     /inference="similar to AA sequence:RefSeq:NP_015312.1"
                     /note="ancestral locus Anc_8.79"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138404.1"
                     /db_xref="GeneID:59324848"
                     /translation="MGLGLVRIRLARFGRTNSPVYNIVVTNAHKARDAKPIEVLGTYN
                     PIPRPRTVKQKKQGMVAIKDVQLDFDRAKYWIGVGAQPSETVTKLLQKSGILDESWGK
                     SYASSRKVVAPRREVLE"
     gene            complement(<1101031..>1102173)
                     /locus_tag="HG536_0B05960"
                     /db_xref="GeneID:59324849"
     mRNA            complement(<1101031..>1102173)
                     /locus_tag="HG536_0B05960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282510.1"
                     /db_xref="GeneID:59324849"
     CDS             complement(1101031..1102173)
                     /locus_tag="HG536_0B05960"
                     /inference="similar to AA sequence:RefSeq:NP_015311.1"
                     /note="ancestral locus Anc_8.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138405.1"
                     /db_xref="GeneID:59324849"
                     /translation="MLLDRFHRKFYHSKHRTSPEVGSSEDVTMVDDSMEADSFQLSQP
                     VPVTAGNRHGESLGLYGQGQEFEESEEMMYVDPGVHTPVSTTPLNRQEDVEGLGGSFP
                     PYLQMQGRQRSVSSLASSVSDFHGGLRHQAFATAAAGGAGSFTPQFLSLLLQVYQDLS
                     SDPTVTPFDKTNPPSAILNKAAKIAIEQCRTQGVEIGYERNSWLLTLVRHRLLEEVRM
                     EGFYSRNNSNLSLAPPPPQFVELMYNSSFQNSKPSTPDCAGKPTAQDYFGNVLSANAG
                     RTGLMRSRSNSSQILLARTRSNSNGLFALTPASSECCLAPGFNGAAPSVNTNHGAFLS
                     RQRSNTALSNSPATTAMAATCNHPSLENSIVSETLRKKRESLRLKR"
     gene            <1102737..>1105238
                     /locus_tag="HG536_0B05970"
                     /db_xref="GeneID:59324850"
     mRNA            <1102737..>1105238
                     /locus_tag="HG536_0B05970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282511.1"
                     /db_xref="GeneID:59324850"
     CDS             1102737..1105238
                     /locus_tag="HG536_0B05970"
                     /inference="similar to AA sequence:RefSeq:NP_015317.1"
                     /note="ancestral locus Anc_8.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138406.1"
                     /db_xref="GeneID:59324850"
                     /translation="MGAQEGCEKFGHPYEPYEIQLQLMRCIYDALSSGRKVAVVESPT
                     GTGKTLSLICSVVSWLRRNKPDLLAGAFGEDAEEEDDDEPDWVNETYKRSVLGSRLQA
                     MREYEQHLERLSRDLRMLVPEVRETAGNTYKRRKTPSRVEVSVAESDFLAQPYESDSE
                     NANNDGGVIHAGDKQKLEREVKEMLAKLESSRSDEKSSLKNDNFNPVKIFYASRTHSQ
                     LNQFASQLRLPKFESSFVEQQVPVERLKYVPLASRKQLCINEDVKKWGSVEAINDACA
                     ELLKSPKGCQFYQPSSAFYKEHLSRSFRDNTFAQIQDIEDLCALGKALHVCPYYATRD
                     SLTGAEVVTLPYQYLLSESTRMQLGIDLKDSIVIIDEAHNLVETINAIHSAEISLADL
                     TLCNEGVKRYLERFRSRLNPGNRVNLMKLMELMRTWIAFIRNNYKKPGQEISFVDFFA
                     STNIDTLNIHKINRYITKSKVAYKIDTYTKSLSEESCNSDSSSKAPVKASSNPLLFKV
                     ANFLQCLTNPAKEGRFFFEKGQVIKYMLLEPAESFQSIVNDARCVILAGGTMQPVSDL
                     LNNLFMEIPKEEISLFSCNHVIPDENLRAYIPQESQFEFTFEKRQSLSLIKGGLFQFY
                     LALAKNVPTSGGIVGFFPSYQYLEYVYNIWKREGLFTKLDNVRKIFYESKVNEDPLPA
                     YTEAVSKGKGALLLAVVGGKLSEGINFQDDLCRAVVMTGLPFPNVFSGELLIKTRHLE
                     NKIISSGGTTKDAKQATRDFYETICMKAVNQSIGRAIRHANDYSLIFLLDKRYANPEI
                     SKKLSQWVSRRLQSQSTVTEIMKDTSSFFSLHNHR"
     gene            complement(<1105290..>1107029)
                     /locus_tag="HG536_0B05980"
                     /db_xref="GeneID:59324851"
     mRNA            complement(<1105290..>1107029)
                     /locus_tag="HG536_0B05980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282512.1"
                     /db_xref="GeneID:59324851"
     CDS             complement(1105290..1107029)
                     /locus_tag="HG536_0B05980"
                     /inference="similar to AA sequence:RefSeq:NP_015318.1"
                     /note="ancestral locus Anc_8.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138407.1"
                     /db_xref="GeneID:59324851"
                     /translation="MKLLKDLVITRKELQDSERNIVWARDGTLYITAYPDICIGQPIY
                     RKEVSNNSKQLFHIKDYPLELENKFEFEGAGRNALLNSQPVSYTKLCKPCPTASFLAV
                     LTSNLNVHIFKDQRLICNLDEPDKELERRAYHCVEWSPDGSSLAVGNERGEVVIYSLE
                     DHADGSPHFTANKLIELGHDVATNWIVGIDWKDDKIIIMLDNNSIYMVDFSKGGKLTR
                     LRAPSRLRLIDSCLLDKFLVYTDSCHLYRVDLEAEETSSLALTASDGFKIVPVKGTET
                     VIVISNKTSCKVQLKGELTLAPDEIVAPHLERKFKKWSIINNEFSNYEASVLIHGLAL
                     SSDGYSLAICYSMERATMKYKIASEHMFYITFVPLCHSWTISKYATGLAWYQCYQIYQ
                     CTLPSSASKEDIPTPTCDVNMSLRAYIRSLLNNEKMNSWRFFNFIDEHPSIVPFRRAI
                     FDYAVAKSSEITNPIDKASIQSLASILRRDSPVTSDIVELRGEFITESFDFRTSDTPD
                     YICSEQQHTWRRCFVSLLPILTTQVKVCPISNQRIIDIKKDNLNDYGWFTRTLLEELN
                     EESVYTGTAMAAA"
     gene            <1107210..>1110731
                     /locus_tag="HG536_0B05990"
                     /db_xref="GeneID:59324852"
     mRNA            <1107210..>1110731
                     /locus_tag="HG536_0B05990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282513.1"
                     /db_xref="GeneID:59324852"
     CDS             1107210..1110731
                     /locus_tag="HG536_0B05990"
                     /inference="similar to AA sequence:RefSeq:NP_015319.1"
                     /note="ancestral locus Anc_8.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138408.1"
                     /db_xref="GeneID:59324852"
                     /translation="MLPMILLACIAGLCNAVTAMAARCAMYDHCGKKSVFGSELPCPV
                     FDPQFKPDPANDELIDLVAEICGEEWRDETELCCTMDQVENLKKNLKKAQGIIASCPA
                     CMKNFNSLFCHFTCSPKQADFVNVTRIQESLAKKEIVAEVDVYLNSSWASVFYDSCKD
                     VKFSATNGYAMDLIGGGAKNYSQFLKFLGDEKPLLGGSPFQINYLYELDGAGGDFSLF
                     NDSVYACNDSEYKCACADCGASCPDLAPLARDTCRVGSLPCFSFGILMIYALLLVALV
                     IWHICMFRNKQKTSLITSDESPTGSISQMGSDDRLFETYDTNSYSFNNKVANVLGSVS
                     GYSVRNPYFTTTLTIATVAVFGLLLYFFGELERDPINLWVSKHSEKYREKVFFDENFG
                     PFYRVEQIFVVNETGPVLSYETMEWWSAVEQEISEIITSTENLTFQDFCLRPTPGSSC
                     VLESFVQYFPNGLPDKLSWREQLQMCTDSPVNCLPTFQQPLRKNLLFSDDDIFEAKAF
                     VTTLLVNNHSESAILWESALEAYLLQLQIPEGLRISFNTEMSLEKELSNNDDVLIIFT
                     SYLVMFLYASWALKKRGGGDRWLLGFVGILIVASSVLCAAGLMSVLGIKSTLIIAEVI
                     PFLILAVGIDNIFLITHEYDRLSDTNLNLDTDTRIILAVKRICPSILLSFICQAGCFL
                     IAAFVSMPAVRNFALYSALAVLFNVLLQMTAYVAFLALYEKRNATIIKDDSDDGHLFG
                     ERYFCLIAKKRKILAFFSSWAMLSLVFLPEIKLGLDQTLAVPKTSYLVDYFRDVYENL
                     NVGPPVYFVVKDLDFRKRRNQQKVCGKFTTCNNDSLANVLEKERERSTIVDPVANWLD
                     DFMLFLNPDLDQCCRLKKGSTDVCPPSFPNKRCETCYQEGDWKYDMSGFPEGDDFMEY
                     LSIWLETPSDPCPLGGRAPYSSSISVDQSKVKASVFRTAHKPLRSQDDYIKAYKDSIR
                     ISESLEGLDVFAYSPFYIYFVQYQNIITLAVGLIGAALVLIFAANTLFLGSAQTAALL
                     TLTVMMILVDIGAFMVWFGISLNAVSLVNLVICVGLAVEFCVHIARAFSVLPEGIRND
                     RDSRVKYAMSTVGGSVFRGITMTKLIGVCVVAFAQSKIFEIFYFRMWFSLIAIASVHA
                     LIFLPVLLSLAGGKSYIDEPTQESLLD"
     gene            <1110922..>1112766
                     /locus_tag="HG536_0B06000"
                     /db_xref="GeneID:59324853"
     mRNA            <1110922..>1112766
                     /locus_tag="HG536_0B06000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282514.1"
                     /db_xref="GeneID:59324853"
     CDS             1110922..1112766
                     /locus_tag="HG536_0B06000"
                     /inference="similar to AA sequence:RefSeq:NP_015320.1"
                     /note="ancestral locus Anc_8.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138409.1"
                     /db_xref="GeneID:59324853"
                     /translation="MNVLITLGQILSKNGVASPSVKHEKYLLSMFEKARPVPNKIKIN
                     KVKQTQKTPERMRKVVTLKANRHLVGQGSNFQKKVVKDYLSPLRVHDFSRHEIKNDYD
                     TQKATRMSHIARRRKQSANYREILFSDSRRFVGELLAALVACSSKTIEATSDHVVRHF
                     PTWTMEEVPKIPKFSANPNLFEDYIGFLSHTKFLYRNSSSTNGIVPMILRNLMHPGNL
                     KTLHLRTTRTYNDMIYYFCEKFDFASCREIFAQMKIEGAQRNTITYNLMLLSVLKNSH
                     IRKVKPVDNEVIYYLKSMRKNKVQADAVTWTTCYNFLKEDVSRAIFIEQMQLRGVPIT
                     AAFVYTVLRNGTYSSEECLRFLSNNKVPLSFKLFKLCLDRLLEEDRANVAWLFLEHTM
                     MKREMDFRIDSDILNSFLRYFAKKGRFDMAIITFNTCTRDFNIKPDDHTFEMLFKALV
                     TNGYTKNFSLVLKYLKNVRGSFGLGNRNNYWLIKATGISKFNVPKLNAFSDEDLEKLT
                     SQLDNLKWSSTSSGFTVKTWKENGPSFKRALRDIGCVPPMVRASKKPHTVNTTAMQKK
                     SRYRRRIRNIAVQSAMCKRIPLAKDWYGTLKQQLKERNILADELIRYR"
     gene            complement(<1112902..>1113867)
                     /locus_tag="HG536_0B06010"
                     /db_xref="GeneID:59324854"
     mRNA            complement(<1112902..>1113867)
                     /locus_tag="HG536_0B06010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282515.1"
                     /db_xref="GeneID:59324854"
     CDS             complement(1112902..1113867)
                     /locus_tag="HG536_0B06010"
                     /inference="similar to AA sequence:RefSeq:NP_015321.1"
                     /note="ancestral locus Anc_8.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138410.1"
                     /db_xref="GeneID:59324854"
                     /translation="MHRTYSLRSSRAPTASQLASPPPPPSTTKSKFFGKASIATSFRK
                     NAAGNFGPELARKLSQLVTTEKGVLRSMEVVANERRAAARQLSLWGADNDDDVSDVTD
                     KLGVLIYELGELQDQFIDKYDQYRVTLKSIRNIEASVQPSRDRKEKITEEIAHLKYKD
                     PQSTKIPVLEQELVRAEAESLVAEAQLSNITREKMKAAFNYQFDSIRELAEKFALIAG
                     YGKALLELLDDSPVTPGETRPAYDGYDASRQIIMDAEAALESWTLDIAAVKPTLSFHQ
                     TAEDVYEEEEVEEEAEEQEEIGGGDQLASDHEDVAGPDGEHSAAV"
     gene            <1114144..>1115481
                     /locus_tag="HG536_0B06020"
                     /db_xref="GeneID:59324855"
     mRNA            <1114144..>1115481
                     /locus_tag="HG536_0B06020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282516.1"
                     /db_xref="GeneID:59324855"
     CDS             1114144..1115481
                     /locus_tag="HG536_0B06020"
                     /inference="similar to AA sequence:RefSeq:NP_015322.1"
                     /note="ancestral locus Anc_8.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138411.1"
                     /db_xref="GeneID:59324855"
                     /translation="MLSRFDRQVRIWGAPAQTYLERAHVCLVAKSFHDALLQEILKSL
                     ALTGIGEITLLLEDPESAKDLYSADASSFFAVNETLLGEKLVTDISSWKCLDEPLCVY
                     TIIVAVNLERNEELDWLVRRREPLVVASAKDFSGHVELCLKEGHFVIDSLPGYSIPDV
                     RICDAWPELREFYESFDLAQWLSSGRLSEIPYPVILYHMVKDVAKKDLVNTSSKYVRS
                     KIEEQFPNNLDDLNIIEAKRFAHLAIRSFDHCGRMVKFLLNVGPELSRNQWFDPLNHE
                     TAYFLKCLRQYYYRYESLPISGYLPDMESSTELYGRLKCLYRNKHSEDIRCFNDIMSE
                     EGGQPSLPSGAEDVFIRKLRYLEFCPAKPVIYQIPNTGRRPRPLPSVLSRYTEKANEP
                     GGQNEAITFHTSCFIGGVASQEIIKLITHQHVPISEQYRYEQQDKWRSSISGD"
     gene            complement(<1115527..>1117338)
                     /locus_tag="HG536_0B06030"
                     /db_xref="GeneID:59324856"
     mRNA            complement(<1115527..>1117338)
                     /locus_tag="HG536_0B06030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282517.1"
                     /db_xref="GeneID:59324856"
     CDS             complement(1115527..1117338)
                     /locus_tag="HG536_0B06030"
                     /inference="similar to AA sequence:RefSeq:NP_116654.1"
                     /note="ancestral locus Anc_8.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138412.1"
                     /db_xref="GeneID:59324856"
                     /translation="MVESLSWDSLDYPLQPWIQTAIEVMGFQAMTAVQASTIPLFARN
                     KDVVVESVTGSGKTIAFVIPLLEKIISEGANSASFKKGHFHSLVITPTRELSNQIQSV
                     INSFLAHYPDDMPPVKSQLLIGTAQKTVRDNVADFLRDRPQLLVGTPGRVLEFLQAPA
                     VKTSSCSMVVLDEADRLLDADFFKDTESILRTLPKQRRTGLFSATISEAGQQIFKTGL
                     RNPVKVSVNSERRGPTSLGLYYTVVRPEQKLQNLISIFNHYKFRKCLVYFPTCMSVTL
                     FYSFLQYLQKEKKVVEQDLQIFSLYGKLQTASRTKTLDTFTETPSQAVLLTTDVAARG
                     IDIQDVDLVIQLDPPTDTSVFLHRAGRTGRANRTGKAVTFLNEGREEDFIPFLKVKDI
                     HLKSIEIKSEDFSLEGDFYDVFKGWILEDRARFDLSVRSYVAFIRYYSNHSASSIFRL
                     QSLDYVGVARMYGLFRLPRMPEITRYFQDVDIKDGWIVQPPIDMDRYAYKDKKRERAR
                     LEELKNIEKINDKKKLKFELKKKNMAWSNKSQSKEAKAERKANMTLKRKAIEEQIARE
                     EERENSELSKDWKDEVLSRKRKQMKSTNELQGSFDDL"
     gene            <1117728..>1119065
                     /locus_tag="HG536_0B06040"
                     /db_xref="GeneID:59324857"
     mRNA            <1117728..>1119065
                     /locus_tag="HG536_0B06040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282518.1"
                     /db_xref="GeneID:59324857"
     CDS             1117728..1119065
                     /locus_tag="HG536_0B06040"
                     /inference="similar to AA sequence:RefSeq:NP_116655.1"
                     /note="ancestral locus Anc_8.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138413.1"
                     /db_xref="GeneID:59324857"
                     /translation="MFLWKKAVKVLRVGSFRGSNKSVMEDKYADWSKEQLIERLLELE
                     TSEPAGGQKPSPSASTLPNKVKPPKKAKASRKFDFSKYDRRFIALKFAYLGWNYNGLA
                     IQKEPTPQPTIEGVIIEALNKCKLVPSTEPQTFHFSRCGRTDKGVSAMNQVISLYVRS
                     NLNPEEQLDPQNDPREIPYVNILNQLLPDDIRISAVCLRPPKGFDARFSCQYRHYRYL
                     FHKEGLDIQRMGEAASLFLGEHDFRNFCKLDGSKQITNYRRTIMSAKILPISDDFYCF
                     DLIGSAFLWHQVRCMMANLFLVGQNLEEVSLISDMLDVEKTPRKPIYDMASEVPLILY
                     DCKFPNMEWIETNLDDYKAIKYGKAIGALTLGYQLKAEIAQIFKEVLPSSSANLAGKT
                     TINLGNGKGKVITKYEKMSRRNVMEAPETVNEKFKQRKRFKNEAKRTDAVSSS"
     gene            complement(<1119662..>1120381)
                     /locus_tag="HG536_0B06050"
                     /db_xref="GeneID:59324858"
     mRNA            complement(<1119662..>1120381)
                     /locus_tag="HG536_0B06050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282519.1"
                     /db_xref="GeneID:59324858"
     CDS             complement(1119662..1120381)
                     /locus_tag="HG536_0B06050"
                     /inference="similar to AA sequence:RefSeq:NP_015323.1"
                     /note="ancestral locus Anc_8.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138414.1"
                     /db_xref="GeneID:59324858"
                     /translation="MSRFGLAAFDDQQRKEKFEGVGTAVLERQSAELEDQLTVFQERL
                     VKFARKHNREIRANPEFRSKLLRMCAPLGIDPLSLFDKDEHLFNLNDFYYEICVRIIE
                     ICRETKDMNGGIISFNELEEGFFKGLNVTAADLGKSTEMLKSLDGGFELFEIRGKKYL
                     RSVPNELTGDQTKILEICSILGYASISLLKANLNWKAVRSKAVLDEMVANGLLWVDDQ
                     ADAEVLYWDPSWIATKKWHAT"
     gene            <1120549..>1121814
                     /locus_tag="HG536_0B06060"
                     /db_xref="GeneID:59324859"
     mRNA            <1120549..>1121814
                     /locus_tag="HG536_0B06060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282520.1"
                     /db_xref="GeneID:59324859"
     CDS             1120549..1121814
                     /locus_tag="HG536_0B06060"
                     /inference="similar to AA sequence:RefSeq:NP_015324.1"
                     /note="ancestral locus Anc_8.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138415.1"
                     /db_xref="GeneID:59324859"
                     /translation="MIFNPIIGSNKYPYMKITMMNANAVVAGSNDTMSIADFQPAIWT
                     SSSNSALKISLVSDNAIQFSPVFTYPIYGDSEQIYGYQDLVIHLAFDSVTFKPFVNVK
                     YSAKLDEGRDDVEGRLLSFLPKDDVVLKDEAKWVDCFQKEQETYKLPPQDCLIDEYLL
                     DGEAFAVYRTKVTDPSTKELHRRIQIFSLLFIEAASYIDQDDPNWEIFWLFSKDHKQC
                     IGYVTTYKLWHYTGSASFDQPENIKYRARISQFIILPPYQGKGHGSHLYEALFSHWIK
                     DDSVTEVTVEDPNENFDDLRDRKDLQRLYENRFFNQVAKDGEVSQEWIESNRMRYKIE
                     KRQFNRLVEMIMMHNNSPQFRLQVKRRLYIKNYDSLIDMPESERKDALQKSFLLLADD
                     YKRIVAKCKFSKRATESDNQNPCAKKIKG"
     gene            <1122273..>1122881
                     /locus_tag="HG536_0B06070"
                     /db_xref="GeneID:59324860"
     mRNA            <1122273..>1122881
                     /locus_tag="HG536_0B06070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282521.1"
                     /db_xref="GeneID:59324860"
     CDS             1122273..1122881
                     /locus_tag="HG536_0B06070"
                     /inference="similar to AA sequence:RefSeq:NP_116656.1"
                     /note="ancestral locus Anc_8.91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037138416.1"
                     /db_xref="GeneID:59324860"
                     /translation="MSPPKKAKSQNQRREVRPEVFQDSEARNQLADVPKLTEKSSVRK
                     SSRNAVRKEQARVRLYGKKKGKTYDEKDLSLPTLNRAIVPGVNIKKGKKGKKFIDDHD
                     AVKLNRLIKTIGDKFDDIDESKLEKSRRLEEIRELKRQEMERKEADKREVLEDKKKEI
                     KRKASIARTMRRKQKRENGRISQPEHSGLSEKSKPKKRVTFA"
     gene            <1123268..>1124710
                     /locus_tag="HG536_0B06080"
                     /db_xref="GeneID:59324861"
     mRNA            <1123268..>1124710
                     /locus_tag="HG536_0B06080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037282522.1"
                     /db_xref="GeneID:59324861"
     CDS             1123268..1124710
                     /locus_tag="HG536_0B06080"
                     /inference="similar to AA sequence:RefSeq:NP_