GenomeNet

Database: RefSeq
Entry: NC_050733
LinkDB: NC_050733
Original site: NC_050733 
LOCUS       NC_050733             917212 bp    DNA     linear   CON 10-NOV-2020
DEFINITION  Torulaspora globosa chromosome 7, complete sequence.
ACCESSION   NC_050733
VERSION     NC_050733.1
DBLINK      BioProject: PRJNA670758
            BioSample: SAMN14605265
            Assembly: GCF_014133895.1
KEYWORDS    RefSeq.
SOURCE      Torulaspora globosa
  ORGANISM  Torulaspora globosa
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Torulaspora.
REFERENCE   1  (bases 1 to 917212)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     The yeast mating-type switching endonuclease HO is a domesticated
            member of an unorthodox homing genetic element family
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 917212)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (09-NOV-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 917212)
  AUTHORS   Coughlan,A.Y., Lombardi,L., Braun-Galleani,S., Martos,A.R.,
            Galeote,V., Bigey,F., Dequin,S., Byrne,K.P. and Wolfe,K.H.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2020) Conway Institute, University College Dublin
            (UCD), Wolfe Lab, Belfield, Dublin Dulin 4, Ireland
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP059252.
            
            ##Genome-Assembly-Data-START##
            Assembly Method        :: HGAP v. 3
            Genome Representation  :: Full
            Expected Final Version :: Yes
            Genome Coverage        :: 100.0x
            Sequencing Technology  :: PacBio
            ##Genome-Assembly-Data-END##
            
            ##Genome-Annotation-Data-START##
            Annotation Provider :: INSDC submitter
            Annotation Status   :: Full annotation
            Annotation Pipeline :: Eukaryotic Annotation Propagation Pipeline
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..917212
                     /organism="Torulaspora globosa"
                     /mol_type="genomic DNA"
                     /strain="CBS764"
                     /isolation_source="soil, St Thomas, West Indies (strain
                     received from Westerdijk Fungal Biodiversity Institute)"
                     /type_material="type material of Debaryomyces globosus"
                     /db_xref="taxon:48254"
                     /chromosome="7"
                     /country="USA: Saint Thomas, West Indies"
     gene            complement(<4401..>5345)
                     /locus_tag="HG536_0G00100"
                     /db_xref="GeneID:59327395"
     mRNA            complement(<4401..>5345)
                     /locus_tag="HG536_0G00100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284932.1"
                     /db_xref="GeneID:59327395"
     CDS             complement(4401..5345)
                     /locus_tag="HG536_0G00100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140828.1"
                     /db_xref="GeneID:59327395"
                     /translation="MSNSPKIVYGGYPFGLLPHEDSSKIVEVLKKSGIRELDTARIYP
                     GSEKAIGELHLPEQFVIDTKARGFTDGSLTKKGIEESIAESLDLLGVESVEIFYLHCP
                     DRDTEIEEETIDAINELHQQGKFKKFGLSNFPAKDVEQVYNYAKSKGYVLPTVYQGNY
                     NAVARRSESELFPLLRKLNIAFYAYSPIAGGFLARSVDDIKNGEGRFDPNTPVGQIYL
                     KLYSRPALLTALDEWDKLAQKVGTSKARLAYRWVVHNSVLSGKFGDAVIIGGRNADQV
                     TDTAEAISEGPLPANIVSEIDKLWEKIKDEAPLDNYSF"
     gene            complement(<6120..>7262)
                     /locus_tag="HG536_0G00110"
                     /db_xref="GeneID:59327396"
     mRNA            complement(<6120..>7262)
                     /locus_tag="HG536_0G00110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284933.1"
                     /db_xref="GeneID:59327396"
     CDS             complement(6120..7262)
                     /locus_tag="HG536_0G00110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140829.1"
                     /db_xref="GeneID:59327396"
                     /translation="MSELFAPAPEPPTELGRLNLLSKTAGIKVSPLALGAASIGNAWS
                     EYLGSSNKERAFELLDVYYEAGGNFIDTANNYQNEESEAWIGEWMESRKIRDQLVIAT
                     KFTSDYKAYEVGKGRSANFGGNNRRSLHVSVRDSLKKLKTDWIDILYVHWWDHMTSIE
                     ELMDSLHVLVQQGKVLYLGASDMPAWVVSAANYYAVSHGKTPFSVYQGRWNVILRDFE
                     REILPMAKHFGMALVPWDVLGGGRFQTKESIEERKKRGEKLRSFGQPPEQTELEVKIS
                     SALEKVAKEHGTQSVTAIALAYIRSKGTNVFPLVGGKKVEHLKDNIAALSIKLTPEQV
                     SYLESVVPFDIGFPTSLIGQNPAISGELAFLSASCYKLNLDSLQFK"
     gene            <8666..>9886
                     /locus_tag="HG536_0G00120"
                     /db_xref="GeneID:59327397"
     mRNA            <8666..>9886
                     /locus_tag="HG536_0G00120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284934.1"
                     /db_xref="GeneID:59327397"
     CDS             8666..9886
                     /locus_tag="HG536_0G00120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140830.1"
                     /db_xref="GeneID:59327397"
                     /translation="MEFLKTPAGNPLQYMATVYGRGLNYERPPFTFQSNEWEALARNR
                     MSQEALGYVCGNASTGETYQKNREAFKKWSIVPRRLVKTTSYPSLKINLFGREIPSPI
                     ATAPVGVLRIFNPDGEIAVAKAAARERVPYIYSSAAATAMEDVAKANGDGVRWFQLYW
                     PANEHNDITASLLKRAKANGFSALFVTLDTYKLGWRPSDLNNGYNPFLRSDSIGTALG
                     FSDPVFRSHFKAKHGKEVEEDLHSAASEWASMIFPGFSHGWEDIAFLREHWDGPIILK
                     GIQSVQDAKHAVELGIEGIVVSNHGGRQQDGGPASLDCLVKIVKAVRDKIDIIFDSGI
                     RCGADIAKAMAIGAKMVLVGRPYVYGLVLGGEEGVEHVLRSLLGDLTMNLHLAGIPSV
                     PQKDLNVDSLEFSG"
     gene            <11060..>11788
                     /locus_tag="HG536_0G00130"
                     /db_xref="GeneID:59327398"
     mRNA            <11060..>11788
                     /locus_tag="HG536_0G00130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284935.1"
                     /db_xref="GeneID:59327398"
     CDS             11060..11788
                     /locus_tag="HG536_0G00130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140831.1"
                     /db_xref="GeneID:59327398"
                     /translation="MANTRLNEFNQEIGYAIDDWEGRDAPQKVLLTGEFCEVQPINAE
                     KHALQLFESFKVSGNKIWTYVPIGPYESLENYKEFLDQCAQRNDEIHFAIVDKTTGHA
                     VGTIALISVNPLNGSAEAGYVIYSSKLKRTPIATEAQYLLMKYVFDDLKYRRYEWRCD
                     SLNRPSRTAAERLGFKFEGTFRQVVVIKGRNRDTTWLSIIDKEWTLCKQAFERWLSPD
                     NFQDGVQKRSLSDIRKLCQKESAC"
     gene            complement(<11987..>12382)
                     /locus_tag="HG536_0G00140"
                     /db_xref="GeneID:59327399"
     mRNA            complement(<11987..>12382)
                     /locus_tag="HG536_0G00140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284936.1"
                     /db_xref="GeneID:59327399"
     CDS             complement(11987..12382)
                     /locus_tag="HG536_0G00140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140832.1"
                     /db_xref="GeneID:59327399"
                     /translation="MNIISDFKEELIRIKRRLKYEDARIRSNVHRKRTPLPASLSVLP
                     ANRLALTLREEIDYATYTNNMLSEADNIVYSEFYNFECKCSCHGDKKLRTLHEPVFHS
                     AECVQECGESNDEYRHYLSGKIHTVQNSP"
     gene            complement(<12466..>14409)
                     /locus_tag="HG536_0G00150"
                     /db_xref="GeneID:59327400"
     mRNA            complement(<12466..>14409)
                     /locus_tag="HG536_0G00150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284937.1"
                     /db_xref="GeneID:59327400"
     CDS             complement(12466..14409)
                     /locus_tag="HG536_0G00150"
                     /inference="similar to AA sequence:RefSeq:NP_012900.1"
                     /note="ancestral locus Anc_2.669"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140833.1"
                     /db_xref="GeneID:59327400"
                     /translation="MDKANMDWAKDIPCRNVIIYGYCRKEREGCPFKHENSEAESPSA
                     STGMKTLAGSEFAVGSKTGEVGPPPSIPGVTPKFNAKVSASFTPMSAKSGSVAAVSVE
                     PRASAASPSNAHSMNAPAASHLPSLASGASFTPPAFNPYAAETFTPSSSAGTNLNQLA
                     IDDSDSRSLGIRHTAEGSLPVSATAMELDNMAGNPTGTSPSHVALKYPTIYPPPHSLL
                     QYHLYAPDPPPHLKAPLKPNEQTPESLFIPNDLREELVKRNLASLQVFPLGGATPTIV
                     QDYFGLVPLDFNKSTGKKDSFQGHKNSLYKVFSNLDGKVYLLRRIHAVSIVDPTQISG
                     TFQAWSKVASANVVKLVDLFLTTKFGDSSLCAVYDYYPLASSLYDTHFTCFPLIPITQ
                     ELLWTYLVQLTNAIRAIHASGLAVVNLDWDKVIVSGSPGRVKISGCGAVDVLRGQEAF
                     DLLEEQQGDFIKLGTLLKDLASKMSSKKDSSVQDLMVDGDFKSVLQYLLNQDNSKKNV
                     QQLASLFQDRIFDVINSSLAYTEYTEGVLSRELENGRLFRLMCKLNCVYGRMESRIDV
                     SWSESGTKFPITLFYDYVFHQIDTSGKNILDLTHVLRCLNKLDAGVSEKIVLTTPDEM
                     NCIMISYKELRDLIDSTFRSLTQ"
     gene            complement(<16085..>17005)
                     /locus_tag="HG536_0G00170"
                     /db_xref="GeneID:59327401"
     mRNA            complement(<16085..>17005)
                     /locus_tag="HG536_0G00170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284938.1"
                     /db_xref="GeneID:59327401"
     CDS             complement(16085..17005)
                     /locus_tag="HG536_0G00170"
                     /inference="similar to AA sequence:RefSeq:NP_012901.3"
                     /note="ancestral locus Anc_2.667"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140834.1"
                     /db_xref="GeneID:59327401"
                     /translation="MLKNIGSNFKRVRIPLNRPAQSFLTCKPNSSGRIASWLCRGYSN
                     NAEPKTKESGKKTPKPSGKLLLLLGALAVGSTVVSLSYQKTDPAEFLEEAPEEVKKEY
                     KKPKQPAFSPDQVSVVFVLGGPGAGKGTQCAKLVNDYHFVHLSAGDLLRAEREREGSK
                     YGELISHYIKEGLIVPQEVTVALLKQAITENFEKGSTKFLVDGFPRKMDQAITFEQEI
                     VPSKFVLFFDCPEKVMLERLLERGKTSGRDDDNIESIKKRFRTFIETSMPVVEYFDKQ
                     AKVVRVGCDHPVDEVYRNVQTAVEQKVGKN"
     gene            <17182..>18201
                     /locus_tag="HG536_0G00180"
                     /db_xref="GeneID:59327402"
     mRNA            <17182..>18201
                     /locus_tag="HG536_0G00180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284939.1"
                     /db_xref="GeneID:59327402"
     CDS             17182..18201
                     /locus_tag="HG536_0G00180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140835.1"
                     /db_xref="GeneID:59327402"
                     /translation="MNADELVDFLLQDDDLTVEVRYEEPDFPFQIKEPPKGTSAASEK
                     LRRSVKPVFTEVDEILKDLEQLIVRPSTCQAYNTLNGDAWSNTEQEATEINKDVMSRR
                     RHPRKKDRNRHAESSGAKNALEDNVRNRVSKENAESKQENTTSRKPRKSRKRNLERDR
                     NQNETEPFLIPRAGNSLKTSRKNEHKTVTSDKEQVDIKQRSDRDTKEDPRQHQEDYLS
                     KKRSKKKKNRQNAAPESFLSEEVLIEEVTELLEMERTRNEHEGTKKGNAENRTRKSVS
                     RFQAPLEGSKNHSSKKQSKKRITRQKNAEKLNNDGSTQVTAEDPKDDRLQQVGNQQKA
                     LDSKE"
     gene            complement(<18758..>21058)
                     /locus_tag="HG536_0G00190"
                     /db_xref="GeneID:59327403"
     mRNA            complement(<18758..>21058)
                     /locus_tag="HG536_0G00190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284940.1"
                     /db_xref="GeneID:59327403"
     CDS             complement(18758..21058)
                     /locus_tag="HG536_0G00190"
                     /inference="similar to AA sequence:RefSeq:NP_012903.1"
                     /note="ancestral locus Anc_2.665"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140836.1"
                     /db_xref="GeneID:59327403"
                     /translation="MREPEADWQPLDISGGGGSMSSDGTPTQHNSTLAISPFVTGRSS
                     TRINASQSERQRQNSPNEAVERRDGQEWNAEGMAKNSVYQSIANSPLVQKANASITAQ
                     SLATPHHHGGSGGNGVSLLASISKSGLFGSTMPSTLRKVSLQREYRDSGDKQLHGDNE
                     PLATTTLTTTTTSAVDELNQLDIADLSSIERLRLWRHDALMQHLYGTAEFVANKIYTL
                     TGDPNDAFWLAQVYYCSGSYVRAVDLLTKDMLESVSIMCRYLLALCLVTLQKYDEALD
                     VVGESNPFSEAADQDAKKQNDGGVKLESSLCFLRGKIYAAQNSISKAKESFKEALLVD
                     VKNFEAFAELTARNLLTPREEWDLLEALELDFSVLGDNQDMVKNLYMLRLSKYINWEK
                     SSSARKGLIRENNLELNVDIMRYQVEVYHTQCKFLKCLDLCEVILERDEYNPDVLPIY
                     ISCLYELNSKNKLFLLSHRLAENVPKSPITWFSVATYYMVVEKIGEARKYFSKSSILD
                     PNFAPAWLGFAHTYAIEGEQEQAISAYSTAARFFPGIHLPNLFLGMQYMALNTISLAE
                     EYFTLSYDVCPQDPLLLNEMGVMYFRRNDLHKAKKFLKRALEAVEELDPTSKTSVSIQ
                     MNLAHAYRRLGENERAIKCFKAVLEVSNKSSDTYCSLGFLYLKTKQLQKAIDHFHVSL
                     SLCPTNSAAQELLLHALELNVSMTLDTDHPLMVNAQIQESSFTLFQTSKKRAPLTMDI
                     VGLPKKMKIPSQVTDPDDEDNAMEIE"
     gene            <21252..>22442
                     /locus_tag="HG536_0G00200"
                     /db_xref="GeneID:59327404"
     mRNA            <21252..>22442
                     /locus_tag="HG536_0G00200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284941.1"
                     /db_xref="GeneID:59327404"
     CDS             21252..22442
                     /locus_tag="HG536_0G00200"
                     /inference="similar to AA sequence:RefSeq:NP_012300.3"
                     /note="ancestral locus Anc_2.664"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140837.1"
                     /db_xref="GeneID:59327404"
                     /translation="MLNRAAIVLGCCTKTAGHSTDTDVMSVTLHLRAETKPLEARAAL
                     TPKSVKELISKGFKIYVEESSQSAFKSEEYRKAGATIVPEGSWVDAPRDRIIIGLKEM
                     PETDTFPLVHEHIQFAHCFKDQAGWQDVLKRFINGKGTLYDLEFLENDQGRRVAAFGF
                     YAGFAGAALGLRDWAFKQTHADSEDLPAVSPYKDEQALVKDVVKDYQKALKRGARKPK
                     VLIIGALGRCGSGAIDLLHKVGVPDENILKWDIKETSRGGPFKEIAQADIFINCIYLS
                     KPIPPFINYDLLNRDDRRLRTVVDVSADTTNPHNPVPIYNIATVFNKPTVLVPTTAGP
                     KLSVISIDHLPSLLPREASEFFAHDLLPSLEQLPQRNTAPVWVKAKKLFEKHSNRARR
                     SSKL"
     gene            complement(<22527..>23708)
                     /locus_tag="HG536_0G00210"
                     /db_xref="GeneID:59327405"
     mRNA            complement(<22527..>23708)
                     /locus_tag="HG536_0G00210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284942.1"
                     /db_xref="GeneID:59327405"
     CDS             complement(22527..23708)
                     /locus_tag="HG536_0G00210"
                     /inference="similar to AA sequence:RefSeq:NP_012904.3"
                     /note="ancestral locus Anc_2.663"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140838.1"
                     /db_xref="GeneID:59327405"
                     /translation="MMARNQFRIIVGSYEHNILCLSIDLSLSTPVFTPIFHFQAHTLS
                     VKCLDISGRYLVSGSNDENIRIYDLQKRKELGTLLAHQGSITALKFSNRATDNQEETV
                     SVSGKKAPAGKWLLSASEDNHVIVWRVKDWENFGTLKGHTARINDVDIHPSNRIAISV
                     SEDHSIRLWNLMTVKKAAVLKLKNYSQNAQFVRWLGQDGAYFAAALLNKVLIYKTSTA
                     KVHSEIDLGRLSVMHIERTTIDGEDYLAVGLSNGRVNFYTAKSLYEENIKDVQPVFDL
                     LGHTNRIKDFKFYENECGSYLVTIGSDGKVIVWDLNKREQLAVYDAGERLNCLAICDE
                     ATEKYETINKREATIEIDEQSEVEHDVEELKQEMFGKTRKKSNKHKKRKGNKKVSIEM
                     E"
     gene            complement(<23910..>27167)
                     /locus_tag="HG536_0G00220"
                     /db_xref="GeneID:59327406"
     mRNA            complement(<23910..>27167)
                     /locus_tag="HG536_0G00220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284943.1"
                     /db_xref="GeneID:59327406"
     CDS             complement(23910..27167)
                     /locus_tag="HG536_0G00220"
                     /inference="similar to AA sequence:RefSeq:NP_012299.1"
                     /note="ancestral locus Anc_2.662"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140839.1"
                     /db_xref="GeneID:59327406"
                     /translation="MITQLRREQVYHDGGREESATGNCNEEVDMLESDMLNDFLFRSA
                     EGRGNVDGSEKGLGSGRNEDEDAIFDAFINTDSLDGGAGVANGLVLNPRFNAGGDVFQ
                     QPAFSMTSAQLDCRLVGNDGIVSDPNSRSPTPISDSAGYHRQCQETVEKSLVFGRTEP
                     LQTSPVDPTEYVNLDETSLPYKLSVYGLPEVSRVENQIKLTLKIDPSMRPCMVHLPSD
                     CIARQKFYLEKDVKQYPQEFQDQLIYVEAFLLCATSNKTTFVCARCVKREHRRASRRK
                     SGLSDNVLWCNNNNRRAIIFNNKQIFVTKEADRDRSSTEFDLTARIVCYCRHHKSPEG
                     FKILFILKNSTGQVLAKNVTSSIVIMDKKPSNATTESPIIAQCNSNTDSGLDTAGEVF
                     SNANSSDRPATTSASDNGNQEIQFNSGKYFAMTDISPLKMEADLNMRLALPNGPMLSP
                     TSMSEEGSEAQASAVESRRLSHPIGSVSTPAAVARTENYQRKRPRNEGVPDNSLMSRR
                     TWSNSSLSKSVSSSQVISQPSSQVLRTMPDFLSTPNPGQPSIQRVIPAQGPINGGIEI
                     TLLGTKFKDGLLVKFGENIALSTQCWSKTTMVTYLPPASCAGQVFVTVIDPDDNNLVE
                     THPSNKAVFTYVDDTDRQLIELALQIVGLKMNGKLEDARNIAKRIVGNDAGSNSLSPS
                     NISPGNNSATNQSSTHKNIGYSDELLLVKVVKSLHVNSNLSMCDNLGRTLLHLASLKG
                     YSSLCSTLIKNGARVNDKDLYGFTPLHFSCVSGDLRVIRLLAECKADPSIKACNSVTA
                     KQLFIANHKSKIGLNHYFKEVTDLLDDLEATNIFRSNSRKMSDSSFHSSVFENESLCS
                     LDNINAGIKTSGISRDEDRSDYNESDFEEDGDESLLTGDEAEEAADPNVGDNENKKIV
                     KKGRKNGMDKSLLNRMLHYLNDELPKYEDLFPGSHETGEDKIEPAIVETQGSELQAEA
                     ASTTEDFQTSSEDEEDALQQGFNGFFQQRQNFQNDKMLLFFWLPLTIVLLTWYVFYRF
                     GQEDDIVHYFTRMVSEYLRMVLAKILLGNERMKTAFKEQLTMIQNTGILNDFIVT"
     gene            <27543..>28478
                     /locus_tag="HG536_0G00230"
                     /db_xref="GeneID:59327407"
     mRNA            <27543..>28478
                     /locus_tag="HG536_0G00230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284944.1"
                     /db_xref="GeneID:59327407"
     CDS             27543..28478
                     /locus_tag="HG536_0G00230"
                     /inference="similar to AA sequence:RefSeq:NP_012906.3"
                     /note="ancestral locus Anc_2.661"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140840.1"
                     /db_xref="GeneID:59327407"
                     /translation="MKGFEDVQPLPIVTELPDELCQIMYTEEYKQTMGIARALLQKQE
                     YSKRALDLTAKVIGLAPAFYTIWNYRFDIVMHMAEQEEDAARLLNEELDWVDETTLNN
                     PKNYQIWSYKQALLERHPAPNFKRELPVLELMINDDTKNYHVWSFRKWCVLFFQDFSQ
                     ELSYSDLLIQKDVYNNSAWTHRMFVLKHSNPDREQIDLELDYVKEKIELVPQNVSAWA
                     YLQGLYENFLSGSYDAGILQFAQMLTNNVTDSAESPETTLPEIESSYALEFLATVYAK
                     TDATKKKAVKAYQALAAKYDPIREAYWQRQISMLE"
     gene            <28620..>29690
                     /locus_tag="HG536_0G00240"
                     /db_xref="GeneID:59327408"
     mRNA            <28620..>29690
                     /locus_tag="HG536_0G00240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284945.1"
                     /db_xref="GeneID:59327408"
     CDS             28620..29690
                     /locus_tag="HG536_0G00240"
                     /inference="similar to AA sequence:RefSeq:NP_012292.3"
                     /note="ancestral locus Anc_2.660"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140841.1"
                     /db_xref="GeneID:59327408"
                     /translation="MGAEKNADLSRILGNIYIGGIQPISEHVPLNAEYGITHILSVIK
                     FQVIPEYLVRKNYTLKNIGIDDDDSTDILRYINESNKFLDQCLFPNEREYDPAKVDFK
                     RKPQTGAAFIHCQAGVSRSAAFVIAYLMYRYGLVLKTALHAVRRKRPSAYPNENFMEQ
                     LAIYEAMGSNVVDDDFPQYKQWKLANSVKSDPTGTEILSKDDTFKSEEEDLKDMSPES
                     LENVTVARCKKCRQRLALSTSFINHEPPSKESLEGHFIRRAAGSRRIIGIEESQNICS
                     HYFVEPLNWMKEELQGKQELEGKFFCPGCNSKVGGYNWKGSRCSCGKWVVPAIHLRSN
                     KVDKLPLSSQVLSNQSKFVPST"
     gene            complement(<29726..>30670)
                     /locus_tag="HG536_0G00250"
                     /db_xref="GeneID:59327409"
     mRNA            complement(<29726..>30670)
                     /locus_tag="HG536_0G00250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284946.1"
                     /db_xref="GeneID:59327409"
     CDS             complement(29726..30670)
                     /locus_tag="HG536_0G00250"
                     /inference="similar to AA sequence:RefSeq:NP_012291.1"
                     /note="ancestral locus Anc_2.659"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140842.1"
                     /db_xref="GeneID:59327409"
                     /translation="MSDSCQNYVSLGDLPLFRDIKEVLVMEKQQNKTGRPGDGPKMAD
                     KSKSGYNESSPGHHYIPPLSAYNAIEETPYFPSGAKDQRFAFDELTMRTDQAQQRLNS
                     VRTLGWDCIRPIGVKETMKQLQERLKNQENSAKAREPGDMPALSAMQENGAEAIVGFH
                     ELGDEAAAHIDTSIGGQLHAQPEEEDEDLSYDYDAEFARVEEEGDDEAGGELRGVAMS
                     FRANNPLSNRGTERDVTIQQFVETSHVERRPYDSQDEYETSQLNLDPDQGESREFMEV
                     PWVEVSDTVESVGSRRISSLNSVTGHVLGNRRDLGREI"
     gene            complement(<30848..>31150)
                     /locus_tag="HG536_0G00260"
                     /db_xref="GeneID:59327410"
     mRNA            complement(<30848..>31150)
                     /locus_tag="HG536_0G00260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284947.1"
                     /db_xref="GeneID:59327410"
     CDS             complement(30848..31150)
                     /locus_tag="HG536_0G00260"
                     /inference="similar to AA sequence:RefSeq:NP_076899.1"
                     /note="ancestral locus Anc_2.658"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140843.1"
                     /db_xref="GeneID:59327410"
                     /translation="MNIHSLVHFGFDLTLVAMLLAALRQNTGYVFAFELTSGISQYVH
                     RMLGWGEWCYSKFVNYAVGSQYFRKQLRSDGFTTRSAREIEELGRSSRSARNRRVE"
     gene            <31341..>32324
                     /locus_tag="HG536_0G00270"
                     /db_xref="GeneID:59327411"
     mRNA            <31341..>32324
                     /locus_tag="HG536_0G00270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284948.1"
                     /db_xref="GeneID:59327411"
     CDS             31341..32324
                     /locus_tag="HG536_0G00270"
                     /inference="similar to AA sequence:RefSeq:NP_012907.3"
                     /note="ancestral locus Anc_2.657"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140844.1"
                     /db_xref="GeneID:59327411"
                     /translation="MALDISKDNLVKFQAVKSFRVPENEISPITSLSYDDHGQYLLTS
                     SASDNMHLYDAVSCRFLNTIASKKYGCHSAKFTHAQSECVYSSTMKSFDIRHLNLETN
                     QYLRYFTGHGALVSDIQVSPLNDTFLSASYDESVRLWDLRASKSQAIVPSLVPSCIAY
                     DPSGLVFALGNPENNELGLYNLKQLKSGPFLVVKVKPGFTQWNKLEFSNDGKYLLLGS
                     SAGRQIILDAFDGSQLFELTGTKAFPLREFMDSGSACFTPDGRFTLGADYDGRIAVWS
                     HSDSISSKTLKPVGFIPAAPNSCPRTIAFNPKYASFVTADENVDFYVIGDQ"
     gene            complement(<32352..>34364)
                     /locus_tag="HG536_0G00280"
                     /db_xref="GeneID:59327412"
     mRNA            complement(<32352..>34364)
                     /locus_tag="HG536_0G00280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284949.1"
                     /db_xref="GeneID:59327412"
     CDS             complement(32352..34364)
                     /locus_tag="HG536_0G00280"
                     /inference="similar to AA sequence:RefSeq:NP_012908.1"
                     /note="ancestral locus Anc_2.656"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140845.1"
                     /db_xref="GeneID:59327412"
                     /translation="MNKQLSDKFLRCISHEREQDVEVTSRILKGLPLPKLVDAGYAIS
                     NLTMENLRTGLGGKLYLELGPDRAISDEISRGDIKSGDIVLIRPKLSSTAGSKKNRND
                     GKEAQEFECNGVVFKITDSQMVISIDESQEDAASGLSTFTRLFVLKTTNTITYKTMES
                     SMRKLAELDGLASNKIVQYLLNSRPFLQQPPASNVTFNNASLNASQQEAIRFALANDI
                     CIIHGPPGTGKTYTLVELIQQLREKGQRILVCGPSNMAVDTILERLAKVLPGNELLRI
                     GHPARLLDTNLAHSLDLLSRNGSAGEIVQDIRNEINQKIISTKKTKSSKERKQGWNDI
                     KELRKELKRREQKVVVDLILQAKVIVATLHGSNNRALCSLYSHIPRLFDTLIIDEVSQ
                     SLEPQCWIPLVSHYKSDISKLVLAGDNKQLPPTIKTEDDASVQKTLGTTLFDRLVSYY
                     GNTFRKLLKVQYRMNESIMKFPSSAMYDGELIAATLVANKVLSDLPGVDANDDTTVPF
                     IWYDTQGDEFMESTDQEEHIVSSKFNENEGLLVRAHIEKLIQSNVPQEAIGVIAPYSA
                     QVTLLKHLIHNMFPQIEISTVDGFQGREKEVIILSLVRSNSKFEVGFLKEERRLNVAM
                     TRPKKQLCVVGNVETLEKSGQKFLKDWAEFGEENADIRYPDIGDYL"
     gene            complement(<34559..>35083)
                     /locus_tag="HG536_0G00290"
                     /db_xref="GeneID:59327413"
     mRNA            complement(<34559..>35083)
                     /locus_tag="HG536_0G00290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284950.1"
                     /db_xref="GeneID:59327413"
     CDS             complement(34559..35083)
                     /locus_tag="HG536_0G00290"
                     /inference="similar to AA sequence:RefSeq:NP_012909.3"
                     /note="ancestral locus Anc_2.655"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140846.1"
                     /db_xref="GeneID:59327413"
                     /translation="MSLANPASSKLNWAKVISTLKLSGKTAAQLSAFKKRNDEARRQL
                     FELKAQETSVDFEYYRSVLKNSAVVDKIEQSFKSYKPATLDASKQLSTIEAFESQAIS
                     NARETEELVASELKALQETLKNIESARPFDQLTVDELVKARPEIDAKVEEMVKKGKWE
                     VPGYKEKFGDLTVM"
     gene            <35507..>38155
                     /locus_tag="HG536_0G00300"
                     /db_xref="GeneID:59327414"
     mRNA            <35507..>38155
                     /locus_tag="HG536_0G00300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284951.1"
                     /db_xref="GeneID:59327414"
     CDS             35507..38155
                     /locus_tag="HG536_0G00300"
                     /inference="similar to AA sequence:RefSeq:NP_012910.1"
                     /note="ancestral locus Anc_2.654"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140847.1"
                     /db_xref="GeneID:59327414"
                     /translation="MAGDLGTANGERGDEAGATIGSTVARKTPENDRLERNDGSDAEF
                     SAEYCGYGEFEGDEVLGTQINQASRGKRRRRSALACVRCRRRHVKCPGGRPCAKCAAA
                     NIACEYLEPNKKLIVSMKYLQDLQESLAHMKRENVRLQALVTSLQSSGEATVSKGIGG
                     QQDGAPVPPRRVLTPLDLQADGSDIQFSKNTIEKDVQRDLAQSVGGNVEEDEDIVPSF
                     ARGGRLVESRTGQRYFVGPSSMTLFGLEIQSLISKYLPKDTADRTSANRMPLPSKEGH
                     NSLGETYEPVDQVLQEEGNAYRIVLAKNDDNEDLSVNFTLPSYSYAMFLVDTFITYND
                     GCFYFFNEGIVKHGLKIAYEGKPLYDDHTLQTIWFCKVLLVFAIGEMYLGTHNNVNGN
                     KAVLKGSAKLPGSGFFDDASEIFSCLFSSGKVENITKEGGIEVMLLYAFYLQVADCTV
                     ASYFYFGQALKASLIVGMHVDAQRESLTRYELEHRRRLWWTVYMFERMLSCKAGLPLS
                     FMDETISTELPDDFDMSNPPSGSEHYIFPEAEYIINCVKIVQINAQILNKLYQRQPSS
                     NILPTLKHIVKQLLEWRNNLSSFLQVDFRQKDLKISRLCTNMFTEYFQGLNLAIRPLL
                     FHFTSIQLKKYKESQTYINLQNYSSAISALLNCSLQASLNTIRSLWALMDQNMVALFG
                     YMDREYLFTSCCTLVLFNATFGIHENTYEHLDHALEIFTKMRNLGNNPAGLRRAQLLT
                     LVANLDFHGIFKDLIEKHNDSLKPDSQFDAHDYKDINFVSHTSTDTSALSDIINATLS
                     GSVTNLTKSETRIAEENKSQLNPADVIDNGDLQKILDKMNKLSQTDCELWKDISDQAM
                     WLGSAINPCETATSEADLSAYLGRIS"
     gene            complement(<38210..>43297)
                     /locus_tag="HG536_0G00310"
                     /db_xref="GeneID:59327415"
     mRNA            complement(<38210..>43297)
                     /locus_tag="HG536_0G00310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284952.1"
                     /db_xref="GeneID:59327415"
     CDS             complement(38210..43297)
                     /locus_tag="HG536_0G00310"
                     /inference="similar to AA sequence:RefSeq:NP_012911.3"
                     /note="ancestral locus Anc_2.653"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140848.1"
                     /db_xref="GeneID:59327415"
                     /translation="MDRDRQSKLNHAAEKKYAKSSNVNDGVLDNLSNIISTLVDEGDC
                     KDFRPLIVFSQKGFLSQVVQVWSYYAQVNNHPKFSKATTLLETVLRQLNSDPNIQEYG
                     SSLILLILTGNIKVLYRGVNTMRPSIANPILRLMRQMISFNNGQHVEAFVANFDLSLP
                     GLVRILAASKTDAAIVREDSSRSPKSTIRDTFLNFWLELISQSSPLLRKQVISTNSKI
                     MGAWFKVMDKIDTSEMIGHTLDVFTNLILRESSYKRTTKCQILNELAVSKIHTFYYSA
                     DRNLVQKVNDFFLAYGSNPESSVTFPDDAVWFKNSPISGTHRGAEISIHQRDFKIYNK
                     LLFNVLKIFKPWEDDTQLNTVIKILDNVPELVAPYAAFLASLGAHDPKMTSYWFGCTA
                     LLGRIMRLRIPSLVEKVETDMPPHTPLVLESIMPSSLSKSALTKSLQHERLIIRQLAC
                     QLLIFAFQKLQSVLDLYDRKGWTSAKASVRNAFYLSLPDLSILSSAMNQSYESHKKNK
                     ILQLSISTILRHYSTIFPNFFTVRLPSANIFFDIMQSNNISGMDLAILENFLTFQELN
                     GLQTKWWTRSNRELSLFTSLLKVARGSSNSLAERLCQLLDDMFRGTVAFNSKLLCSPH
                     RALIHSIQSIPSISETEILKIWRIIDESIQHVMRVPYKYVDMSANYDCLSPFILALLE
                     QCKYANTDKNFDISQKWVSFYLRTMIICGESEEGIVNAANCYLSDACQEYIKRYLGDS
                     SAIEESAEEEQFRDSIIQNSFCDLVILEKYPHLKKITRYPVSKLDAAGLLFRIRKLAK
                     DLAVEYDGYFKSTSRALISMLADYADADRSFTFLSSSVLMSFLRLITEPSSSEAMKLK
                     NRYVIRLMLQACQEVRSNYSELKSTIYDWLQSKDEMLQETYSNEENVLFMSAALSFLG
                     SDDCAKILLHKKQLSFISTQLLAKVILESNNSCIPFSIIMLLVKEASPESHRIASQFI
                     AQKRVKDLRAGELLQEILSDDLYSGVTQAFISSDYFSADQISACLQSVRGEQNTLLVA
                     LALHQFRQEEIREYVTKVLRSSRSLIGSDNSSVSQLALELVYQCPDSFSANEKKQLVE
                     YVTNEYKDKYCAAVVKCVVTMSDFEEKDVVKWLNKLVLYITKCFSTAAMVDSQLLGTL
                     DELKKLKDTVWQSVNKNILNSHQEVILSGSLVNQEKVLEYALRVLLAVGPGSTWNERL
                     MQCLVNNESKKLTNNENENYVPFLTASILYILYLGDRERNSNAAIQEALLSCYEGTIS
                     AKDRLILKTLELIEAQTSHSWTNLIYDWELIDDTEEDVNQGYVELIAKRKEGLIITLK
                     RQTIAKSATNYKFDRPRVPSLEGSKSNLSWKVMVSFYQSVEKDKPTSSFYDLYDPLFL
                     LLLSGQNEELVKSSKSESGGLEYKFDVKAFLTSNIFQVVICSLGDETEVQSIALTLIE
                     GMLSTLQKDDYLKDMRIFKILLSKIVYTFMKSKTAGNEYTNSIAPCVWFAISQLATEL
                     AQPTSQLHDKAVRWVLSRPLVRPIDLPLYQELFHSKEIGNTDQNIYYKQLGWVLNILQ
                     LGLKTEQDVELMKRIGVLEWLSNLLSMPYINGRMRSAVSAIFYACQRLGNSGSSLVTR
                     AASIATFELQKVSLERKVNSAELEVMKNPKNSRHLQKFLSLQQQNLNCLEILSSHAIL
                     AGSNKRLREWTENDAYNIEKRVKLPKG"
     gene            <43537..>44226
                     /locus_tag="HG536_0G00320"
                     /db_xref="GeneID:59327416"
     mRNA            <43537..>44226
                     /locus_tag="HG536_0G00320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284953.1"
                     /db_xref="GeneID:59327416"
     CDS             43537..44226
                     /locus_tag="HG536_0G00320"
                     /inference="similar to AA sequence:RefSeq:NP_012290.1"
                     /note="ancestral locus Anc_2.652"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140849.1"
                     /db_xref="GeneID:59327416"
                     /translation="MFRRSLSLGFAACRHYSHAAAKTGSKKSGFDKSMLKPALAVIVF
                     ASMLSHVSNQQNVNAELDRRYELKIGILEKLIERAKHGDRDFDPHEELKLVNKLFARF
                     SSSKGIDLEDEAAKVRKYSDARPYSEEMIINSLNGSAKQVEEESLEEVLKSLMNEVDG
                     KGTMTQPSPPESSFHEKGEVVLNKKLLDELARKEAELLNYSPSTDAHTLVENPGELTA
                     AAKDTEVPKFL"
     gene            complement(<44348..>47557)
                     /locus_tag="HG536_0G00330"
                     /db_xref="GeneID:59327417"
     mRNA            complement(<44348..>47557)
                     /locus_tag="HG536_0G00330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284954.1"
                     /db_xref="GeneID:59327417"
     CDS             complement(44348..47557)
                     /locus_tag="HG536_0G00330"
                     /inference="similar to AA sequence:RefSeq:NP_012289.3"
                     /note="ancestral locus Anc_2.651"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140850.1"
                     /db_xref="GeneID:59327417"
                     /translation="MSVDSKNSPKETGCDESQVNNGGDSAVADGQKDREVKTGSTAAR
                     SSNPRANNNFEMLSFNDNYAAILQNLTNDNGQSASLSNISAKNALMSILSDANEANVR
                     QKEDERPAGAELGHGSKNGPNRAGIDRNNLDALLQHYQGLLSKSENTNNQTGEQTPSN
                     SVPDTARNSQGLDSQVNPTYPIAGEKPCDHCRRRQAKCVVAPNQPGCIKCEAKGIKCT
                     FSELPNNANKFNMTDSGSARVKHPRSDEYANGNIITKKARLNSGENVLQQYSELLQQY
                     NEPSANPNQYVNVGNTSSPQIPSVPNLINSLQTNPRDIQLPRPSPPPQHQFPRSSFYV
                     GSTSVYDVNLVNHVKLDHIDQIQLSPTVALRKVAPNAQFILRDNFNQKLYIKQEQEID
                     LVERMIYPHGRILVDIFFKFVHPYFPILHEKVFLEKYSRSYRELTAPLLASIYSLALQ
                     RWDFHPKLIGFPKPDVTEQLNEIAYRTFFDMIERPKLSMVQTGLLILRCRSECANNWV
                     INCAVVALAEELGLNVDCQDWRLPKWERGLRRRLAWAVWTQDKWTALNESRHSHLILG
                     RNWLVKMLKEEDFPAESPFIGSTAQDENNYNASNPLGNIFLYDMSLTNEDYRDGTLMF
                     KQLVSLSVIVGEIMETFYTEGATHVAPKIEQVLKLAKPLQLKLREWYHSLPAKLSMNN
                     FIPRKLNANATLTLAYFAAEITLHRTIISTLTQDTPKELVQVCRTAAKTRLVAAIEFV
                     RDLKNEHINAFWYSSSTGNLMLIATFASLLYVTSRTKDEAIIFRDCLRNYIWVLRIGS
                     KSFDKSANALKGIHILLAQIPGLLTDEDPKEFMPPTSQPSTLSGQQWKMTTEQSPPDF
                     SQLRNLPHDLLQSLSSTQGSTPNVPNTQLTHRSSSPACYNPSKSEVNPLSFKNKDNGE
                     TERNMTELKNNATTLSQLSPHALPRKRANSSGAVSNHSPDRAEDKRNSHNQGRSIPRV
                     NSANNHNESNPITPQSVGNTVKESSPASRDSSSDNTDETANKPSTISPSSIQDKQQQT
                     NALDTQRAYEHQKTFSHNNDVASPEGCERTTNGTQDESD"
     gene            complement(<47746..>48261)
                     /locus_tag="HG536_0G00340"
                     /db_xref="GeneID:59327418"
     mRNA            complement(<47746..>48261)
                     /locus_tag="HG536_0G00340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284955.1"
                     /db_xref="GeneID:59327418"
     CDS             complement(47746..48261)
                     /locus_tag="HG536_0G00340"
                     /inference="similar to AA sequence:RefSeq:NP_012912.1"
                     /note="ancestral locus Anc_2.650"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140851.1"
                     /db_xref="GeneID:59327418"
                     /translation="MSQSLRPYLTAVRYSLEAALTLSNFSSQEVERHNRPEVEVPNTS
                     AELLLQPMHISRNENEQVLIEPSVNSVRVSIKVKQADEIEHILVHKFTRFLEQRAESF
                     YVLRRVPIPGYSISFLITNKHTESMKTGKLVDFIIEFMEEVDKEISEIKLFLNARARF
                     VAEAYLGEFVY"
     gene            <48478..>50184
                     /locus_tag="HG536_0G00350"
                     /db_xref="GeneID:59327419"
     mRNA            <48478..>50184
                     /locus_tag="HG536_0G00350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284956.1"
                     /db_xref="GeneID:59327419"
     CDS             48478..50184
                     /locus_tag="HG536_0G00350"
                     /inference="similar to AA sequence:RefSeq:NP_012913.3"
                     /note="ancestral locus Anc_2.649"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140852.1"
                     /db_xref="GeneID:59327419"
                     /translation="MSAAADWREAKDANGRIYYYNARSGESRWEKPQEMLSEQELELL
                     KHGWKSSRTADGKLYYYNVKTKESRWDAPTFEAEENLEETKQEAEVAKSTEVHEEREK
                     YANASKILNPPQRTKEEAEGEFIKMLQENQVDSTWSFGKIISELGASDPRYWMVDDDP
                     LWKQQIFEKYLSNRSEHQLLRERAETSKFKSAFWEMLRSKKEIRYYTRWLTAKRLIAN
                     ETIYKHSVVRESVKKATFLEYVDSLAREREEEHSQTKKQALKELEEYLRGIMSSSDAP
                     VNGSQLPVVSWQHLLDNYLFEKNKRFVANKHFKVLSHEDVLNVYLQLVHEVEDSMKED
                     LRRLQSKNYTKDRLARDRFKELLRSSDLHIRADSKWKDVYPAFKNDPKFLRMLGTSGS
                     SALDLFMDVVEEKSITMSANRSIAQNLLIEKGFEWSDEDETDKSLIKELLSKEPHFQA
                     MDVDDIDSTIRLLINFRKEKQKEQLEVQSRIWEQKKNYFRLMLKRFYRGANVRPDSWE
                     AAREDLKNTVEYKELGDQDDVKRALFDEFKKAPSEDDLRVNAAPQASMKRPLSSRVEL
                     DY"
     gene            complement(<50229..>50735)
                     /locus_tag="HG536_0G00360"
                     /db_xref="GeneID:59327420"
     mRNA            complement(<50229..>50735)
                     /locus_tag="HG536_0G00360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284957.1"
                     /db_xref="GeneID:59327420"
     CDS             complement(50229..50735)
                     /locus_tag="HG536_0G00360"
                     /inference="similar to AA sequence:RefSeq:NP_012288.1"
                     /note="ancestral locus Anc_2.648"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140853.1"
                     /db_xref="GeneID:59327420"
                     /translation="MNIRLELSRFLKLCFVLSSAFMFWKGLSIVTNSHSPIVVVLSGS
                     MEPAFQRGDVLFLWNRNEMSKIGDIVIYEVEGKSIPIVHRVLREHHSENKKKQLLLTK
                     GDNNAGNDIPLYANRKLYIQKEKDIVGTVKGYVPQLGYITIWISENKYAKFAMIGFLG
                     LSALLGND"
     gene            complement(<50943..>52070)
                     /locus_tag="HG536_0G00370"
                     /db_xref="GeneID:59327421"
     mRNA            complement(<50943..>52070)
                     /locus_tag="HG536_0G00370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284958.1"
                     /db_xref="GeneID:59327421"
     CDS             complement(50943..52070)
                     /locus_tag="HG536_0G00370"
                     /inference="similar to AA sequence:RefSeq:NP_012287.3"
                     /note="ancestral locus Anc_2.647"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140854.1"
                     /db_xref="GeneID:59327421"
                     /translation="MVQRSLLQRNALEAVDLYCRKANARTLKRLALFIGAAQGTNKST
                     SRENILFQAAFLEELRKRKEQNNVVSVLAIDAGIANFAFARFSWASDQKLPLLLDWNK
                     IQLKEKFMPENRYTMTLNPRDTSDVIYNLTEYLTTELPVPDAFTIERQRARSMSSKTI
                     LEPILKVNILEQVLFSNLENKIRFNQGLPKLNYMVASSDPQRMTSYWCSLTPTRKALS
                     QNFPEDSEESKLKMNSNRLSKSIKINLVKRLLEGAVGLTDEKLITLTPDWSQRLKSHI
                     LGNRKFKLWDCAGLGPKAGARKDDDLADAFLHGLAWMEWLRAYEEVRNIVLKEKGKYD
                     QNVLADFNEYCKKKKVALEKFQEGTSNRLTELEPPEEDDYE"
     gene            <52239..>53168
                     /locus_tag="HG536_0G00380"
                     /db_xref="GeneID:59327422"
     mRNA            <52239..>53168
                     /locus_tag="HG536_0G00380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284959.1"
                     /db_xref="GeneID:59327422"
     CDS             52239..53168
                     /locus_tag="HG536_0G00380"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140855.1"
                     /db_xref="GeneID:59327422"
                     /translation="MADRQKSTADYDDDHFRPARRKQHLRRSKGDRPSTGRRTLKQAF
                     RDYRAKRKSAGSPVEGHYSIRRWKNRSRRVVKNPDGEATFHQTAKEEPSQVLPGICQV
                     SQPILPPKIHYREQASTESLLLEAEEPMPRLGEPRFVPLLFDQPAAGTSRSKSAPVNS
                     LEGRIELASFHVASLPREFPPAQAETELFPLNNGGHRQQIQVTDVTTTSISRTASTVS
                     TKLTTEPKAGTDSAGNGVMKRLGASFSSFFSFAIPKKVSSQHIYDSGENSRGLSSPFF
                     KSKHSIEKGFTPPRGSIDYVDYSIYGNHAKYFI"
     gene            <53521..>55047
                     /locus_tag="HG536_0G00390"
                     /db_xref="GeneID:59327423"
     mRNA            <53521..>55047
                     /locus_tag="HG536_0G00390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284960.1"
                     /db_xref="GeneID:59327423"
     CDS             53521..55047
                     /locus_tag="HG536_0G00390"
                     /inference="similar to AA sequence:RefSeq:NP_012835.1"
                     /note="ancestral locus Anc_2.646"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140856.1"
                     /db_xref="GeneID:59327423"
                     /translation="MSEEKRLEAPARSGTSTVNAGGEDIKKPVSILNNWRNAKPTVRK
                     EQDNRPVYYKTQLAHASNEDLEEASRPAKSELSSDSSSSIPRYSSFDKYKGLNGNGRS
                     SQKLKVLTDTPVDSSPQKSSSASSNTAVSFTVSNGAKISHHRYSISAKPGRSSLSNSP
                     NASTDQLVVKAESPSEEKNSIVHMPGDFIYFEPRVKSHNAGNHENAVDASPQIPRKEV
                     IKPLTGPQVPFMEFFQKQDDKKFHILLGATGSVATIKVPLIIDKLFKIYTREKVSIQL
                     IVTKPAEHFLKGLKISTDVKIWREEDEWSGFRKLGDPVLHHELRRWADIFLIAPLSAN
                     SLAKIANGMCDNLLTSILRDWTPSTPVLVAPAMNTFMYINPMTKTHLKILQEDAPFIT
                     VLKPVEKVLICGDIGMGGMREWNDIVEILRRRIAELCKANENDVDDGEDDEEEEDEED
                     EEEEDDRDSNRPNADRDGDEDEDDDEDDEDDDDDDDEDEDEYEDDGEKADDTMGSRKT
                     "
     gene            <55361..>55645
                     /locus_tag="HG536_0G00400"
                     /db_xref="GeneID:59327424"
     mRNA            <55361..>55645
                     /locus_tag="HG536_0G00400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284961.1"
                     /db_xref="GeneID:59327424"
     CDS             55361..55645
                     /locus_tag="HG536_0G00400"
                     /inference="similar to AA sequence:RefSeq:NP_011869.1"
                     /note="ancestral locus Anc_2.645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140857.1"
                     /db_xref="GeneID:59327424"
                     /translation="MSFLGFGGNAQPQLSSQQKIQAAEAELDLVTDMFNKLVDNCHKK
                     CITAAYSEGELNKNESNCLDRCVAKYFETNVKVGEHMQQMGQHFNAAGRV"
     gene            complement(<55738..>56478)
                     /locus_tag="HG536_0G00410"
                     /db_xref="GeneID:59327425"
     mRNA            complement(<55738..>56478)
                     /locus_tag="HG536_0G00410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284962.1"
                     /db_xref="GeneID:59327425"
     CDS             complement(55738..56478)
                     /locus_tag="HG536_0G00410"
                     /inference="similar to AA sequence:RefSeq:NP_012836.1"
                     /note="ancestral locus Anc_2.644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140858.1"
                     /db_xref="GeneID:59327425"
                     /translation="MSTEVESVVSMADPQDEEGSKCPVDHEARQVWLKQAEEADAGKE
                     KCPVDHSARSVWLKHASSAAEDVECSSDELPEKPVYHTSVKLPEEREISSIPRTGTGA
                     NWVYPSEKQFFEAMLRKKWDPSSDDMKTVVPLHNSVNERVWNSIRLWEKDQGGEACGG
                     IQLTSFKGDARKLTPRAWFRSALLGYSKPFDRHDWTVDRCGKTIDYVIDFYHEDSETL
                     GPNIYLDVRPKLNSFEGVRLRVCKSLGL"
     gene            <56882..>58228
                     /locus_tag="HG536_0G00420"
                     /db_xref="GeneID:59327426"
     mRNA            <56882..>58228
                     /locus_tag="HG536_0G00420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284963.1"
                     /db_xref="GeneID:59327426"
     CDS             56882..58228
                     /locus_tag="HG536_0G00420"
                     /inference="similar to AA sequence:RefSeq:NP_011868.1"
                     /note="ancestral locus Anc_2.643"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140859.1"
                     /db_xref="GeneID:59327426"
                     /translation="MGCAASSNLAEDENDPFLQGQRANDSIERSMQLEKQKSRNEIKL
                     LLLGAGESGKSTVLKQLRLLHKGGFTHQERLQYTQVIWADAIQSMKILVIQARKLGIA
                     LDCDDPMRHPELFECKRVLLKAKALEFIDAGVAGGSEFLSDYVLKYSERYETKRRVQS
                     TGVARAFDPEDAVRPAGSTLDLREISKNLEDGTADGQMFIKEQQPQPQRECSNEEIAQ
                     AMKQLWTRDRGIRQCYARSNEFQLEGSAGYYFDHLDNFARPDYVCSDEDILKGRIKTT
                     GITESEFTIGSSKFRVLDAGGQRSERKKWIHCFEGITAVLFVLAMSEYDQMLFEDERV
                     NRMHESIMLFDTLVNSKWFRDTPFILFLNKMDIFEEKVKRMPIRKYFPDFQGRVGDVE
                     AGIQYFENIFLSLNRNSNKPIYVKRTCATDTQTMKFVLTAVTDLITQQNLKKSGII"
     gene            <58369..>58710
                     /locus_tag="HG536_0G00430"
                     /db_xref="GeneID:59327427"
     mRNA            <58369..>58710
                     /locus_tag="HG536_0G00430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284964.1"
                     /db_xref="GeneID:59327427"
     CDS             58369..58710
                     /locus_tag="HG536_0G00430"
                     /inference="similar to AA sequence:RefSeq:NP_012837.1"
                     /note="ancestral locus Anc_2.642"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140860.1"
                     /db_xref="GeneID:59327427"
                     /translation="MSLQTQNLHKVSEIPLSQIKRPIAPVLDEPKIDSMETTLKTNAE
                     LPPVDVLQMKNSKGSVVNFAFGGCHRLQAYDRLARATNGDPLVRCKILPATRQQLELY
                     LGSSLAVIDDE"
     gene            <58868..>59875
                     /locus_tag="HG536_0G00440"
                     /db_xref="GeneID:59327428"
     mRNA            <58868..>59875
                     /locus_tag="HG536_0G00440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284965.1"
                     /db_xref="GeneID:59327428"
     CDS             58868..59875
                     /locus_tag="HG536_0G00440"
                     /inference="similar to AA sequence:RefSeq:NP_012838.1"
                     /note="ancestral locus Anc_2.641"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140861.1"
                     /db_xref="GeneID:59327428"
                     /translation="MFNRVARRAFSTTRVNPYKVTVLGAGGGIGQPLSLLLKLNHKVT
                     DLRLYDLRGAKGVAADLSHIPTNSVVRGFAPEEPDALHSALEGADVVLIPAGVPRKPG
                     MTRDDLFAINAGIVHDLASAAAEEAPKAAILVISNPVNSTVPIVAQVFKAKGVYDARK
                     LFGVTTLDSIRASRFISEVAGTDPTREHVNVVGGHSGITIIPLLSQTRHHELTREQRD
                     ALVHRIQFGGDEVVKAKNGAGSATLSMAQAGAKFANAVLCGLAGERDVIEPAYVDSPL
                     YKSEGIEFFASPVTLGPQGVEKVHSIGEISSEEEELLAKCNETLKKNIAKGVAFAEQK
                     K"
     gene            <60031..>60375
                     /locus_tag="HG536_0G00450"
                     /db_xref="GeneID:59327429"
     mRNA            <60031..>60375
                     /locus_tag="HG536_0G00450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284966.1"
                     /db_xref="GeneID:59327429"
     CDS             60031..60375
                     /locus_tag="HG536_0G00450"
                     /inference="similar to AA sequence:RefSeq:NP_012839.1"
                     /note="ancestral locus Anc_2.640"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140862.1"
                     /db_xref="GeneID:59327429"
                     /translation="MGIQVHGQLIDDQSRCVHWHSVLDVVALRFKCCDRYYACFSCHE
                     EDLESRGHSVRRYHVKRDRLAKVVLCGVCQLEMTFDEYVGAGDLRCPSCGVQFNPGCK
                     LHYSLYFDGIDI"
     gene            complement(<60398..>61486)
                     /locus_tag="HG536_0G00460"
                     /db_xref="GeneID:59327430"
     mRNA            complement(<60398..>61486)
                     /locus_tag="HG536_0G00460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284967.1"
                     /db_xref="GeneID:59327430"
     CDS             complement(60398..61486)
                     /locus_tag="HG536_0G00460"
                     /inference="similar to AA sequence:RefSeq:NP_013784.1"
                     /note="ancestral locus Anc_2.639"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140863.1"
                     /db_xref="GeneID:59327430"
                     /translation="MLGDPSVRLREAVIEGNLLIVKRLLRRFPEYLTNVDPSNGWSSL
                     HYASYNGRYLVCVYLIQLGHDKQELMTTFKGNTCVHLALMNGHEQTTHLLLQHFPRFI
                     DRPGEHGRTPVHIACMRDHYQCLGLLMGVGAKLNVQDDGGDTPLHICLQYGSISCMRI
                     LVFDGRIVGDNVKNNYDLRPSDVAETFDLAKVYAKMLKDAQVPGVLGKPSYSSFRTPV
                     LASKGVFDDGPSPVLTMNSPYSLYSQPAPTPQLPRIPPSRRPSTTRSNKSPGAGAPLP
                     SRLASKDSSLSASSSSLHRKPTNITRSSAEASPSKNEDAPAPDDNASDANPEASASPL
                     AGSPRNEPRRRVSLLNIPITKLRLQGSQ"
     gene            <61629..>62933
                     /locus_tag="HG536_0G00470"
                     /db_xref="GeneID:59327431"
     mRNA            <61629..>62933
                     /locus_tag="HG536_0G00470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284968.1"
                     /db_xref="GeneID:59327431"
     CDS             61629..62933
                     /locus_tag="HG536_0G00470"
                     /inference="similar to AA sequence:RefSeq:NP_013783.1"
                     /note="ancestral locus Anc_2.638"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140864.1"
                     /db_xref="GeneID:59327431"
                     /translation="MATVSVNYKFSSFRVKVTPNTVMNDVLSESLSHFRLIESESSKP
                     KTQWILEHDKKPVTLDLPWRFLNLSPGVKLELKEGDPTVTANKIASVRIKLQVMGHPT
                     VIETIRSTADLRDVLDILASKHGWSINLLESKLQVVSKTIPYAELRGLHLADLGVKDS
                     VLLRLITKAPSEPTQLPPTDKQSTAEENVDDRTPVPETEENVDDRTPVLDTEEPAGKK
                     QSLHKVSAFVPPETSITSKVHNEVENDDDYEMTVDEARAYQKMLSKQRGNLGGPLLSK
                     RLRQAREEVHKRAVTECVVRIRFPDLNHIEVTFRPDENMDTVYKVVSESILPEHSEFT
                     LSQPHPYITYPRDERKLVDDLAFGSKTLLVFKSDKEGPYLSNAVLEQAKQLGEADDIR
                     LDQINHRADTNGVGLKTKTKSKPSWQASKMENVPKWLRLNKK"
     gene            complement(<62962..>65595)
                     /locus_tag="HG536_0G00480"
                     /db_xref="GeneID:59327432"
     mRNA            complement(<62962..>65595)
                     /locus_tag="HG536_0G00480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284969.1"
                     /db_xref="GeneID:59327432"
     CDS             complement(62962..65595)
                     /locus_tag="HG536_0G00480"
                     /inference="similar to AA sequence:RefSeq:NP_013782.1"
                     /note="ancestral locus Anc_2.637"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140865.1"
                     /db_xref="GeneID:59327432"
                     /translation="MMRSTHLALRSLLRTNVRFYRKRGPSTSHITALKSKKLLRDERS
                     SNLNGNGLNEMQKGLRGLEFEELDVEKSLEDVMLGYFERASSTFKRSSSNFKSLKKQL
                     TAEGVTDDDKANVLFSYLLQEASLEIKRFETMNKEQLRALRETRRDDMLHERVDSEKE
                     LEAGLVSSLFMPSSENETYLMSLDLIYEILTDLNNKKKPIGSKVLSIEQLVEAFELAK
                     IVPIEGRRKRGIFLAGNLIYARGNVRMDPVNESFYIESLVNYGLYRKAYNLFETNREK
                     VDERWWYEMGMMVALRANYLQKFERLLAMLDEKFPGYPYVSPRILKLAIKKKLFLRDL
                     GSANALTTRLLDIVTTFGLNSSQDRAQKTVDFASEDEADMYLNERELPTSYDLLTVAD
                     YHLFRKNFNTAYKVMATYLDKVGNSELGYQYFVVRMKLNLLRDIKSLKSSLQTHMSPE
                     IADFCLEKLQNTFDRIVKEANVDNSMCQDLLFDSIDSLVKDPLLTKTVEGLIVSSLRD
                     KDLLSPSKSFHSVLKLLLASGREADAMKVLSSMEQASKQCGQHKAGSNEHFFSEANAH
                     HYAEFIEYYALQAVRRRKQREAYQKKVSQILDRMSSLGVPYNSVFLSKLLMFYRQSDD
                     FENSFTLINRILEEKRVQSNPPDADRTSFYNRRDITRGLYAEIWKLCSSYYYVFAREL
                     HTVEMKSNYGVWKENASKIVKATKVHPNFSIRTLFRTMVNDDNILPDERMYFTILVTF
                     MKKRDWQAIPGILAAMIEVHGLSFPKNLSDYLRKGLDREHIMLERRQLKGRATLDQLT
                     GAEPGFSDQLPKNNFGPEGTVKEINNYSKLIEDILLLQKQKYPDDKNFFLVSEALEEL
                     QFSPSNMQELIDNVHSRDSVI"
     gene            complement(<65801..>67057)
                     /locus_tag="HG536_0G00490"
                     /db_xref="GeneID:59327433"
     mRNA            complement(<65801..>67057)
                     /locus_tag="HG536_0G00490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284970.1"
                     /db_xref="GeneID:59327433"
     CDS             complement(65801..67057)
                     /locus_tag="HG536_0G00490"
                     /inference="similar to AA sequence:RefSeq:NP_012841.1"
                     /note="ancestral locus Anc_2.636"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140866.1"
                     /db_xref="GeneID:59327433"
                     /translation="MSNTLEERLRSNSNAFEGLLALIPAKYYYDDKTQEQWKAKKKSK
                     SQAREDKVKKLDPDQMDDETLSSLEVMKKRENNAKPVSLPGEKFKLKEAAAAIEGAGE
                     SSTPERDSAEEDGKIGVIFDDEGNEVAPEAPAGEEPQKDAKKQPEGGSKKNLDALRSK
                     LQAKIQELKEKRKAPGTKVKGAPSSREAILAERKRKLENKNRRQRQQQDEEEPNGSDN
                     SDSDDDGDSDNQMDGESDRKRHKAADDNIASQVMFQNIIFDDGDAVASNLQNLRRTAK
                     KKGPANNDVRAHLKLVEAKKQKLESKDELEQIKLKEKSKWQRATLQAEGVKLKDDEKL
                     LRKALKRKEAKKRKSALEWKERQKSVASTIAEKQKRREENLKIRRENKGVKRSKQQKM
                     KRKFTGTAGSKKRAGFEGRLKSGKKK"
     gene            <67517..>68976
                     /locus_tag="HG536_0G00500"
                     /db_xref="GeneID:59327434"
     mRNA            join(<67517..67721,67946..>68976)
                     /locus_tag="HG536_0G00500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284971.1"
                     /db_xref="GeneID:59327434"
     CDS             join(67517..67721,67946..68976)
                     /locus_tag="HG536_0G00500"
                     /inference="similar to AA sequence:RefSeq:NP_012842.1"
                     /note="ancestral locus Anc_2.635"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140867.1"
                     /db_xref="GeneID:59327434"
                     /translation="MSVGTLYACRSPRVRLVKALIKYLKLDIEIVNAAESAQFAELFP
                     LKKMPAFVDAKGYKLTETIAIAYYFVSLASDEKAKTTLLGGSAKEKADILRWASVANQ
                     EVSSAFMNPLFVLLGRQPYNKKVVESSLAELDLLAQFFEQRLREFTYLAAERITLGDL
                     VGAVAWALPLGMICGPEFRERHPYLTRWFNTVLASPIFKEEYSDFKFAEKTIEAPKKP
                     KAEKPKKDAEPAKPAAKKEEPEDAEPAAPKKPKHPLEALGKSTFVLDEWKRKYSNEDT
                     RSVALPWFWEHYNPEEYSIWKVDYKYNDELTLTFMSNNLVGGFFNRLSASTKYMFGCL
                     VVYGENNNNGITGAMMIRGQDNVPAFDVAPDWESYSYTKLDPSNEQDKEFINNMWAWD
                     KPVIANGESREIVDGKVLK"
     gene            <69175..>70353
                     /locus_tag="HG536_0G00510"
                     /db_xref="GeneID:59327435"
     mRNA            <69175..>70353
                     /locus_tag="HG536_0G00510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284972.1"
                     /db_xref="GeneID:59327435"
     CDS             69175..70353
                     /locus_tag="HG536_0G00510"
                     /inference="similar to AA sequence:RefSeq:NP_012843.1"
                     /note="ancestral locus Anc_2.634"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140868.1"
                     /db_xref="GeneID:59327435"
                     /translation="MSTALYTANDFILLSLPEKTKPANSPNSSADAWLQEGLIGGRAF
                     VSDFKIPEFKIGSLDSLIVESEELAKYDSQIGGSIAKIVEILGGLSQANTNAYRTVPI
                     NNVPVPEYLENFQWQTRKFKLDSSIKELMELISSEAAQLDADVRATYANYNNAKTSLA
                     AAERKKTGDLSVKSLHDVVKPEDFIMNSEYLTTLLIAVPKSLKSDFEKSYETLANNVV
                     PGSAGIISQDSEYILYNVHLFKKSVQEFSAKARERKFIPREFNYSEELIDQLKREHDS
                     AASLEQSLRVQLVRLAKTAYADCFINWFHIKALRVYVESVLRYGLPPHFNTKIIAVPP
                     KNLSKCKAELIEAFGFLSGNAFTRDKQGKIVKQDSSLHQYAQLVDTEYEPFVIYVINL
                     "
     gene            <70616..>72532
                     /locus_tag="HG536_0G00520"
                     /db_xref="GeneID:59327436"
     mRNA            <70616..>72532
                     /locus_tag="HG536_0G00520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284973.1"
                     /db_xref="GeneID:59327436"
     CDS             70616..72532
                     /locus_tag="HG536_0G00520"
                     /inference="similar to AA sequence:RefSeq:NP_012844.1"
                     /note="ancestral locus Anc_2.633"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140869.1"
                     /db_xref="GeneID:59327436"
                     /translation="MLWSPDSVIAADIPSIAGLHRDSAIKVFLKLKPAQDEMSQLRYK
                     VKDSQTIVLEGPRRSEPIQGQDLELFVFDGIEDIETETIEVSNSIVNDSVKELLDGYN
                     VAIMAYGQNESGKTHAMLGRDGNDGLVQSTFKQLFNEILREEARNVDFTLSLSIVEVY
                     CEEIRDLLALPDRRKPLKLRADSNQSTLHVKDLSSVTVSSLSETLSCLQKAKVNQNSG
                     GKRMPSRASVIIKLSINQRNNDEEIVKASTLQMIDLASSDKVHKDSGPSLGTEDARKI
                     NISMDAIDNVARSLAGSKLTVSDTRPPASKHQIPYMESSLTQLLREVIGGNYRTTVLL
                     TCSTKKEDEAETLQSLNFGANMRLIKNSVSQNKSGFNSKKILDLLMKDFSVERANYIS
                     RIEQLQNEMTLIRRKEREKDYIQSDILLTENSNLKAQVDSLSQLLNSDGKKTKDEEHS
                     RILETLMEKCESVIQLQMKLDNECSRTAHLRSELEFNVSREQALEAMNLKLLHQLQEN
                     EDELKQVLASNFSLKQDLEKWQNLAATRLEKNESLESLLTVNNVGRHDDRNRRSSASS
                     AGSFMAQIDENSQFRKSSWLFGHSSTNSRAMRQASVDSVRSNTSQELSRPKVLKNGLN
                     LNAVSGDAESFHSK"
     gene            complement(<72543..>74129)
                     /locus_tag="HG536_0G00530"
                     /db_xref="GeneID:59327437"
     mRNA            complement(<72543..>74129)
                     /locus_tag="HG536_0G00530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284974.1"
                     /db_xref="GeneID:59327437"
     CDS             complement(72543..74129)
                     /locus_tag="HG536_0G00530"
                     /inference="similar to AA sequence:RefSeq:NP_013781.1"
                     /note="ancestral locus Anc_2.632"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140870.1"
                     /db_xref="GeneID:59327437"
                     /translation="MLKSVHIFSAYDISMTICSMLWFLVIGLPLGESYSLDISSQLQQ
                     RFSAINTTDKVLAKEYLEDKFPFLKSHCVTEALKSFLPICLEKGMEFVDSALRVEAAV
                     KLSICEFKASGLEHIPNSCDSWDIDSMMDCMIRLESSAQWWTTYSGNYQRLSSICFEN
                     SLPYEKQQILDLFLNVTRMYSDISDALRAQVQEIISNTESASRRHLENMANMFQEYMD
                     DFSQRAKSNEEDIETEFIAHKDRMKELITRDSVAFLEELKKKDSQLIESLGDILITTD
                     KIATELSRMDITNEINDKNRAALEKWTEVDEIVEKIYDAQIENHNRMGKQWEDFLVLA
                     RDDIITISSDLAKSHARAFEALNDYDDMIKDTIIPSIANSVLSPLHALKEQILFDWQE
                     TAELISEDVTNWNNRVASSFEAISQNLNNTMEKVIDLDNRIAKLHGLFAHIQKVFELI
                     FKAFQHSSMIFLHLIRNRWFWVLAMLSFCMPKTLKVFRSEIPFLMIISVTQLALKWCM
                     ILIMIFIGSKLGTLIVSNNS"
     gene            complement(<74251..>75999)
                     /locus_tag="HG536_0G00540"
                     /db_xref="GeneID:59327438"
     mRNA            complement(<74251..>75999)
                     /locus_tag="HG536_0G00540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284975.1"
                     /db_xref="GeneID:59327438"
     CDS             complement(74251..75999)
                     /locus_tag="HG536_0G00540"
                     /inference="similar to AA sequence:RefSeq:NP_013780.1"
                     /note="ancestral locus Anc_2.631"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140871.1"
                     /db_xref="GeneID:59327438"
                     /translation="MKPCRIYSTCNVRGVPRNPLKHRIGPKQGLPLSVPSPSHIVHPF
                     YTPSTTEEIIACSTETLPALLDGKQIMPSLLNEKPAGSYHLEMSSLRFKCVRGVANWL
                     EDFSAFAGSSSELDYRVLNQQMTGLLLKPSKLSRMKHPLISTLKELFAVEKSQQINPA
                     TLNAIVEQFISDRDLGVFSEDIYLYLLQHHVNSTDKILTIIESIKLHLATDIDQLKVI
                     EELVLHLLVSLERNKLPITEKLVTSFDGLLDAINKRFHVQNCTTHFQPLVCEEILEYY
                     IKIGNLNESKRIISGLIARKFLPAESTIVNYLKAINDQLNLDKTPKGYLRAFALVSDF
                     RPAVERARNPLTFTYLIPLCRHMSEVTSLLTMIKNCENAKEILDVNLIPFIHKITHIK
                     NGPSMRSANLCSLYRMASAFYGDKLPDKYSKAFLLSFADLKNYVMMATIMKKDIIAIS
                     SDFFKTILSKLEKKQLKNIPSSIEGCDLFKVDLFTSCMLPFYFSLPLKAKLQLISQMK
                     TKLILVTVLKAELAQTENLELDVIRKILVHGLSNDLLSDVPASVWDKFTADTELNSVL
                     RESEKVTAQKQSKKTI"
     gene            complement(<76126..>76806)
                     /locus_tag="HG536_0G00550"
                     /db_xref="GeneID:59327439"
     mRNA            complement(<76126..>76806)
                     /locus_tag="HG536_0G00550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284976.1"
                     /db_xref="GeneID:59327439"
     CDS             complement(76126..76806)
                     /locus_tag="HG536_0G00550"
                     /inference="similar to AA sequence:RefSeq:NP_013779.1"
                     /note="ancestral locus Anc_2.630"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140872.1"
                     /db_xref="GeneID:59327439"
                     /translation="MRVIITVVVLTTVSLVFQLLPVISVPITKSLALSNFLDSAYGVF
                     GWCNTNVDLNGTVCTPAGIGYTDLSVDMSGRKTFLPSMVKYPVTKLLVVHPLSLAFTS
                     ILWVMILLLLSPSLRSSSGYLLVVALFSLPTVLFSLLCFLVDILIFISHLNWPGWLML
                     AATISLAICCSLLWTLRRSVSIKNYETLQAKERASSVETYATAQIAPIKTGSITVHES
                     SVLEPGLS"
     gene            <77023..>79179
                     /locus_tag="HG536_0G00560"
                     /db_xref="GeneID:59327440"
     mRNA            <77023..>79179
                     /locus_tag="HG536_0G00560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284977.1"
                     /db_xref="GeneID:59327440"
     CDS             77023..79179
                     /locus_tag="HG536_0G00560"
                     /inference="similar to AA sequence:RefSeq:NP_012845.1"
                     /note="ancestral locus Anc_2.629"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140873.1"
                     /db_xref="GeneID:59327440"
                     /translation="MQTSADSVLPKNQKRGRKVHPFQRSQSKVVQFVENKQDDEDELE
                     NQTLSRNELKKKANDLLRVRQTFPVYQNKEEIMKYIRKNQVAILIGETGSGKSTQIPQ
                     FVLDDLYAGRFKGAIAVTQPRRVAAINLATRVAQEYGCNVGEQVGYSVRFDNATSSKT
                     RLKYLTDGMLLRESMMHRDLKEYSVVVIDEAHERTVLTDLILGFLKSLIDGPRPDLKI
                     IVMSATLQAERFSSFFHNAPILFVEGRKFSVDQYYLGQPCEDVVDSMVRCCCQINQGE
                     QMGDILCFLPGQEEIDKAVAIMNKISPCISETTAVPLMVALPLYAALPPAQQALVFRP
                     VKGFKRKVVFSTNIAETSVTISGVKFVIDSGLRKVKVWRHQLGLATLLTVPISRASAM
                     QRTGRAGRESEGKCFRLYREADYNQLPLQTEPEIARSDVTSPVLMLKRYDIDDVVNWT
                     WFENPGKDALVLALQQLYELQALDEAGKITSRGKQMALLPLPPQMSSVLIHAHEIKCL
                     SPAIDIVACLSVDNFLLNPPPELRDEVNERRLALCSAGKRHGDLIMMKELFDFASQIH
                     TPQERVEWCKQLCVSHRAFKNIAKIKEQLRTYCKHLFNDDVTQQEENELALDTNTNIA
                     RIVKCFLTGFAKNTAIRMPDRSYRTVLTGEPISIHPSSLLFLNSHCPAIMYTEYLFTT
                     KGYARNVTRLELAWLQEIAGLGAVAKQTVASHEQSV"
     gene            <79664..>81400
                     /locus_tag="HG536_0G00570"
                     /db_xref="GeneID:59327441"
     mRNA            <79664..>81400
                     /locus_tag="HG536_0G00570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284978.1"
                     /db_xref="GeneID:59327441"
     CDS             79664..81400
                     /locus_tag="HG536_0G00570"
                     /inference="similar to AA sequence:RefSeq:NP_010825.3"
                     /note="similar to Saccharomyces cerevisiae STL1 (YDR536W)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140874.1"
                     /db_xref="GeneID:59327441"
                     /translation="MGLRLSKKFSPKGGFMSRTAHFGLTGKKLRYVITTTAMTGFSLF
                     GYDQGLMASLITGDQFNYEFPATKNNGEGDTHTSTVQGAVTSCYELGCFFGSLFVMFC
                     GERLGRKPLIVLGSLITIVGAAISTCAFREHWALGQFVIGRVITGVGTGLNTSTIPVW
                     QSEMSDPSIRGLLVNLEGSTIALGTMLAYWINFGFSYIDSSVQWRFPVSLQILFALVL
                     LALIVNLPESPRWLIAQSRTEEARYLLGQLDEVDPNDDQVIAEVAMIHDTVMRSKSEK
                     NSMSNLFARGKSQNRQRALVAASTQFFQQFTGCNAAIYYSTVLFEKTILLSPRLSMIL
                     GGVFSTVYALSTIPSFFLIERFGRRNLFLMGAAGQAVSFTITFACLIHSTKENAKGAA
                     VGLFLFIVFFGSSILSLPWIYPPEIASMKVRASTNAFSTCTNWICNFAVVMFTPIFIH
                     RSGWGCYLFFAVMNYLYIPVIFFFYPETAGRSLEEIDIIYAKSHEEGTQAWRVAANLP
                     KLSLQEIEDHANALGLYEDDLEKEEFIEDKADDNRGAHGYALFARNTQNNAEDSSSAS
                     EKDPRTASQGDI"
     gene            <81580..>82905
                     /locus_tag="HG536_0G00580"
                     /db_xref="GeneID:59327442"
     mRNA            <81580..>82905
                     /locus_tag="HG536_0G00580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284979.1"
                     /db_xref="GeneID:59327442"
     CDS             81580..82905
                     /locus_tag="HG536_0G00580"
                     /inference="similar to AA sequence:RefSeq:NP_013778.1"
                     /note="ancestral locus Anc_2.628"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140875.1"
                     /db_xref="GeneID:59327442"
                     /translation="MKVSSALLQQGSKMIDKYALYVPKSGVFPKGFKVASAATGVKKN
                     GNLDLGIIVNTNKSHQSSAAAVFTTNKFKAAPVLVSRTVLEETSGKNVNAIVVNSGCA
                     NSVTGDVGMADAKEMVGLVNSKLQLENSTLVMSTGVIGQRLQMDKISQGIDKIFNENR
                     FGSDFSSWLDIAKSICTTDTFPKMISSEFALPNGARYTLTGMAKGAGMICPNMATLLG
                     FIVTDLPIESHALQKMLRFSTERSFNCISVDGDMSTNDTICMIANGAVDTPEITESSP
                     YYEQVKEQVTEFGKRLAHLVVRDGEGATKFVTVNVKNSLTFADAKIIAESISNSSLVK
                     TALYGKDANWGRILCAIGYAKLENLSSLDVEKINVSFIATDNSEPRELKLVVNGVPQL
                     EIDEERASEILALTDLEVLVDLGTGKEEAQFWTCDLSHEYVTINGDYRS"
     gene            complement(<83012..>84976)
                     /locus_tag="HG536_0G00590"
                     /db_xref="GeneID:59327443"
     mRNA            complement(<83012..>84976)
                     /locus_tag="HG536_0G00590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284980.1"
                     /db_xref="GeneID:59327443"
     CDS             complement(83012..84976)
                     /locus_tag="HG536_0G00590"
                     /inference="similar to AA sequence:RefSeq:NP_013777.1"
                     /note="ancestral locus Anc_2.627"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140876.1"
                     /db_xref="GeneID:59327443"
                     /translation="MSGGATPTLSVDASNKSLTPPTAAVQRDPSDIEGRIRDKIERNP
                     VDILAYLELVQYYESRDAFEDSRKIYTELHNKFPFYSPLWTLQLKGELQRDEFKVVER
                     LLAECLSGEKANNDLQLWSTYLDYVRRTNNLITGGQEARAVVMKAFQLVMEKCAVFEP
                     RSSSFWSEYLGFLEQWKPVNKWEDQQRIDMIRRLYKRMLCVPFESIEKNWNRYTQWEQ
                     EVNSLTARKFIGELSPDYMKARSLYQEWSQLTRGLRRSPPSSLSTANKNTIPSIDEEL
                     DPNQLRIWLRWIEWEKENKLGLENEMLQSRILYVYKQGIQHMLFAAEMWYDYAMFISD
                     ATERCQILSTAVRANPTSPSLTFKLAECYELDNKYDLVQKCFEDCTQSLLREYHLMLA
                     SENEFRIYKQKKKMTFVNCIYMNTMKRLSGLSAARSVFGKCRKLKNNLTHDIYIENAY
                     LEFQNQNDYKTACKVLELGLKYFQEDAAYINKYMDFLIVINKDSQIKTLFETSVEKLK
                     DLEGLRSIYKKMISYESKFGTLNNVYSLEKRFFERFPHENLIEVFADRYRVQDENLIK
                     QLELTYMNDDKYSETDDMLSSSLKRSRGSQANGQSHKKMKRGPAVPNEIIDLLAIIPK
                     RQYFKAALLDPQNLVTYLNEQVELPPPSHV"
     gene            <85244..>86179
                     /locus_tag="HG536_0G00600"
                     /db_xref="GeneID:59327444"
     mRNA            <85244..>86179
                     /locus_tag="HG536_0G00600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284981.1"
                     /db_xref="GeneID:59327444"
     CDS             85244..86179
                     /locus_tag="HG536_0G00600"
                     /inference="similar to AA sequence:RefSeq:NP_013776.1"
                     /note="ancestral locus Anc_2.626"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140877.1"
                     /db_xref="GeneID:59327444"
                     /translation="MVAGQCTVHMWGLNERASLISPESVALYWFLNGYYSKLRKDTTR
                     VEIVFSNNTDLSPNEELPLLVQDARRISGFVNIVDYLMSDEESEKDTVGNTLLQSSLL
                     QFTSSDLSVLTDYQLYLNKTNYDTFTRRTFCRLLSWPMWYNTPLHYRAVARERCQDLL
                     GDLDSDDECEPPGSQLETAELTQSKTFKIAQQIKKQGKKELQNAKNNLHYLSKLSEHL
                     KLWIQVRERAQSDRVIPADLLMWANIYVQLQLPDSDKVANHLSQTLGSDFFNTLQKQL
                     DLCSNLEPVVSQRAPSFREQGNVLMSVYNIAAKYL"
     gene            complement(<86186..>86560)
                     /locus_tag="HG536_0G00610"
                     /db_xref="GeneID:59327445"
     mRNA            complement(<86186..>86560)
                     /locus_tag="HG536_0G00610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284982.1"
                     /db_xref="GeneID:59327445"
     CDS             complement(86186..86560)
                     /locus_tag="HG536_0G00610"
                     /inference="similar to AA sequence:RefSeq:NP_013775.2"
                     /note="ancestral locus Anc_2.625"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140878.1"
                     /db_xref="GeneID:59327445"
                     /translation="MANDAGDGTIVRLVRDNLAYCQFWTELCVCDRTLAWRDQTLHLI
                     SGRPTQKLSHDGDEEIHTEYVLPVEMSQYKKGYVTLECLDKVFCQMCPPSASRLTLAI
                     VSNDGTVAFYYVYKGLHKPKRN"
     gene            <86616..>87953
                     /locus_tag="HG536_0G00620"
                     /db_xref="GeneID:59327446"
     mRNA            <86616..>87953
                     /locus_tag="HG536_0G00620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284983.1"
                     /db_xref="GeneID:59327446"
     CDS             86616..87953
                     /locus_tag="HG536_0G00620"
                     /inference="similar to AA sequence:RefSeq:NP_012846.1"
                     /note="ancestral locus Anc_2.624"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140879.1"
                     /db_xref="GeneID:59327446"
                     /translation="MSWIFQSGESIFPPERLRTLYTVKSSTEIGRCYRCASFESLIAV
                     GLCNSCSVPDMQKFWLALVVLLAGFSQVHGYRPVVRPKEKVTTSEQADPWYRTIYGSK
                     VELVTPTVIAGVTFKAKPSPTPNPLQPWITLNKLGEPKTVKPEIKNGITKKGSPEYST
                     YFKVVSTTTLGYEDLKAHNMDPDEVYEEKVFIEEDDTYVSLNPVIRCTPDRYFNKGAS
                     RDISSEPFCTPQEDVQWKVGKTYFASWYTHFFRDEHSDEVIDQVKVHLSYVKERDGEK
                     GFVKRDIPATFFSSEWLRNDEGMLPIEVQPEWLQGARTRKVVLSVQPKNVPDEEFHPL
                     DHGILLFIDAGSRVYKHTKEQLALEEAGFTERHWLFVAITMPTVVVIALILMYFFLYA
                     NNSYRDFSDITRKAVSKKHRVIGKVSEMKKFKNLRNHKYSELPSYQTKPDKQH"
     gene            complement(<87995..>89344)
                     /locus_tag="HG536_0G00630"
                     /db_xref="GeneID:59327447"
     mRNA            complement(<87995..>89344)
                     /locus_tag="HG536_0G00630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284984.1"
                     /db_xref="GeneID:59327447"
     CDS             complement(87995..89344)
                     /locus_tag="HG536_0G00630"
                     /inference="similar to AA sequence:RefSeq:NP_012848.1"
                     /note="ancestral locus Anc_2.623"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140880.1"
                     /db_xref="GeneID:59327447"
                     /translation="MKSADHSSSSYLPGPTMLNPTDSASCADNTSLPAGKRSCSCEIS
                     SMSSREIKTGRKGPSRRARGSRLRKPRFRFPRNLKTEGTNYDLITSVEYLNEKYGIRK
                     SHYIEKFLKCIHRKIDYDVNRLSDKFVNSLNPWIKIKLFLLLVTLSQRGGPEYWMDKN
                     EQNHASPVKGKQKQERRDGEEDAIFSLTEQVMRYNINEDFTESAYDENYVFSSIWANF
                     MEGLINHYLEQVIVPHSEMKVCEQLYKPMMKIISLYNEYNELMEKSERNGFLPSRCDT
                     REGLISEDDEEATQNMAESSSGDGSTQERLQRAQKLLWQARQDIPKTISKELTLLSEM
                     YSTLSADEQDYELDEFVCCAEEYIELEYLPSLIEVLFANCGGNNFWKIMIALEPFFYY
                     IEGISEDEDKEDDSNSAAYLNTDKDTTEDLGSQSFKPDQRVVILEKICEVAARQKWI"
     gene            complement(<89535..>91394)
                     /locus_tag="HG536_0G00640"
                     /db_xref="GeneID:59327448"
     mRNA            complement(<89535..>91394)
                     /locus_tag="HG536_0G00640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284985.1"
                     /db_xref="GeneID:59327448"
     CDS             complement(89535..91394)
                     /locus_tag="HG536_0G00640"
                     /inference="similar to AA sequence:RefSeq:NP_013774.1"
                     /note="ancestral locus Anc_2.622"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140881.1"
                     /db_xref="GeneID:59327448"
                     /translation="MSLVTVFLLVISSVVTFAKAATHTFNWTTGWDYRNVDGVRERPV
                     ITCNGEFPWPDVRVTKGDRVQVYLTNGFNNSNTSLHFHGLFQRGNSQMDGVPGLTQCP
                     IVPGSTMLYNFTVEDNSGAYWYHSHTDGQYEDGMRAAFIIDDGENNENYPYKYDEEVV
                     LTIGEWYDRPVHELNRLFLNLNNPTGAEPIPQNLILNDTRNLTWEVKPDTTYLLRLIN
                     VGGFVSQYFWIEDHELTVVEVDGVTVEQNTTDMLYVTVAQRYTVLVHTKNDTSRNYAI
                     MQKFDDTMLDKIPTYLELNATSTLSYSADLGAASENYVDALEPLDDFYLVPYNKQEVY
                     GDPDYVITVDVSMDNLINGVKYAFFNNITYRAPKVPTLMTVLSGGDNVTDPYIYGTNT
                     NTFVLQKDDIVELVLNNFDNGTHPFHLHGHAFQTIVRDRAYEDAPRRYDDSDHPEFPE
                     YPMIRDVVYVNRQSNFVIRFKADNPGVWFFHCHIEWHLLQGLAIVLVEDPLAIQATAS
                     QHLTDSVQEVCRDAGIALAGNAAGNTVDFFDLTGQNVQEKRIPSGFTKKGIIAMTFSC
                     LAGVLGLITLSVYGLLEQPEVASEKLMQDFNLGPQELIEERSTSSNSVDRVNP"
     gene            <91794..>92726
                     /locus_tag="HG536_0G00650"
                     /db_xref="GeneID:59327449"
     mRNA            <91794..>92726
                     /locus_tag="HG536_0G00650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284986.1"
                     /db_xref="GeneID:59327449"
     CDS             91794..92726
                     /locus_tag="HG536_0G00650"
                     /inference="similar to AA sequence:RefSeq:NP_013772.1"
                     /note="ancestral locus Anc_2.621"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140882.1"
                     /db_xref="GeneID:59327449"
                     /translation="MVEKSASSRDAGPGSNFAIDFLMGGISAAVAKTAAAPIERVKLL
                     MQNQDEMIKQGTLEQRYDGILDCFRRTASREGVISFWRGNTANVLRYFPTQALNFAFK
                     DKIKAMFGFKKDEGYWKWFAGNLASGGAAGAISLLFVYSLDYARTRLAADASHHGGSR
                     QFSGLADVYKKTLASDGVAGLYRGFMPSVTGIIVYRGLYFGLYDSLKPVLLTGSLEGS
                     LAASFLLGWVITTGASTASYPLDTVRRRMMMTSGQTVKYSGAYDCFRKIVAQEGVTSL
                     FKGCGANIFRSVAAAGVISLYDQLQMLLFGRKFK"
     gene            <92868..>93806
                     /locus_tag="HG536_0G00660"
                     /db_xref="GeneID:59327450"
     mRNA            <92868..>93806
                     /locus_tag="HG536_0G00660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284987.1"
                     /db_xref="GeneID:59327450"
     CDS             92868..93806
                     /locus_tag="HG536_0G00660"
                     /inference="similar to AA sequence:RefSeq:NP_013771.1"
                     /note="ancestral locus Anc_2.620"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140883.1"
                     /db_xref="GeneID:59327450"
                     /translation="MSSIERFISQPPFIIQSSLAQLRYLILSEGIQASNDKQLQRLRC
                     YVWSVLSRTSMERSTQIYLSFLQLGPAPQPILQKIKNDTFRTLQTDPKFITVVSEESL
                     VRCLSCFAWQSLQMQRNGSDSKIHQVSTYVQGMNVLVAPLLYSSPSEPMAFQLFSKLC
                     YTIIPTYLDNNLTGVHNGAKLLDICLKIIDPKLSKFLSDNLLTAEIYGIPSILTLSSC
                     NRPLDQVCKLWDFMFAYGFHMNILFVVALLVTVRTKILKSESPMNLLTRQLPEFDADE
                     IIKLGVGFVAKIPSEYYNLLVQHLTEPNLTIPYDDD"
     gene            complement(<93845..>95371)
                     /locus_tag="HG536_0G00670"
                     /db_xref="GeneID:59327451"
     mRNA            complement(<93845..>95371)
                     /locus_tag="HG536_0G00670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284988.1"
                     /db_xref="GeneID:59327451"
     CDS             complement(93845..95371)
                     /locus_tag="HG536_0G00670"
                     /inference="similar to AA sequence:RefSeq:NP_012849.1"
                     /note="ancestral locus Anc_2.619"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140884.1"
                     /db_xref="GeneID:59327451"
                     /translation="MGGQQALEDLRSKIVASMSSERRNEQAGKRVASEAGAREDDVKR
                     QRPIKLPTGPRNGITRSRYEPYGRGVGYSDYSRRGARADNFGYSSHGRSPPPPRYTAQ
                     QSSRWNRFDSHQEQRPSAPFHEDYLKDVEPIDKRKRLSASRWDVTPKGFEKVPAERAK
                     LSGLFPQPGQPQELDRSKLERVALHGGSKSRRTRILFEDATSKNLVVSKLACELVVEG
                     LDQTASESFSSLVQKFVAGLEGDMAVRKVLVPDHRTYAVVELGSAECATLVLSCRSFI
                     NKKLGLSLRWRRPNEYVQQLDHPDRLCSPEIIAVEGLEDGDETAIGQMLSDNGLKNCY
                     LKPITSLMDGVPTFTGCALVELDNVEDDVLEKFKTTTSWFRPNQGTLVQESSSITFQS
                     LPTLVSEQTRSESKVLVLLNCVDPLDLKLVPFAQEIEDTIKYTLGDVDTVRMRRPNAD
                     YRLNFDNISEGVGNIYVKFKTVEASIEAMAKLPGSKFNGRTVLCSYVSEEDFEKIGVL
                     "
     gene            <95556..>98258
                     /locus_tag="HG536_0G00680"
                     /db_xref="GeneID:59327452"
     mRNA            <95556..>98258
                     /locus_tag="HG536_0G00680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284989.1"
                     /db_xref="GeneID:59327452"
     CDS             95556..98258
                     /locus_tag="HG536_0G00680"
                     /inference="similar to AA sequence:RefSeq:NP_012850.1"
                     /note="ancestral locus Anc_2.618"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140885.1"
                     /db_xref="GeneID:59327452"
                     /translation="MNFSAIYWILSLASLLWPGSLAAVIGIDYGQQNVKAMVVSPRAP
                     LELVLTPEAKRKDISGLAIRKRGDGIERIYGSAVGSLATRFPKNSLLHLKPLLGKTEA
                     DEIDIVLYLREHPGVEITATKRASLAISVDGQEYPIEELSAMNIQEIVNRANRLVKEK
                     DSLNSDYVDKLAITVPDFFDQHQRRALLDVGSLTTDNLETVLISDGLSVLLNFVFKQR
                     DFVLGEPQYYIVYDMGAGSTKASLFSILQPANESEPLKIELGGYGFDEHLSGSKFTLD
                     VASLLENKFLEAHKTIRTDILHSNPNALAKLNQAAEKAKLILSANSEASVSIESLIDD
                     IDFRTKVTRQEFEDFIQESVVDLVKPLEDALDRQFWQSHVALKNIQGVILTGGSTRVP
                     AVQQRLISVLGEKKVLKSVNADESAVNGATIRAVKLFNAFKTKAVDIVERSPSDYGLK
                     IMEDETEMIVFPRGSAYPRTKTIEVAQMSNLSKALTLDLYEDGKIFRKVRLLPEVIKK
                     AFPTDECTDGISFNATFSLSQNRLFDLDKVQAICWNGPKAGEGEKDSGKGQSSDQSDR
                     LNDSRDKGRNKKSPTLEFLTEEVPLSHLMHQEKYRLRENIKTLDEKDSERFEFERAKN
                     ELEALLYNTRDFITSEDVAETGPKKHLEKLASIIPTYLDWLEDESDGADKADIMSKIA
                     AVNDLKSRVEIYIESLQEPLNAEQFKALLAKADKLSKKINTEREVPHEGLSALNETFS
                     QAGYDIQKEYFKINLPYYLSNPLSSWNDKFEALQKIANATKEKISSDALGKDSREELL
                     ELKLSFDQAFIELEQIMELLEKARNYRFRELLSWYQRAEKAKKRKEMKLSSEILKSSS
                     SMAASSSAGVTDSVTGATSTSTSAASSSAGHSSTSNTAPVHDEL"
     gene            complement(<98385..>100985)
                     /locus_tag="HG536_0G00690"
                     /db_xref="GeneID:59327453"
     mRNA            complement(<98385..>100985)
                     /locus_tag="HG536_0G00690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284990.1"
                     /db_xref="GeneID:59327453"
     CDS             complement(98385..100985)
                     /locus_tag="HG536_0G00690"
                     /inference="similar to AA sequence:RefSeq:NP_013770.1"
                     /note="ancestral locus Anc_2.617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140886.1"
                     /db_xref="GeneID:59327453"
                     /translation="MTYTQLYIPLEISREVVCLLGNLGNVMFRDLNRDLTAFQRGYVD
                     QIRKFDEVDRLVGHMREIAEKHAAATWRYILHTDDEGNAIQHPNVAQLIRTMHTHTHD
                     SIQEMVEDVTSFESRVRQMDDSLNNLRKRLSALLEERSTIFECSRFLQGHPGIFGRVT
                     REQRERMDVDEFSLTNDDVSEDLSDTFSFEGAGETDAAGIYEQSQENSRHGSLSSGSF
                     DMLERGFHNRFLIAGSIRRDKVEVLNKILWRLLRGNLFFKNFPINETLVEDDVGVEKD
                     CFLVFTHGDTLLSKVKRVVDSLDGRVFSLDQQSDRALQKLNDRISDLQQVVLTTEQTL
                     HTELLVITDQLPMWNAMVKREKYIYATLNLFKQEAHGLVAEGWIPSSDLLIVSNALKD
                     YSESVGSEYSTVVSVIHTNKLPPTFHRTNKFTVAFQSIVDAYGIPTYKEINPGLATIV
                     TFPFMFAIMFGDLGHGFILFTIGLVFWLNERKFEVMKRGEIFDMAYTGRYVILLMGAF
                     SMYTGIMYNDIFSKSMTLFHSGWKWPSTFKKGETIEATKVGVYPLGLDSAWHGTDNGL
                     LFSNSYKMKLSILMGFCHMSYSFMFSYINYKHKHSTVDIIGNFIPGLIFMQSIFGYLS
                     WAIVYKWSKDWIKDGKAAPALLNMLINMFLSPGTIDDQLYPGQAFLQTILLIAALICV
                     PWLLLYKPLTLRRQNEYAIAHGYQSVSHQQTTESLVDSQQEAGDDMVVTDFADADEHK
                     EFNFGDVMIHQVIHTIEFCLNCISHTASYLRLWALSLAHAQLSSVLWSMTIQNGFSSS
                     NSGSPLAVAKVVFLFGMWFILTVCILVAMEGTSAMLHSLRLHWVEAMSKFFEGEGYAY
                     EPFSFASLSD"
     gene            <101411..>103726
                     /locus_tag="HG536_0G00700"
                     /db_xref="GeneID:59327454"
     mRNA            <101411..>103726
                     /locus_tag="HG536_0G00700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284991.1"
                     /db_xref="GeneID:59327454"
     CDS             101411..103726
                     /locus_tag="HG536_0G00700"
                     /inference="similar to AA sequence:RefSeq:NP_012851.1"
                     /note="ancestral locus Anc_2.616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140887.1"
                     /db_xref="GeneID:59327454"
                     /translation="MAREHARPNDHYMPNVDTLLYKPLATEPLASFIFPDFGALHALR
                     LESFVNLNFQEIDVNGFEIYIVEQWATERKISTVITSYTGNSQDTIRAVQVALPEDPR
                     KWPAPLRNYHDNLVTFAQAKVMSKGTLFITNLPSVPSNLNLLHVECGDVRVIWRNFEV
                     NLDLKRLQCGGRSALLLCASTKAAEDKFSQLYKISMCPISREQYLQCDDQDDHGQYAP
                     MGLAECYHPVIELITLVQIALGYFDLFHHEKDGLLCNDTISAINRWWNKYGKFYLGVE
                     RLKNEGPLGPTTTTALISLVLSCYFKMKVEDCAFSKDPFEETPFRNSIHAFQKKYGIG
                     KGSGAIYLDDKTLEKLFEVSAKTSNTDIFKFKKVVKSTVQDIAGRGNPMHLSNEVLTT
                     DLDSFVKHIHGGSLGLLWKSKGRPRRRLRNIREHLGMCDIKYFRGDPDALLEKQAIYF
                     LEMKAHGADSQNSSDGQEKTLCEANKLMRYDSSGSSISASSMFCNYDKSKYARNFGIN
                     KVYHEEYIRRHSFPYADDGTHDTFDDDDDSCNKQKAHCLYRSDSVSQVQDVIETWRLP
                     FDPSLVKMARDLLRIRYKLEAQQRVDEMMHGYMGKLELNGDCTTAFSDLMSDLESVYH
                     SYSQNLGELDEKKKGTDTKQALLRGEMRELNSLSSKFQYDMRVLKGRMRDVEDSVNHF
                     ETKLMAMQKSLVEQGLGIATAVDSLSDKVKFDKCVSALVQEKDTKYEGICLKMFSKRF
                     VRDVKEDVSHWGSWFFTKLFYRHGNTDNGIK"
     gene            complement(<103805..>104425)
                     /locus_tag="HG536_0G00710"
                     /db_xref="GeneID:59327455"
     mRNA            complement(<103805..>104425)
                     /locus_tag="HG536_0G00710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284992.1"
                     /db_xref="GeneID:59327455"
     CDS             complement(103805..104425)
                     /locus_tag="HG536_0G00710"
                     /inference="similar to AA sequence:RefSeq:NP_013767.1"
                     /note="ancestral locus Anc_2.615"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140888.1"
                     /db_xref="GeneID:59327455"
                     /translation="MDSSSDNFDYVFQLIKVLGSECRANRQESDKIESILRRLAKQSG
                     LSYDQLSEKVSENTRQKYDEVSAPDSTDKLILENYSLIYEIELQEYLNRRIWSLIQEI
                     VEHLNSIRGFIIERKVTGTQTIDYYIQDKFDLKMEQLRRSNESLQDTKRVTRDKLTAI
                     YDEIRIVLGQINWDDVPSNFKERERIFQILLQLKDSYGVDLMKTVF"
     gene            104596..104696
                     /locus_tag="HG536_0Gtrna4W"
                     /db_xref="GeneID:59327892"
     tRNA            join(104596..104632,104660..104696)
                     /locus_tag="HG536_0Gtrna4W"
                     /product="tRNA-Trp"
                     /note="codon recognized: UGG"
                     /db_xref="GeneID:59327892"
     gene            <104839..>105387
                     /locus_tag="HG536_0G00720"
                     /db_xref="GeneID:59327456"
     mRNA            <104839..>105387
                     /locus_tag="HG536_0G00720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284993.1"
                     /db_xref="GeneID:59327456"
     CDS             104839..105387
                     /locus_tag="HG536_0G00720"
                     /inference="similar to AA sequence:RefSeq:NP_012854.1"
                     /note="ancestral locus Anc_2.614"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140889.1"
                     /db_xref="GeneID:59327456"
                     /translation="MPYHANYSSFTQNADKKEALQLVLDHYESLSTDQSNWICNLANA
                     SSLLWYAYKSLNVNVNWTGFYVAQPDQGAQNDETLLLGPFQGKVACQTIPFGKGVCGA
                     AAATQETQLVSDVSKAAGHIACDGDTKSEIVVPIVDPQSRKTLAVIDIDCVDLNGFDE
                     VDKFYLEKLARLICTSCNFNRV"
     gene            complement(105450..105523)
                     /locus_tag="HG536_0Gtrna14V"
                     /db_xref="GeneID:59327886"
     tRNA            complement(105450..105523)
                     /locus_tag="HG536_0Gtrna14V"
                     /product="tRNA-Val"
                     /note="codon recognized: GUU"
                     /db_xref="GeneID:59327886"
     gene            <106025..>108517
                     /locus_tag="HG536_0G00730"
                     /db_xref="GeneID:59327457"
     mRNA            <106025..>108517
                     /locus_tag="HG536_0G00730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284994.1"
                     /db_xref="GeneID:59327457"
     CDS             106025..108517
                     /locus_tag="HG536_0G00730"
                     /inference="similar to AA sequence:RefSeq:NP_013764.1"
                     /note="ancestral locus Anc_2.613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140890.1"
                     /db_xref="GeneID:59327457"
                     /translation="MRCDEINLQLWKTILDCTLWLSSTYLELLKLCSIVRRTGEMVAS
                     RKRSQEEERESSDDEQFMPTGSMIDVEAEESSDDDDETFYEAEALGENEEEEEEEDSD
                     AEFNRILAEDEAGEDEEDYNTSESFDDTASMTDKLSGMELKTIADPNIYTKFSDGKPR
                     VIKPEIDPKYDSDDSDAEAANTIGNIPLSAYDEMPHVGYDINGKRIMRPAKGSALDQL
                     LDSIELPEGWTGLLDKNSGAGLNLTEEELDLISRIQKNEQTDENTNPYEPLIDWFTRH
                     EEVMPLTAMPEPKRRFVPSKNEAKRVMKIVKAIREGRIIPPNKLKEIKEAEAAADYKY
                     DLWGDSSETVDHIMTLRAPKVPPPTNEESYNPPAEYLMTPDEKEQWDNTDPEDRERNF
                     IPQKYSALRKVPGYTETVRERFERSLDLYLAPRVRKNKLNIDPESLIPKLPSPKDLRP
                     FPIRCSTVYSGHEGKIRCLSIDPSGLWLATGSDDGTVRIWEILTGREVYKVILINVKE
                     NKDDHIESLEWNPDKETGILAVAAGENIYLIVPPIFGFDIENNGKTLIENGFGFDTFG
                     LKKKSDLQVNDSDDETESAKASTVVKKSVAQWVKPSQAQQEKDISIVITCKKTVKKLS
                     WHRKGDYFVTVQPDSGSTSVLIHQLSKHLTQSPFKKSKGITMDAKFHPFRPQLFVCTQ
                     RYIRIYDLSQQVLVKKLLPGARWLSEFDIHPRGDNVIASSFDKRVLWHDLDLAGTPYK
                     TLRYHDKAVRSVKFHRKLPLFCSAADDCTIHVFHGTVYDDMMKNPLIVPLKQLTGHKL
                     NNSLGVLATVWHPREAWLFSAGADNTARLWTT"
     gene            complement(<108577..>109209)
                     /locus_tag="HG536_0G00740"
                     /db_xref="GeneID:59327458"
     mRNA            complement(<108577..>109209)
                     /locus_tag="HG536_0G00740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284995.1"
                     /db_xref="GeneID:59327458"
     CDS             complement(108577..109209)
                     /locus_tag="HG536_0G00740"
                     /inference="similar to AA sequence:RefSeq:NP_013763.1"
                     /note="ancestral locus Anc_2.612"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140891.1"
                     /db_xref="GeneID:59327458"
                     /translation="MGGELWFGIDAENETPIETEKGSTNSETLVDPTLVDPTAVVGSL
                     RRRTPQIKLTAERLVGERGLPYVMKHAPKAIRISKKRNAHDNLSHIIQFYQLWAHDLF
                     PKARFGDFIRLCHSLGKSDKMLREYRKNLYRHEMHGEESMQPSDVRAGNAEDLEEDDI
                     YTAASQQPAEAPERSVDEPPASTEQDQNLDTQEMFVEDEDAMEAMRELGF"
     gene            <109543..>109776
                     /locus_tag="HG536_0G00750"
                     /db_xref="GeneID:59327459"
     mRNA            <109543..>109776
                     /locus_tag="HG536_0G00750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284996.1"
                     /db_xref="GeneID:59327459"
     CDS             109543..109776
                     /locus_tag="HG536_0G00750"
                     /inference="similar to AA sequence:RefSeq:NP_878111.1"
                     /note="ancestral locus Anc_2.611"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140892.1"
                     /db_xref="GeneID:59327459"
                     /translation="MSRVTTSTMIYNTDTGMMFDPSRVSARSVQEHASGSQLARDDDS
                     EDMMVDLSTGSFIPVNLRSWTVLMEVTDKLGKL"
     gene            <110400..>113873
                     /locus_tag="HG536_0G00760"
                     /db_xref="GeneID:59327460"
     mRNA            <110400..>113873
                     /locus_tag="HG536_0G00760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284997.1"
                     /db_xref="GeneID:59327460"
     CDS             110400..113873
                     /locus_tag="HG536_0G00760"
                     /inference="similar to AA sequence:RefSeq:NP_012855.1"
                     /note="ancestral locus Anc_2.610"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140893.1"
                     /db_xref="GeneID:59327460"
                     /translation="MFGANRPAFGGASRPFGTTSSPFGSQAQQQPQQQQQQQPSSTFG
                     LNTANNVQSGFGGFGAAQNTTATTNPSNTLFGMSNSSNTSNGPFGKTVTGGVTSNSSG
                     SLFGNAALGSSGSTVGSVSGNAGSGTAIKSFAAYQEKDPTTGVVNVFQTISAMPEYRN
                     FSIEELRMQDYQAGRKFPSANSNVAGTVSPFGAQTTNTNTGFGTIGNNNSMQLQSAGS
                     GGLFGQRNTTSQDSPFGSLTSSNNTNNTSNTFGSGAFGANSNANTGFGNTSNSPFGLN
                     KPAGGGLFGQSQNSGSTGFGQQSTAFGGTGNAFGNTNAMGNTGGLFGQSNQQQPQQGF
                     GSQAPNTFGQNNPQGGSMFGQNTTSNTGGLFGQQQKNQAAGGLFGNKPSGGLFGQQSS
                     TFGSTNTGSTGLFGQTSNQQQPQSGGLFGQSSATQPQQGGGLFGQSNTMNQPGGLFGQ
                     NTSQQSGGMFGQNSNQQRGLFGQTNAQVGFGQQQATSTAGPFGSKPSGGLFGQPQTST
                     GFGANTGATGGGLFGQSSAQPTQAGGGLFGQQQGAVGQATQQQPGGLFGAKPATGGLF
                     GNQPNQAGGSLFGSTQQQPQGSGLFGQSNQTQQQSGGLFGSKPAGAAGGGLFGSNAST
                     TNQAPLGQPSSGGLFGAKPPTGGPTNTASGGLFGNVNATNPAGSVGGGLFGGTSANNT
                     SVNTGLFGSKPQGQTSGGLFGNNLTGNSTSTSGVSGGLFGSKPETLNTGVSGGGLFGN
                     NSSAVTNNLSGGLFGNKPQQGIQQSSFLGSSQPLQQQQPQQLQSQASNPYGTNDLFSR
                     VVVPNSITQPTKPSATKVNADLKKKANLTGAYRLAPKPLFTGRSLADSTRTKNDVLMI
                     TGSRAPSTTSAPSSAGKESVTSDTGRSLFSAETDEAILSADKLLFNPDKKSFKNLMIN
                     RKKLEKEVDLVDKPSEVKRIAFAPHETTDGKALPDGLTDGRENLFDQVQDSPTVNKDQ
                     KNKKGIHSTKKSGLSSTTALEENGSNSKLRGVIGDDITFTANGYYISPSLDSLASKTL
                     PQLRKVSGLVIGHKDYGKIEFLEPVDLSNIPLPWLCGKIICFEPRACIAYPNSNNPPA
                     EGEGINVRSRISLYKCYPSDKATREPIKDASHQLVKRHIEKMKKQKNAKFESYDPVTG
                     CWTFIVQHPAC"
     gene            complement(114125..114196)
                     /locus_tag="HG536_0Gtrna4H"
                     /db_xref="GeneID:59327891"
     tRNA            complement(114125..114196)
                     /locus_tag="HG536_0Gtrna4H"
                     /product="tRNA-His"
                     /note="codon recognized: CAC"
                     /db_xref="GeneID:59327891"
     gene            complement(<115082..>116407)
                     /locus_tag="HG536_0G00770"
                     /db_xref="GeneID:59327461"
     mRNA            complement(<115082..>116407)
                     /locus_tag="HG536_0G00770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284998.1"
                     /db_xref="GeneID:59327461"
     CDS             complement(115082..116407)
                     /locus_tag="HG536_0G00770"
                     /inference="similar to AA sequence:RefSeq:NP_013758.1"
                     /note="ancestral locus Anc_2.609"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140894.1"
                     /db_xref="GeneID:59327461"
                     /translation="MSHIYQPTDVVLAKVKGYPAWPAMVVPTELIPQHILRLRHQQSA
                     KQKPAADEEIRDDEQADEQEDENPVNYIFYSNILKFRKFDSPCQQYCVKFFCDDSYIW
                     VKPADLKPLTIEDCQKWLAKPRNKKLIPAYEMASRGSEGIDVWEFIEYGSAGKPEEEA
                     YEEPYEDEEDITGEESSVEYEDESSGERQRPSRTSARQKKNRESKSTPNRRSIRSRKR
                     ADEREDEDLDSDEEILEPKAKRAKIKSKANKKRLVVKYKFEDDEDWTLVGRGPQDLSV
                     QDKVSPFVNKLSQKRNMEWHLETKLELVDRVNGVNKLLLDILTSNEERDTANLREDCE
                     IVLDELNVALSTKGANDEFATVFQSSAELLSYFRLLFNMKSNDLKDWRLWDQFQHCFA
                     LIYGHEFIPDNEQWTAQKTPPEEDGTATSTVAKCQTLEEQDGLKQEIET"
     gene            complement(<116698..>117456)
                     /locus_tag="HG536_0G00780"
                     /db_xref="GeneID:59327462"
     mRNA            complement(<116698..>117456)
                     /locus_tag="HG536_0G00780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037284999.1"
                     /db_xref="GeneID:59327462"
     CDS             complement(116698..117456)
                     /locus_tag="HG536_0G00780"
                     /inference="similar to AA sequence:RefSeq:NP_013757.1"
                     /note="ancestral locus Anc_2.608"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140895.1"
                     /db_xref="GeneID:59327462"
                     /translation="MSDIEDVEDSGSRSGQPKERRKIEIKFIENKTRRHVTFSKRKHG
                     IMKKAFELSVLTGTQVLLLVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDE
                     EEEEEEEEEEEVRDGGEENDSSNQVSANEQQQQQQQQQQQQQHQQQQQQHQQLHHHQQ
                     QQQQQQQMLNNTLKQEGMKSHSMHPSLNPNHGIPPGPPGASMAMPQQAPHQPHPGMPH
                     PHLQGFPNASSPYLNPEQNAVYQQYFQESQQGQY"
     gene            complement(<118015..>118371)
                     /locus_tag="HG536_0G00790"
                     /db_xref="GeneID:59327463"
     mRNA            complement(<118015..>118371)
                     /locus_tag="HG536_0G00790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285000.1"
                     /db_xref="GeneID:59327463"
     CDS             complement(118015..118371)
                     /locus_tag="HG536_0G00790"
                     /inference="similar to AA sequence:RefSeq:NP_013756.1"
                     /note="ancestral locus Anc_2.607"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140896.1"
                     /db_xref="GeneID:59327463"
                     /translation="MQNRLSEGYEESPADRTAQGDSCSTTPPSAIEGKTAKRKANIKL
                     IANRTRRHVTFAKRRHGIMKKAYELSVLTGANVMLLILSKSGLVYTFTTPKLEPFVRD
                     EEGKKLIRRCLEDEHL"
     gene            complement(118474..118567)
                     /locus_tag="HG536_0Gtrna6F"
                     /db_xref="GeneID:59327893"
     tRNA            complement(join(118474..118510,118530..118567))
                     /locus_tag="HG536_0Gtrna6F"
                     /product="tRNA-Phe"
                     /note="codon recognized: UUC"
                     /db_xref="GeneID:59327893"
     gene            <119018..>119476
                     /locus_tag="HG536_0G00800"
                     /db_xref="GeneID:59327464"
     mRNA            <119018..>119476
                     /locus_tag="HG536_0G00800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285001.1"
                     /db_xref="GeneID:59327464"
     CDS             119018..119476
                     /locus_tag="HG536_0G00800"
                     /inference="similar to AA sequence:RefSeq:NP_012856.1"
                     /note="ancestral locus Anc_2.606"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140897.1"
                     /db_xref="GeneID:59327464"
                     /translation="MSNTERTFIAIKPDGVQRGLISKILSRFEDKGFKLVGIKLVTPT
                     ENLLKQHYAEHVDKPFFPKMLSYMMSGPILATVWEGKDVVKQGRAILGATNPVNSAPG
                     TIRGDFAIDMGRNVCHGSDSVESAQREIDLWFKKEELCDWKLNQLAWIYE"
     gene            <119898..>120122
                     /locus_tag="HG536_0G00810"
                     /db_xref="GeneID:59327465"
     mRNA            <119898..>120122
                     /locus_tag="HG536_0G00810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285002.1"
                     /db_xref="GeneID:59327465"
     CDS             119898..120122
                     /locus_tag="HG536_0G00810"
                     /inference="similar to AA sequence:RefSeq:NP_001032580.1"
                     /note="ancestral locus Anc_2.605"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140898.1"
                     /db_xref="GeneID:59327465"
                     /translation="MRPTLIRNFHRSAVRMAAHADHSNAPGGRWLFTAGGVALLLAGG
                     AVVVAQRNNEQNSHIRNIFKNERGTGARHL"
     gene            <120263..>121282
                     /locus_tag="HG536_0G00820"
                     /db_xref="GeneID:59327466"
     mRNA            <120263..>121282
                     /locus_tag="HG536_0G00820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285003.1"
                     /db_xref="GeneID:59327466"
     CDS             120263..121282
                     /locus_tag="HG536_0G00820"
                     /inference="similar to AA sequence:RefSeq:NP_013755.1"
                     /note="ancestral locus Anc_2.604"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140899.1"
                     /db_xref="GeneID:59327466"
                     /translation="MLPIGPCNVPVDHSDITKLPDLILGGAILNTQYNDDPEAIPLVE
                     MLRYAFSRGIIAIDTSPYYGPSEILYGKALSKLEGEFGRETYFICTKVGRVGLDQFDY
                     SREHVRFSVKRSCERLKTSYLDLVYLHDIEFVPLQETLEALKELKALKDEGIIKHFGL
                     SGYPVDYLRSVTYRCAHDEPEIGPLDAALSYCNLNLQNVTLGDHYLKWKEESQLKIIN
                     NGSILSMSLLRSQETRGFHPCSRELRKLADTAAAYCQANGVELADLATRYAISKWRGK
                     GSTVLGVSDLQELEKALQNYWIVENNGGLLDDMDTGLVNHIQSKIFGSHMNETWASGI
                     EHHEK"
     gene            complement(<121301..>121924)
                     /locus_tag="HG536_0G00830"
                     /db_xref="GeneID:59327467"
     mRNA            complement(<121301..>121924)
                     /locus_tag="HG536_0G00830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285004.1"
                     /db_xref="GeneID:59327467"
     CDS             complement(121301..121924)
                     /locus_tag="HG536_0G00830"
                     /inference="similar to AA sequence:RefSeq:NP_012858.2"
                     /note="ancestral locus Anc_2.603"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140900.1"
                     /db_xref="GeneID:59327467"
                     /translation="MSLYFTSLFAVLTFEMVLLFIIVLPLPYRMRKFLYNTYYKWTSS
                     KQFQTVYYIFGIIVGLLFVDSWKRAQVKVSLYHHRKYNEENPDPAAVTPIQALASRAY
                     NQRNVYISGFILYFMICIPTVMTIVRRLVKYENLIREEKADRPKDAKLGRPVEDRDID
                     ELAEKLKNREASLRGLQKQVKNLEEFFDKQNDEKALGRADEKIKKNV"
     gene            <122581..>123273
                     /locus_tag="HG536_0G00840"
                     /db_xref="GeneID:59327468"
     mRNA            <122581..>123273
                     /locus_tag="HG536_0G00840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285005.1"
                     /db_xref="GeneID:59327468"
     CDS             122581..123273
                     /locus_tag="HG536_0G00840"
                     /inference="similar to AA sequence:RefSeq:NP_013753.1"
                     /note="ancestral locus Anc_2.602"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140901.1"
                     /db_xref="GeneID:59327468"
                     /translation="MSYYNRYRNRKKFDGSGTSSSNGGGSGGLAATEAVFDLGKNKRV
                     TVRQFRNVNLIDIREYYMDTSTGEMKPGKKGISLTEDLYDELLKHRLNIDEALRRFGS
                     KRPRTKTVRLLSDDEEESGAQADVKEADSSATGHDDDNATSSSSKRKKPAPPTLLPQE
                     EKRQNDEREANAPLVVPGLAKKRPPAPDANAAQPRLKEDDEDAGNAIDEEFVQNLEAE
                     MNRPDDEVSEEE"
     gene            <123470..>126223
                     /locus_tag="HG536_0G00850"
                     /db_xref="GeneID:59327469"
     mRNA            <123470..>126223
                     /locus_tag="HG536_0G00850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285006.1"
                     /db_xref="GeneID:59327469"
     CDS             123470..126223
                     /locus_tag="HG536_0G00850"
                     /inference="similar to AA sequence:RefSeq:NP_012859.1"
                     /note="ancestral locus Anc_2.601"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140902.1"
                     /db_xref="GeneID:59327469"
                     /translation="MAKPNDTERQPLLSPNTSLGSYDGSPKSKFRSEATRTGSPDSTK
                     HHSSITDFDQADSWGILHETEGNGGSKDDRDTFIDHRPTMSRLASRSKSASHNNAHRA
                     SLPAILTKSHSSRKAKGPEAPQKSSLARLSRSELKEWADNGQYGGNPYDSGLDQPKRR
                     NTLAGDDVVIDVDELMQHVHNKNANNSSKSSRSLGSSNEEGYNSRPSSRGSSTNSSLD
                     DVCLYLEDEGATEGRKWPDVSVLEEFSKEETEKLRRQALKDAEEFHFQYDEEDELDEE
                     TGTSDGIFFSKPIVTSIDVPELGNKRVNEAEQLRSGRLRPKKIAPWHLKRALIPSSYK
                     TLKDHTKINNDNQMRDNFLVGRNIQYPPHIVSNNPEHFRFTYFRVDLDATVHSPTVSG
                     LLQPGQKFEELFVHSVYSGNFARRKSETPSLTKSSTPFAGQGSAVNPSSATLNNNRSS
                     YNLPPSSPDDEDDISPFWLDVLNPTEEEMKVLSKAFGIHPLTTEDIFLGEAREKVELF
                     RDYYLVCFRSFDIVAERHTRKKRLRQDASSPTADRESLQKSQRSIKRSSRWFPTFRRR
                     RRSSTIRTTTASTFSNRRRRNEKEREEKEKYKRKSGDRHKPRQGELEPLNVYIIVFRT
                     GVLTFHFAPTPHPINVRRRARLLKDYLNVTSDWIAYALIDDITDSFAPMIELIEDEVY
                     DIEDAILRMHHSDDSSDDQSDDSEGSDSDNELYPFDRSSHRSAFTKESRSTMTSSSRS
                     RSTDDSTFNVNLIGWKKKGDMLRRIGECRKRVMSILRLLGSKADVIKGFAKRCNERWE
                     VAPRSEIGMYLGDIQDHIITMVSSLNHYEKLLSRSHSNYLAQINIDMTKVNNDMNDVL
                     GKITILGTVVLPMNVITGLWGMNVIVPGQYNDSLTWFASICAFMVLLAYTAYVYTKRR
                     FGF"
     gene            <126272..>127054
                     /locus_tag="HG536_0G00860"
                     /db_xref="GeneID:59327470"
     mRNA            <126272..>127054
                     /locus_tag="HG536_0G00860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285007.1"
                     /db_xref="GeneID:59327470"
     CDS             126272..127054
                     /locus_tag="HG536_0G00860"
                     /inference="similar to AA sequence:RefSeq:NP_013752.1"
                     /note="ancestral locus Anc_2.600"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140903.1"
                     /db_xref="GeneID:59327470"
                     /translation="MTQVNITPAWAAERPPGKMTTEQLDNDSFEATYAVKMHCNDCTD
                     QIKQCLLGVPGIEKLNFDLQKQIMSVQGSVAPSSVVAALAQCGRDAIIRGTGQPNSSA
                     VSVLETQSFAKGESPVRGLVRMVQVADNNTFFDITINGVASAGNYYASVREYGDVSQG
                     SRSTGPVWHQFDTPIDCRRPSDLDGTLFSGSAFLRAPVNVWEMIGRSFVLSTQPSAGA
                     SSDLCGVIARSAGIWENDKQVCACSGKTVWEERKDALQSNIR"
     gene            complement(<127090..>127500)
                     /locus_tag="HG536_0G00870"
                     /db_xref="GeneID:59327471"
     mRNA            complement(<127090..>127500)
                     /locus_tag="HG536_0G00870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285008.1"
                     /db_xref="GeneID:59327471"
     CDS             complement(127090..127500)
                     /locus_tag="HG536_0G00870"
                     /inference="similar to AA sequence:RefSeq:NP_012860.1"
                     /note="ancestral locus Anc_2.599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140904.1"
                     /db_xref="GeneID:59327471"
                     /translation="MQGGIRRKRDLLPRYKNGGGRAKNGGVLTTPMKKIVVYVFLLGV
                     VFVLLRLGFADLSKEVSYELDGAGAARSVVVESDGELRIPKETVPREQFNNEVAKQQE
                     VKNLENDNKPPAPERNRRVVAKEGDKRAGRGGVL"
     gene            <127735..>129789
                     /locus_tag="HG536_0G00880"
                     /db_xref="GeneID:59327472"
     mRNA            <127735..>129789
                     /locus_tag="HG536_0G00880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285009.1"
                     /db_xref="GeneID:59327472"
     CDS             127735..129789
                     /locus_tag="HG536_0G00880"
                     /inference="similar to AA sequence:RefSeq:NP_013786.1"
                     /note="ancestral locus Anc_2.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140905.1"
                     /db_xref="GeneID:59327472"
                     /translation="MFPGALMAKQPELLEVFFFSSWSVFPKQPGVASVLYNRVRWATR
                     LALYETAARADVVYRMSPGFAESVLSSRATELQQDGFFHTDDMIADGNSVNSLSLDIR
                     NTSGSVSTTLHTTGTTNTPATNVNSFPSPELNGELGVKALEQQQNSAVEQPVSSGSSG
                     TNGGGVKSYEYYKAGQRNGSGGSGVGVRISHSHTLSTPTAMSDFIAMLDAQSAIQQQW
                     KNSGVGEGVAEENMVLGQSSLNYESNSDLSSNEFASGAAVQTQGDSGSLSPLQKNGSA
                     PFVEPNVLKNNMFMDSFAMAAGGEYDVFQQPGVGASLDEYVSAELVGDDANARKLAQM
                     HSNAGSGLFSHDRRHSEVITQALPEVTAARGSISHSIDFWNLDERRATQPAFGIDNDV
                     TQVLNDYNMSFTRTPRRASSSANPGFQRHGVKKQPRGSMSVLDGSLNNDLFSKLYKNG
                     SGATNVKLVPWENSVFSDEDEEYGTRGIDSGLPNLEPIVSPQSPKSEAVARPKNQQFI
                     KPSMMLSENASTAAKMATTGTEKIDLISNLDNWNYELTVDPTMKIRRSPPPHYQTIKP
                     SAMATINSSMSAPAASRRRRSTPNIMTIRNGSSGASIGGSGRGKSRSITPMSGTDEEA
                     KPFKCKECSKAFRRSEHLKRHIRSVHSSERPFACMFCEKKFSRSDNLSQHLKTHKKHG
                     DF"
     gene            <130116..>131933
                     /locus_tag="HG536_0G00890"
                     /db_xref="GeneID:59327473"
     mRNA            <130116..>131933
                     /locus_tag="HG536_0G00890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285010.1"
                     /db_xref="GeneID:59327473"
     CDS             130116..131933
                     /locus_tag="HG536_0G00890"
                     /inference="similar to AA sequence:RefSeq:NP_012876.1"
                     /note="ancestral locus Anc_2.597"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140906.1"
                     /db_xref="GeneID:59327473"
                     /translation="MDSSARPAFPTVLSGKIESNRDNIESEVRSGAASISLLSSDSAS
                     TPFRPTYYGLIEANTAYIANFIKPYVKRIASNDGSSINGYSLGPSIGHGQFGKVYKAY
                     LKSKNSVYAIKMIPKRPWNNQYSMNQTMRQIQIWRSRGAVAPISSDEAIMLMNVQKCR
                     WELYAVSRLSSPYIASFKECLDSPQSKSIWIVTEWCNLGELKWCRSSCDQVLPQWEML
                     MPQCDVLSFTRKALIDLVLGLRYLRSQGCIHRDIKPSNILVDGDRKLLKISDFGCCVL
                     VPESLPFKNASLMECYLAELNKIVGTPAFIAPELCHFAESNIQNVQDGFQLDVWSLGV
                     TLYCLQHNELPFCGDNEFDTYQKAMNLSLGSQLNGELLNDLVISRLLEKDPSKRIDIK
                     KLADLVLPKDLTSKNKDNKPVRRFFNKIWKFKTKKRDEPTPIAEETSEVLELRSRPSD
                     VSPEPTLSMSSYEEPIQITEFLDTVWKPPRVEETHDSDHEISFSQDHREPSEKSDHFS
                     ILSISPIKLATPIKALIRIKSSPHTGRSQEPKTSPYSKSPSKTKPKNKRQKGRKLAHS
                     HDIVNFQKYIQPQQDSNENVGAPLTPQDIEEYLRFADTK"
     gene            <132185..>133906
                     /locus_tag="HG536_0G00900"
                     /db_xref="GeneID:59327474"
     mRNA            <132185..>133906
                     /locus_tag="HG536_0G00900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285011.1"
                     /db_xref="GeneID:59327474"
     CDS             132185..133906
                     /locus_tag="HG536_0G00900"
                     /inference="similar to AA sequence:RefSeq:NP_013750.1"
                     /note="ancestral locus Anc_2.596"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140907.1"
                     /db_xref="GeneID:59327474"
                     /translation="MKILADHESGEKETTIFRTMTLGHSFKGERNIFKNIHSLLKKPK
                     KPEENHLQDEDHHDFSNQRRWASQGSADEYFPGIETSPVSIRAARQSTAVGKSLGSLS
                     PTPRKDPAAQWKEGNRLSELGSSDLQNRPLAISPTLSLSRCNSTERSLRSPNGIEMDE
                     DDIFLHNLLPPQIVRSHSQRKASHNSVGSGGSRTTRPANAVISKREGKSLRGSRASLH
                     RMNSIGHRDLASAQQEELQPAAPARKAYHSMITQSGIPHYNHDGSAGDHFPRISAETL
                     KSIIEDGIYKSHYDSYQVVDCRFEYEFKGGHICNALNVSSREELEKEFIHNDQKMATL
                     LIFHCEFSSYRGPILASHLRNCDRMLNHENYPALFYPDILVLDGGYKGFFDKFPGLCF
                     PRRYVGMDSSENLASRDQELDRFRYDSKKMLSRNSSLHKLTSVSSRSSIKQSHREKNS
                     SSGKPEHPASISFKYEAPPKLSISRYSNDNLFGNSDDSSSASRLSINSSPNLSTSRML
                     LMDGLDGDSCYSFEEDDSTFTTPVGTISTPTNNHNESGNVNETSALNPIKKSLFPNVL
                     REEEEEI"
     gene            complement(<134019..>134570)
                     /locus_tag="HG536_0G00910"
                     /db_xref="GeneID:59327475"
     mRNA            complement(<134019..>134570)
                     /locus_tag="HG536_0G00910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285012.1"
                     /db_xref="GeneID:59327475"
     CDS             complement(134019..134570)
                     /locus_tag="HG536_0G00910"
                     /inference="similar to AA sequence:RefSeq:NP_013749.1"
                     /note="ancestral locus Anc_2.595"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140908.1"
                     /db_xref="GeneID:59327475"
                     /translation="MWQPLRSLLGDMSRSYGLRLSLVTLSWVPVVMTFNDDICYIARV
                     DGSSMRPTLNPDESASSTDWVLLWKFHSSKAQCLNRDDVVLFKSPLDPSKTYCKRIKA
                     VQYDSVLTRHPYPKEVVQVPRNHIWVEGDNVFHSVDSNNFGPISNGLVIGRVVKVIWP
                     PSRWGADLKLATGRHDILTAKSD"
     gene            <135087..>136370
                     /locus_tag="HG536_0G00920"
                     /db_xref="GeneID:59327476"
     mRNA            <135087..>136370
                     /locus_tag="HG536_0G00920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285013.1"
                     /db_xref="GeneID:59327476"
     CDS             135087..136370
                     /locus_tag="HG536_0G00920"
                     /inference="similar to AA sequence:RefSeq:NP_013748.1"
                     /note="ancestral locus Anc_2.594"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140909.1"
                     /db_xref="GeneID:59327476"
                     /translation="MVVEKNTFARIWTHPVTEYLKGQWFLYCLAIFIVIARFAPNFAA
                     DGGLIKAQYSIGYGAVACIFLESGLSMKTARLMANMGNWRAHLTILVISFLITSSIVF
                     GFCCAVKAADDSNIDDWVLVGLILTATCPTTVASNVIMTANAGGNDLLCICEVFLGNL
                     LGAFITPALVQMYLRNDPFSFANPASGEGIGALYGRVMKQVGLSVFLPLFVGQVIQNV
                     LPKPTSIVIGFLRKYHLKIGSYMLLLIMFSSFSTAFKQDAFTSVSSLCIIFVCFFNFG
                     IYLLFTGICFLVARPYFIIKLFAVEPIKGESSALYYYSYKLFRPFYYNKRDTVCIMFC
                     GAAKTAALGVSLVTSQYGDDKSHLGKLLVPLVLYQSEQVIVAGFFVPFFRRWCRDEQP
                     EDQDNTRKDIEAGLSHHEVGEDPKLDSGSQKTDSD"
     gene            complement(<136451..>137926)
                     /locus_tag="HG536_0G00930"
                     /db_xref="GeneID:59327477"
     mRNA            complement(join(<136451..137806,137897..>137926))
                     /locus_tag="HG536_0G00930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285014.1"
                     /db_xref="GeneID:59327477"
     CDS             complement(join(136451..137806,137897..137926))
                     /locus_tag="HG536_0G00930"
                     /inference="similar to AA sequence:RefSeq:NP_013747.1"
                     /note="ancestral locus Anc_2.593"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140910.1"
                     /db_xref="GeneID:59327477"
                     /translation="MALFRLDSILIIYPRSGTTLVQFGLQDDVFTLPDLEIPTVVYRS
                     KKSDGTVSYHSQAGESREEVRPIERGSITDLDAFLGFLKLVYVSILHDVSSKKPEAFE
                     GQLSNIPLLLMAHHSWSQCQSETVTQFIFESLQLKNALLLPVSLASSYAMGSLQNCCV
                     IDIGTNHTDVIPIIDYTPLAAFTSSVSCGGQLINDQLNKLLPDLTAEQIEDLKKSPIF
                     EVLTEDAKKLSAFDFQESSETDEGALDVAAIVTSGRDTREILEERERQKNEKNVSNAQ
                     LESNTFTDRHGNVITVGKSRFQGCDRLIKMISNRVGKALDQIDDLVKLRGVWENIIVI
                     GGTSAIQGFKEALLAQLIDDFLKVEPEEERQKREKEAMGALSSKRKNKFMGTGFISNV
                     EYVQAPSVIKLAKNPEYFPEWKKNGYSKIAFLGAQIVSKQIFTHSKDTFYMTKDKYDT
                     KGPAALWEVMF"
     gene            <138315..>138938
                     /locus_tag="HG536_0G00940"
                     /db_xref="GeneID:59327478"
     mRNA            <138315..>138938
                     /locus_tag="HG536_0G00940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285015.1"
                     /db_xref="GeneID:59327478"
     CDS             138315..138938
                     /locus_tag="HG536_0G00940"
                     /inference="similar to AA sequence:RefSeq:NP_012875.2"
                     /note="ancestral locus Anc_2.592"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140911.1"
                     /db_xref="GeneID:59327478"
                     /translation="MEFRQLESRGIQSDTGARTLSNVNRLSVEQERINERALSLLRRN
                     RERRELLRRQQDRRRYERLPEQSLDVPVEHRYVRNNEETHQFQAERGQQRRKRVRHAK
                     KVVSHKRHTPSELALYEIRKYQRSTELLISKIPFARLVKEVTDQFTTEDQQLRWQSMA
                     ILALQEASEAYLVGLLEHTNLLALHARRITIMRKDMQLARRIRGQFL"
     gene            complement(<138999..>140909)
                     /locus_tag="HG536_0G00950"
                     /db_xref="GeneID:59327479"
     mRNA            complement(<138999..>140909)
                     /locus_tag="HG536_0G00950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285016.1"
                     /db_xref="GeneID:59327479"
     CDS             complement(138999..140909)
                     /locus_tag="HG536_0G00950"
                     /inference="similar to AA sequence:RefSeq:NP_013746.1"
                     /note="ancestral locus Anc_2.591"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140912.1"
                     /db_xref="GeneID:59327479"
                     /translation="MRDQSGQLPLFYSSKASACLKDSRTGVMSYSYELCFWDPNDNGV
                     NVLLQHISAGIKSCGTMVSFFKQRSELEKDYARRLGAMSNKLVSDMEENPEYGRLNDC
                     FRTVVTNERARAQAHSKQSELLYRQIYSDVKAFAGKMQARYTTLSGRIENLRVDKYNK
                     RKGCEDLTKKLEEAELRARDLRLNQNNVIGSKKIEQNRRELAKWDNNSREISLQLDVL
                     TQEYRASQKYWFKEWADISGQLQEMETARISYLQSKMQQFAQVTLETALLEQSKMDSL
                     MNQLATFTPADDIAEFSSDYGTGRLKEKRKATGDLAVHDISRSKKDLHAENIRKLSSQ
                     LQRQTLGDSRNDKQLPSPKLQRQEEIGTKRVPKNELSRIEEPISADLKEKLSPSARHQ
                     QQNRQGTSPSSSASSSVPTDFTAHVKNRHSIDSMATSVSSMASSIDESQRFAKSWNSS
                     NRKRKSMSHLHQEKAREEQLGSSLGQHSEGSLQNGSPVLRNPSADTTIMNTNLATQQS
                     VRRKSMVLQDSSNPIEDALYEMERIKSMGNSVFAGSDSQLGRVRDNGITVTLPTVTSQ
                     GEPVIRYAKAIYPLLDNDAAELAHFDKGDYLLLTAIINEDWFRGEVYDNNFIAGTHKN
                     GLIPYNFIQLLN"
     gene            <141455..>144118
                     /locus_tag="HG536_0G00960"
                     /db_xref="GeneID:59327480"
     mRNA            <141455..>144118
                     /locus_tag="HG536_0G00960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285017.1"
                     /db_xref="GeneID:59327480"
     CDS             141455..144118
                     /locus_tag="HG536_0G00960"
                     /inference="similar to AA sequence:RefSeq:NP_012874.1"
                     /note="ancestral locus Anc_2.590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140913.1"
                     /db_xref="GeneID:59327480"
                     /translation="MSLVSAVKERDRYGDLQDDHEVRRETKMSSSVYQTSGEPLSKEA
                     LYRAKLKYGVYQSPATNISLGVAQPKEASGRAANVANENKITINAYKRLFVDPGAAHA
                     ATKVGLKGVEPAPVVEVKKSHAGSQSAATRAYSIASSTASTKKVTKSAHAGSSSAAGR
                     DRLHSVSSATHALGASATFNEQKVNPAPKPLNMSKVLSGAERQAERRIHDRTSPERKN
                     FSYGLRTGGAGKAAGNSFELSKDTLEKISAKIDSAAIEREADPQNYAEWAAYAVRDVD
                     PSSLMDAEFQDREKRRQQYLSQLTSQQVLAKARENADRELKAIDALDTHRQLFGNEAY
                     NKAAVETAREMARKNAQKMAPYQNKINMGGGLWLSPDEVNDIAENLINPVLGEVTQRA
                     EDQRATDLDIKERTEAHKAEYAAWLEMQHTKIRNNATIVVNTNIRHEREKEENKEKAT
                     KDYNELVAMKDKQIADKEEKLARTKQAKTEFETEMEGKLKSEDERVALVLANFGETNK
                     KDLEDARKEQEELLRPYHDALDAAEKEHARLLEEKSGIQKEIEKLRTSIDAHGVLLLK
                     YERGIKANDEKQAVELKNLQNLDSEKQKLRSDIDENVINLANRAKEQAAISSEQARLR
                     QLEVDALVNERKSRLNETEIELQREKLNMLDAMREAAEARGDTAIDEDRVKELLGMSS
                     EDYVAQQKNAVSKTETRPVGADLDEEDEADEDNLSEGVKPARHLDLGAFEGPAPSASV
                     RSIADVSARIPESLSEHPAKGDKSSDVSWSEKFFLGAARARKRRESQQKSEKPEISKP
                     AETAKTAEPSGTAANAGHELQPTFSGFSQDGIAAQQDAGKKKGKSTESPTVDDSEDED
                     EEDVPDLSGTDRNDDLSGANKRSSYFQEVFE"
     gene            complement(<144390..>145436)
                     /locus_tag="HG536_0G00970"
                     /db_xref="GeneID:59327481"
     mRNA            complement(<144390..>145436)
                     /locus_tag="HG536_0G00970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285018.1"
                     /db_xref="GeneID:59327481"
     CDS             complement(144390..145436)
                     /locus_tag="HG536_0G00970"
                     /inference="similar to AA sequence:RefSeq:NP_012873.1"
                     /note="ancestral locus Anc_2.589"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140914.1"
                     /db_xref="GeneID:59327481"
                     /translation="MEKRRRNISPGNYFFLVPVIGFIPWYGMLIAMLICWAGQGRPIY
                     WFMHQPQSVVYISDIGATNLNPLFIAGAGWQGLFLVITVACEFYQRSGYWPFRLRADC
                     RTTADEKSENGLSFNSMKSQYSDLLESSRFLMPPWYTRHERNLIFAAFVNGLIGELGL
                     LFCSIFTTAKYHHVHISMVTVFIVFMLLCVCCNIAEYMSMGRHYAMLHPLASQGAATV
                     TPADLKWYQWSGHVWNKFTISGVTKMAWLALAIVWAICFGAINDDSTSACFEWLLAFW
                     FGLYFIILSVDFYLGGRYKKSRYFRHVQTFAGYYKYDELLASTVFHRVSIPSQDEEAI
                     FVDADAHPSVSVVA"
     gene            <145764..>146525
                     /locus_tag="HG536_0G00980"
                     /db_xref="GeneID:59327482"
     mRNA            <145764..>146525
                     /locus_tag="HG536_0G00980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285019.1"
                     /db_xref="GeneID:59327482"
     CDS             145764..146525
                     /locus_tag="HG536_0G00980"
                     /inference="similar to AA sequence:RefSeq:NP_012872.2"
                     /note="ancestral locus Anc_2.588"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140915.1"
                     /db_xref="GeneID:59327482"
                     /translation="MTKSDIAARGQKSRWPAAHATGRKTGQETATTMAEETLEKLDQE
                     ITLNLQKIDSNLSYCFNRITKQIIPRVTQYGAVCEEIMDHASWLGSMFQQTGNVELSL
                     QAAGGDSAASPPPSDTLFPLAGREAEQRGPPAAALSDDEDAFHTADVAAAADSSDDDA
                     EGSTLQRQRRKRKVSLLLQQEFGSSSSMVPSPVAIAQRGAAAALRPDSSTTGGYRGML
                     DSSPVKQQSTDRQQPDESTKQVPKPGTVIHFSTGA"
     gene            <146647..>146907
                     /locus_tag="HG536_0G00990"
                     /db_xref="GeneID:59327483"
     mRNA            <146647..>146907
                     /locus_tag="HG536_0G00990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285020.1"
                     /db_xref="GeneID:59327483"
     CDS             146647..146907
                     /locus_tag="HG536_0G00990"
                     /inference="similar to AA sequence:RefSeq:NP_012870.1"
                     /note="ancestral locus Anc_2.587"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140916.1"
                     /db_xref="GeneID:59327483"
                     /translation="MGNAMSASFAPECTELKKQYDDCFNEWYSEKFLKGKSIENECSK
                     QWYAYTTCVDANLVKQGIKPALDEARKEAPFENGGAIEQQDQ"
     gene            <147391..>149412
                     /locus_tag="HG536_0G01000"
                     /db_xref="GeneID:59327484"
     mRNA            <147391..>149412
                     /locus_tag="HG536_0G01000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285021.1"
                     /db_xref="GeneID:59327484"
     CDS             147391..149412
                     /locus_tag="HG536_0G01000"
                     /inference="similar to AA sequence:RefSeq:NP_012869.1"
                     /note="ancestral locus Anc_2.586"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140917.1"
                     /db_xref="GeneID:59327484"
                     /translation="MSSQSRKSNNSHNKKLDPEVKFKLETLTELFPDWTNDDLIDLVH
                     EYDDLETIIDKITSGAATKWDEVKKPTKKERQDRKQEQQQQHQAVLEQDSSSSHHHNH
                     HHHHHTRAGPGAGGRQSGSSGSARSRRQQHGKHGESSEAAKAPPAVAAATAAAARGKS
                     GTNQTGSWASVASSDLKKQVLEEVEPKKKEEESKQEEPESVEAVPAAKKSTAPVTQKP
                     KKMSWAAVAAPKPKVVQKKPSPLSDIKDLKREVELIADGESPAKDESMEVNVQGSEDQ
                     KVEQPSEQEVPQEEPAEVAEQDVTRETEEEEHALEAQREESKEKEQQVVEPQEESVTQ
                     IPAATVPEMSAQVETAEKQEAEESTGLRSKEQENVYYEQQQQQYLAQQQQQQQQQQQQ
                     QQQHQQYAQKPTVQQTTQQIPQQQAQQSQPASQQQSNATAAQQQYYMYQNQFPGYSYP
                     AMFDSQNYYGQQQQYSQQPAQNAAQSGMSDAGVSSQYSIPQAYGQVAVGSPDMASAGT
                     ATASPAASHTQPQQQQPQYGHSFMPYYAHFYQQSFPYAQPQYGMAGQYPYQVPKGGYS
                     YYPGGQQTQDKQHVQQSPAQSPSQQGEDIQQQAQASQHQSQNGQASQTTQNGQQPLNP
                     QQVQFQQYYQFQQQQQAAAAAAAAAAAQQGLPYGYTGYDYTSQASRGFY"
     gene            <149595..>150416
                     /locus_tag="HG536_0G01010"
                     /db_xref="GeneID:59327485"
     mRNA            <149595..>150416
                     /locus_tag="HG536_0G01010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285022.1"
                     /db_xref="GeneID:59327485"
     CDS             149595..150416
                     /locus_tag="HG536_0G01010"
                     /inference="similar to AA sequence:RefSeq:NP_012868.1"
                     /note="ancestral locus Anc_2.585"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140918.1"
                     /db_xref="GeneID:59327485"
                     /translation="MAKLFPVAVVTGASRGIGKAIVKKLSSEGVSCVALASSRKSISN
                     IKLGDHLHVLHDAQRHRSLAIDFSDWPKWTQIKKHYGIDYQMPKAPLIESNYVASEFG
                     LFDMLRSWSSPENKYYLALLVNCAGITQASLSVRTDPTTMARILNVNLMSCVSLCNMA
                     IKHMVRDRKFVRRNPSIINIGSILGTESSPVVAGTSLYAASKAALNHYSRVLSEEISG
                     LDIAVETVNPGLVPQSDMIKMLDISIQEQLRHSMGPESTSTEKIASIIWDLYTRA"
     gene            <150637..>151140
                     /locus_tag="HG536_0G01020"
                     /db_xref="GeneID:59327486"
     mRNA            <150637..>151140
                     /locus_tag="HG536_0G01020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285023.1"
                     /db_xref="GeneID:59327486"
     CDS             150637..151140
                     /locus_tag="HG536_0G01020"
                     /inference="similar to AA sequence:RefSeq:NP_012867.1"
                     /note="ancestral locus Anc_2.584"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140919.1"
                     /db_xref="GeneID:59327486"
                     /translation="MLIYKDIFSNDELLSDAYDLKEVDGVIYEADCTMVKVGGDNIDI
                     GANPSAEGGDEDVDDNTEVVNNVVHSFRLQPTGFDKKSFLTYIKGYMKAVKGKLQESN
                     PDAVPTFEKGAQAYVKKVIGSFKDWEFYTGESMDPDAMVIMLNYREDGVTPFVAIWKH
                     GVVEEKI"
     gene            <151408..>153072
                     /locus_tag="HG536_0G01030"
                     /db_xref="GeneID:59327487"
     mRNA            <151408..>153072
                     /locus_tag="HG536_0G01030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285024.1"
                     /db_xref="GeneID:59327487"
     CDS             151408..153072
                     /locus_tag="HG536_0G01030"
                     /inference="similar to AA sequence:RefSeq:NP_013742.1"
                     /note="ancestral locus Anc_2.583"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140920.1"
                     /db_xref="GeneID:59327487"
                     /translation="MNNQSRLHPHYTLPGVMHYLQTEFTKNERDRITWELERAEMKAR
                     IAQLEGENKDLRYKLMKLNMQTSGTAKEADTKDVSGNDLSELLKSKMAVQESVKEIIY
                     LFKSPEIPSRIGSLNEERDSLHEIQKLNLNQDLHSMKKEEASMSHLLQANLHPAGIQP
                     QAVYAGDLNSRDANSDAATVVLGSDTEGSESHDTRRRRSSSLFSSTNVAPMDATKDEI
                     GHFKEPAKISSLFQSNGNGKSESAAIRQLKALDNQIISYSENGRIELWKIDSQLQIGE
                     RPDKTFDVVSSSFLDFYWLDARRFLVFDHEGVKLYATRSTSPLDSKEVFKELDFNIAN
                     AAEHDFINNRFLFVSTRTIQLLEVSASATSPADGLSMGRSYTIDGEREVISARFGMTE
                     KSLIVLYSDPYELVIYNYQGKVLQRVEISKQLLTTDKIRPSLILNKKSSKLLIALGNR
                     ILVYSFDKRKVILNETLKTQPTNIVFKTVRNSMLFGYEDGTVEVRRLNDFTSILRVPV
                     EEHEEATNGKKVTHLDCTSVNSATLIVFGFDDGTIKVQRNPDLLDS"
     gene            <153273..>156368
                     /locus_tag="HG536_0G01040"
                     /db_xref="GeneID:59327488"
     mRNA            <153273..>156368
                     /locus_tag="HG536_0G01040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285025.1"
                     /db_xref="GeneID:59327488"
     CDS             153273..156368
                     /locus_tag="HG536_0G01040"
                     /inference="similar to AA sequence:RefSeq:NP_012866.1"
                     /note="ancestral locus Anc_2.582"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140921.1"
                     /db_xref="GeneID:59327488"
                     /translation="MLLLSKIDADLLQYNKETVPENVINLYLSDENGIDKQNRPNDLH
                     NSHYSKTIELSNNEYIAYHLSNDFSVVSIYTLGTSSGKTINIYLPCPSMNMQHTLNIA
                     EFDERLTISIILKDGVYLVMELPLDFIFSNASHLSQDWLKALNPYDFTIRVPHFLYTI
                     SRDFSVIFLSDGGLLGLRRAKNFELEPILFNDNSYIESLVQMFSRKGRDRSEKVISCL
                     LFADQYLLVLTQSCHLKIWDLESLRLISDDNLFPSSHSETYSTGVHECPGNYLSLLNN
                     WLVVYLPFGNGVFVLGQLEFTAGGKPVFSRRNEISSNLSSLSIWTLVDMDLLKPLELD
                     VDTAYLNLVVLWKSGLSSKVQILNIKDENMELYEWIDGSNKSISDIEAEQDLSVNGDA
                     ERGLFNLKSRYSPQLYERAQKILSENNIIKLADEEETMDYLANLETLLRDLKNKADEV
                     SSLTVLKDEIIMVNCLQSHNHSVYKVNSALENVYYNIYEEPSDNEQSRYLKTLHGFSA
                     TLSPQVVESLSRELTGIVSGEVDTSLTMKEKFTRIFNSCLKSNFEVSNLKLLFDELST
                     FDIVPLLNDLIENLLGGYADHTSSFIDALAVDDISAVMIMESLYQSVTIQKHFVLEIL
                     LTFVLLDFDYDIFSKELNALLNLHYKQSLTLRLYQIDRSLLGTELFSQTTKFRSGVQL
                     HSYSEWNSYLSHALSSIWEDASIHLPNATNRYFMKFFEFYVIQQSENNDRGFTTKLFL
                     QIVGWPYHVRHNQVQEFMLAMMMFACNNYEQAYEYFHLHDYTQSLVTSLPECLEELKD
                     ENSASIWSPLIRTLGTPHGHTKFEYELALLFVSHNSPEFGYKCIKKSIEHTMKSVKIE
                     ETKDFKCKQLKVYLDLLVHFMLFSEALDVLRCSHDTLSEEIRTSYYRSMLQNASQSRT
                     FFATLLNLCSHAAKGLYLPESDFRIIDRILVSQLEDNDWQSYKRLYSFRILNQHDRSA
                     AEVIYHYMASIASDLETKKKCYLIVINVLSTFDDDSDKWLLDGGKIVTLQELKYEIAN
                     L"
     gene            complement(<156396..>157499)
                     /locus_tag="HG536_0G01050"
                     /db_xref="GeneID:59327489"
     mRNA            complement(<156396..>157499)
                     /locus_tag="HG536_0G01050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285026.1"
                     /db_xref="GeneID:59327489"
     CDS             complement(156396..157499)
                     /locus_tag="HG536_0G01050"
                     /inference="similar to AA sequence:RefSeq:NP_013741.1"
                     /note="ancestral locus Anc_2.581"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140922.1"
                     /db_xref="GeneID:59327489"
                     /translation="MSLSQEYDSILEIYLGKVEHTSLRQDSSEYQALLASLIERLLRL
                     KTTIHTTLALFSANESIEDIPTSSIKFLGIDYYLAQMCSRKQTTSAQISDPLQRNKMK
                     LKFLDKSVQLFMQFIHSLQDVEILDQFLVKKIESFENSYRPTLQEFSAQPAHKDDLSG
                     AQLKRQQKIESYRQAKQTAELLDSLEDKYKQKDETQDDDKDELLRELSLQRLKHLSYS
                     AINAVEQILYEIELLTNFTKISPPPAEPSQQKGQKQEQNGFTDKLETLNRPLLSKEGK
                     VLRNFTLVDKRTELQSKVRGYGQYGPTMSVEEFLAKEWEEGRVLQGGEPEPKDDGNED
                     SEKWQDEQTYKARYWDEFKEANPKGSGNTINRG"
     gene            complement(<157729..>158091)
                     /locus_tag="HG536_0G01060"
                     /db_xref="GeneID:59327490"
     mRNA            complement(<157729..>158091)
                     /locus_tag="HG536_0G01060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285027.1"
                     /db_xref="GeneID:59327490"
     CDS             complement(157729..158091)
                     /locus_tag="HG536_0G01060"
                     /inference="similar to AA sequence:RefSeq:NP_012865.1"
                     /note="ancestral locus Anc_2.580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140923.1"
                     /db_xref="GeneID:59327490"
                     /translation="MAVPGYYELYRRSTVGNSLVDALDTLISDGRIEASLAMRVLETF
                     DKVVAETLRDSTQSKLTVKGNLDTYGFCDDVWTFIVKNCQVTVEGVAGGNRGNDESQT
                     TVSVDKLRIVACNSKKSE"
     gene            <158239..>159516
                     /locus_tag="HG536_0G01070"
                     /db_xref="GeneID:59327491"
     mRNA            <158239..>159516
                     /locus_tag="HG536_0G01070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285028.1"
                     /db_xref="GeneID:59327491"
     CDS             158239..159516
                     /locus_tag="HG536_0G01070"
                     /inference="similar to AA sequence:RefSeq:NP_012864.1"
                     /note="ancestral locus Anc_2.579"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140924.1"
                     /db_xref="GeneID:59327491"
                     /translation="MSSTIFYRFRSQKDTGRIMFDGTGLTVFDLKREIIQENKLGDGT
                     DFQIRIYNPDTNEEYEDDSHVIPRSSSVLVRRSPAIKQFSAHGMHRNTGAVGNATRYV
                     TGKPRVFQKKQPASGAVSSEPAAVSGVTEEERIANMFANQENQWEQTQREMSSATPVF
                     HRTQNNSQFGENEGPPPPGYMCYRCGARDHWIKNCPTNNDPNFEGKRIRRTTGIPKKF
                     LKSVEIDSDNITAEEMAQRKIMVTDEGKFVVQVADEQSWEDYQRKQQNRLINKADAKW
                     QKGYFKDLPKELTCPITGGLLKDPVRTTKCCNKVFSKVALEDALLESDFVCPECHTPD
                     ILLDQLVEDEEKDKQVKEFLKEAKLDTEIDNKRQMEANGIIDSSKKAKIDANSPIKPG
                     NVPLPPMPFGMPPFAMFPPPIPFMNIPKNQDKE"
     misc_feature    complement(159575..161027)
                     /note="WHO14 pseudogene"
     misc_feature    complement(161508..162876)
                     /note="WHO10 pseudogene"
     gene            complement(<163189..>164271)
                     /locus_tag="HG536_0G01100"
                     /db_xref="GeneID:59327492"
     mRNA            complement(<163189..>164271)
                     /locus_tag="HG536_0G01100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285029.1"
                     /db_xref="GeneID:59327492"
     CDS             complement(163189..164271)
                     /locus_tag="HG536_0G01100"
                     /inference="similar to AA sequence:RefSeq:NP_012863.1"
                     /note="ancestral locus Anc_2.577"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140925.1"
                     /db_xref="GeneID:59327492"
                     /translation="MGVEQVLKRKTGVIVGDDVRALFDYARANKFAIPAINVTSSSTV
                     VAALEAARDNKSPIILQTSNGGAAYFAGKGVSNEGQNASIKGAVAAAHYIRAVAPAYG
                     IPVVLHSDHCAKKLLPWYDGMLEADEAYFKQHGEPLFSSHMLDLSEETDDENIATCVK
                     YFKRMAAMGQWLEMEIGITGGEEDGVNNEDVSPDSLYTQPAQVYAVYEALSPISPNFS
                     IAASFGNTHGVYKPGNVKLRPEILADHQKYTAEKAGTKEAKPLYLVFHGGSGSSVEEF
                     RTGIDNGVVKVNVDTDCQYAYLEGIRDYVLNKKDYISSMIGNPSGPDAPNKKYFDPRV
                     WVREGEKTMSKRIAIALEDFRTINTL"
     gene            <164828..>166201
                     /locus_tag="HG536_0G01110"
                     /db_xref="GeneID:59327493"
     mRNA            <164828..>166201
                     /locus_tag="HG536_0G01110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285030.1"
                     /db_xref="GeneID:59327493"
     CDS             164828..166201
                     /locus_tag="HG536_0G01110"
                     /inference="similar to AA sequence:RefSeq:NP_013740.1"
                     /note="ancestral locus Anc_2.578"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140926.1"
                     /db_xref="GeneID:59327493"
                     /translation="MGVPGRFLTSDKGTFGEHTAHDRWPIIVQNAVDDLGATLESIEG
                     DRERLEQGRKIQDQLRQLREDILADGKLERFSQEEMEVANVPLSFNEELSRVGEVSWF
                     DAEWLFAEIYLYRRMNVLFAQQSLWRGFDIFDRVKQSTFRSSLHGVVELALRYRSLCE
                     QLEAIGEDEEALKLLFKEFIDISLWGNATDLSLLTDATIEDIKSIQGAKVRQESEAKI
                     LVNDTERAWEAIRHASGDSKRVDFVLDNSGFELYADLMLAAFLLKSKLVTKCVFHAKD
                     IPYMVSDVVLEDFDILLKDLKDRDFFAVTDASSKEALDFFADTITDYVSQGRVEIRED
                     MFWTTHLDYWNIDPTETKYHGAEIYRDFVESTLVIFKGDLNYRKLTGDRKWARTTPWL
                     EAIGPLAHSGITSLSLRTCKADVQVALPEGVDEELSKLWEKDHPGRGSWWSSSGKWAV
                     ICFASGN"
     gene            <166849..>167991
                     /locus_tag="HG536_0G01120"
                     /db_xref="GeneID:59327494"
     mRNA            <166849..>167991
                     /locus_tag="HG536_0G01120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285031.1"
                     /db_xref="GeneID:59327494"
     CDS             166849..167991
                     /locus_tag="HG536_0G01120"
                     /inference="similar to AA sequence:RefSeq:NP_013739.1"
                     /note="ancestral locus Anc_2.576"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140927.1"
                     /db_xref="GeneID:59327494"
                     /translation="MSFYSNLPSGHNDTSSVSSLYPTIFEIISSQEIDALLPTSVRYL
                     IVNYWISRHPSKLSLQINNYFHEWFDLLLKGAIECYHINRYNSTFVDKFYGLQRFNAS
                     NKVLVQAQANSSVRYWPNGLTLSGKQKAVVLFEKVLLPYIRQKLDDLHAKYVARSAFS
                     SNGNQSVVVKKLYPLIKKLFYVLNLFVKLFFLGGRIGSITFLEYLFQIEYTRMTLPLE
                     SSITTKSNPPYSNRLPRQNLYSLWHKCYIVLRKMNQILSYSGSQLFPAFIFMLRVYQW
                     WTTQDLTAKLQRKLNDVDKFIPRANNSSDQAYKSTGICPICHNQIQNPGVLETGYAAC
                     YPCAIAYLPKNEGRCPVTKKRLLGCKYNAELGKWQVISGVRKLLVT"
     gene            complement(<167988..>168758)
                     /locus_tag="HG536_0G01130"
                     /db_xref="GeneID:59327495"
     mRNA            complement(<167988..>168758)
                     /locus_tag="HG536_0G01130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285032.1"
                     /db_xref="GeneID:59327495"
     CDS             complement(167988..168758)
                     /locus_tag="HG536_0G01130"
                     /inference="similar to AA sequence:RefSeq:NP_013738.1"
                     /note="ancestral locus Anc_2.575"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140928.1"
                     /db_xref="GeneID:59327495"
                     /translation="MVDIPTVVLDRLAFIEANYQYELIALSGRPPQCLLLLGHESPDK
                     NCLLSRCVNIPLSLKPVAASCTSFEYDINQVNRRIELTECTNPGLKPLGIMVLNETLY
                     DYSPTLQRLMTQVDGLRYLFTYDPLQESSLSCHSVELDSHRLTLNRVHHELRDSSSNM
                     DLGFREAAQDEAASEQEFTIKLAGKINRIIQYLRHSNDIDPKVLRSVSLLVSQLRRHP
                     TDDIEEEIMNKESEISAFRTACEQWEIGTCFLRNKPVD"
     gene            complement(<168881..>170002)
                     /locus_tag="HG536_0G01140"
                     /db_xref="GeneID:59327496"
     mRNA            complement(<168881..>170002)
                     /locus_tag="HG536_0G01140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285033.1"
                     /db_xref="GeneID:59327496"
     CDS             complement(168881..170002)
                     /locus_tag="HG536_0G01140"
                     /inference="similar to AA sequence:RefSeq:NP_013737.1"
                     /note="ancestral locus Anc_2.574"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140929.1"
                     /db_xref="GeneID:59327496"
                     /translation="MEMSQLYRVVRSFRCTALSNGTFKLQPSITRRLIQSCRSLRQEQ
                     QVLSDSAQLDQYREYYRDLKDIINDVPEDIANRSPALVTLHKRLALPREFPLSVLARC
                     LTCRSSQLPGDINDPRSGIAFTSTVPTNNFFDNHGLNIFGKNLLTYHVTQRLMARYPR
                     LPTVILNAAVDAYISQDVLASVARSWGIETETTSVVDRYLKKEPIQITLGKLRFFNNS
                     LSKHDGVQLITSQNFSENAAYALATRSVIGALWACTQETQPELSGKFIDEHILSRHLD
                     VTRLFQFEQPTRELAALCRREGLHKPVSKLLAESGRLSKAPVFIVGVFSGSEKLGEGF
                     GSSLKEAKARAATDALMKWYCYEPMENQAPVIDHGAVIV"
     gene            170860..170932
                     /locus_tag="HG536_0Gtrna11A"
                     /db_xref="GeneID:59327878"
     tRNA            170860..170932
                     /locus_tag="HG536_0Gtrna11A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCU"
                     /db_xref="GeneID:59327878"
     gene            <171031..>172524
                     /locus_tag="HG536_0G01150"
                     /db_xref="GeneID:59327497"
     mRNA            <171031..>172524
                     /locus_tag="HG536_0G01150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285034.1"
                     /db_xref="GeneID:59327497"
     CDS             171031..172524
                     /locus_tag="HG536_0G01150"
                     /inference="similar to AA sequence:RefSeq:NP_013736.1"
                     /note="ancestral locus Anc_2.573"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140930.1"
                     /db_xref="GeneID:59327497"
                     /translation="MLKVPGTNRFLFLPCRFIGTSSLPTIYALSTPPGQRSAIAVVRI
                     SGNHSKYILRRLTNSEKEPVPRVASLRRLYHPDQKRNLLDTSLTLFFESPKTFTGEDI
                     LELHLHGGKAVTGAVLKAIESLHDLEKGFNIRYANPGEFSLRAFQNGKFDLTEVEGIK
                     ELIDAETETQRKSALSSFNGENKSRFLQWRSQIVDNIAKLTAIIDFGEDTEIEDIESI
                     LTNVESDILQLRAVIRQFIEKIERSNILRNGIRIVLLGPPNAGKSSLINTISQDDISI
                     VSQIPGTTRDAIEIALNIGGYKVIICDTAGVRDDSSDAIEKMGIEKALKKSESCNLCL
                     LLVDPNNTPLIPESLKRHLASPHFQSADKVILINKIDTISPEDLDHIVLRISQEIGQK
                     LPILPISCLSGEGIENLATELITKFQLLSDSSDESNPIIVSQRVREILSNDVLYGIDE
                     FLSFKKDVVMASESLRHAATGIGKITGEAIGVEEVLGVVFSSFCVGK"
     gene            complement(<172541..>172897)
                     /locus_tag="HG536_0G01160"
                     /db_xref="GeneID:59327498"
     mRNA            complement(<172541..>172897)
                     /locus_tag="HG536_0G01160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285035.1"
                     /db_xref="GeneID:59327498"
     CDS             complement(172541..172897)
                     /locus_tag="HG536_0G01160"
                     /inference="similar to AA sequence:RefSeq:NP_012862.1"
                     /note="ancestral locus Anc_2.572"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140931.1"
                     /db_xref="GeneID:59327498"
                     /translation="MKENVRTLYQDIERCVDLLQEAVDLETAKAVSVFSEKTCDNERW
                     LEELKQRFQLRSDEELEQIRALKSQQLDRIDTVESKIEYYEKLCDELEEFQAELEVKT
                     KLAQNRRSRMNSSVRD"
     gene            <173023..>174615
                     /locus_tag="HG536_0G01170"
                     /db_xref="GeneID:59327499"
     mRNA            <173023..>174615
                     /locus_tag="HG536_0G01170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285036.1"
                     /db_xref="GeneID:59327499"
     CDS             173023..174615
                     /locus_tag="HG536_0G01170"
                     /inference="similar to AA sequence:RefSeq:NP_012877.1"
                     /note="ancestral locus Anc_2.571"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140932.1"
                     /db_xref="GeneID:59327499"
                     /translation="MPVRNGGMEDPCYARERFRITKPPHKIPISCMFLSNFEITKGNI
                     TVWSRKWSETNCEIDLENVEFKALPSGIHEVSDDVINFVLPKEVPGDEYHYGVAYYQQ
                     NGQEMAEGTDHVDRNAVKMYALGVIVDPNYRVSGVSDSGFNEWKPNQFTSANDYVDDL
                     QDLLTHWLAKKEYDNFSLFDEYFDCNGLTNDAGGLASPMLQRSGKPARDIFSHDSNAI
                     SKEASRPQMLDYLPFWIRKLGPLVFPLWKSCLLGERILILNPQGGSFELCNALNYCLS
                     IISLIPKALQIDRHEEYEYFVKPLFTIGISDIDSMVSDVRQVQRNAKVPGFIACTSDE
                     IIISKIELYDKVLKLSKETTSQDGDDAAIYSNTGLQIKATPHDFESLQSLYDNFLHEE
                     MSSTAKVRCMSMIEPKTWTQCLIDGFYWWATAGYVKPSYQEHAHSTPTSSEDNEVEMI
                     LSIIGYFHDRTSTLFNKLKAIIQASEHQGSDEVISIHPMTLGDMDLDCFSMQDRDFII
                     ALSWKLFQREVRITGDYYEAIC"
     gene            complement(<174738..>176084)
                     /locus_tag="HG536_0G01180"
                     /db_xref="GeneID:59327500"
     mRNA            complement(<174738..>176084)
                     /locus_tag="HG536_0G01180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285037.1"
                     /db_xref="GeneID:59327500"
     CDS             complement(174738..176084)
                     /locus_tag="HG536_0G01180"
                     /inference="similar to AA sequence:RefSeq:NP_012878.1"
                     /note="ancestral locus Anc_2.570"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140933.1"
                     /db_xref="GeneID:59327500"
                     /translation="MLWKGLLASLATCLACVEAVYLDLNDTASIKNASSLIAVGLMDY
                     YTGLQYGQTIGMFSNPYYWWEAGGAWGCMLDYWYFMENDTYNEVVSQALLYQVGEHKD
                     YVPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPAHQPQWLYLAQAVFNTMALRWDMS
                     SCNGGLRWQIFMWNTGYDYKNSVSNGALFHLAARLARYTGNQSYVDWADRVYDWMYGV
                     GLISNGTDKFVYDGVNIAHNCSGNLTKYQWTYNQGLILSGCAYLYNFTKDEKWGTRTF
                     DYLNSSRVFFNNSVMFESACQGANTCNTDQRSFKAYFSRFLGTTAQLIPETRDQIMTW
                     INTSALAAADSCSGGYDGHTCGINWFYGGWDSQYGLGEQMSALEIIVNTRALDRPPPY
                     NATNGGSSVGDGAAGTEEIPTNLSPLDITAGSKAGAGIITCVIGISILSCALWLIL"
     gene            complement(<176266..>176763)
                     /locus_tag="HG536_0G01190"
                     /db_xref="GeneID:59327501"
     mRNA            complement(<176266..>176763)
                     /locus_tag="HG536_0G01190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285038.1"
                     /db_xref="GeneID:59327501"
     CDS             complement(176266..176763)
                     /locus_tag="HG536_0G01190"
                     /inference="similar to AA sequence:RefSeq:NP_013735.1"
                     /note="ancestral locus Anc_2.569"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140934.1"
                     /db_xref="GeneID:59327501"
                     /translation="MSKTAQRRLLKEYQQLTKDSPPGILAAPKSEDNLFLWDCLIQGP
                     PDTPYEGGVFNAKLEFPKDYPLSPPKLTFTPSILHPNIYHNGEVCISILHSPGDDPNM
                     YELAEERWSPVQSVEKILLSVMSMLSEPNIESGANVDACILWRDNRPEFEKRVKSSIL
                     KSLGF"
     gene            <177047..>178315
                     /locus_tag="HG536_0G01200"
                     /db_xref="GeneID:59327502"
     mRNA            <177047..>178315
                     /locus_tag="HG536_0G01200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285039.1"
                     /db_xref="GeneID:59327502"
     CDS             177047..178315
                     /locus_tag="HG536_0G01200"
                     /inference="similar to AA sequence:RefSeq:NP_013734.1"
                     /note="ancestral locus Anc_2.568"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140935.1"
                     /db_xref="GeneID:59327502"
                     /translation="MDVVIRIKQSSTSEARCRLSSRSKRRLGWCWDARWVEAGEVPMI
                     IYDGEKYACVSCIRGHRSSTCRHTSRMLVKVRSRGRHASLDIRKVIIVDTESQVTPDD
                     NQQGGDSSESCDGAKECDKMNKQPILFLRTIRMQKAVLIDGKLKIIVEENGSGNDDEG
                     KPSYKYVSEKEFLRQCSINLSSAGEGCRCSCKESQANGIKTENKQEVNKALRAGHPAE
                     LPAQSPDAAQNVSQTAVSDLSSQSFFKAKPMFELLTHRGLYLSTQCSCKEGNCPCATC
                     LLHRNEDELNSYIQRSGVPLTNMGEAPVAHQTSVSCPNSCNCSAEECQCQDCLEHPTE
                     IISFNRFVFFGILNVNLKRKTIINYKGRLIPSQFWWDFLKHQVPLMSENQLDNLEINS
                     WFDKIVTTYDSQLIDTRNLHFDFANPMFGA"
     gene            complement(<178352..>179860)
                     /locus_tag="HG536_0G01210"
                     /db_xref="GeneID:59327503"
     mRNA            complement(<178352..>179860)
                     /locus_tag="HG536_0G01210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285040.1"
                     /db_xref="GeneID:59327503"
     CDS             complement(178352..179860)
                     /locus_tag="HG536_0G01210"
                     /inference="similar to AA sequence:RefSeq:NP_013733.1"
                     /note="ancestral locus Anc_2.567"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140936.1"
                     /db_xref="GeneID:59327503"
                     /translation="MSIQDKAVVIVGAGIAGLKAASRLYECGVKSCVVLEARNRIGGR
                     LHTVEGYQGRKYDLGASWHHDTLRNNLFLEEAQLPPSENGPRFVFDDDQAILIDQDRG
                     RVDMDPEMNLEILEEELSSYTDHEFHQKLGVADCSFYEMVMRYLFERRQFLTDDQIQY
                     LPQVARFLELWHGVDWTILSAKDTYFGHIGRNAMVLNYDSVVARIASSFPSDWIKLTT
                     EVHSIKRDGKVFVSTRNGEQFRCDHVIITIPQSVLSLSLKEGEPKELGRIAFEPPLRM
                     PITKAFEKMHYGCLGKVIFEFEECQWSKERSRITTLANSNRDFVRKLRTINDFPQLLE
                     SLNEADRGKEQLEPWDHPHVFINLAKVTGVPSLVMLIQEPLTQFIETLGDKNIVFKFF
                     ESVLNKVMLTLGSGPVVNGMDKEIISTAGSPILRNIIVTNWSREPYSLGAYTACHPGD
                     DPIDMVTALTAGQDDRIRFAGEHTIMDGAGCAYGAWESGKREADYVLANTSI"
     gene            <180385..>181914
                     /locus_tag="HG536_0G01220"
                     /db_xref="GeneID:59327504"
     mRNA            <180385..>181914
                     /locus_tag="HG536_0G01220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285041.1"
                     /db_xref="GeneID:59327504"
     CDS             180385..181914
                     /locus_tag="HG536_0G01220"
                     /inference="similar to AA sequence:RefSeq:NP_012879.1"
                     /note="ancestral locus Anc_2.566"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140937.1"
                     /db_xref="GeneID:59327504"
                     /translation="MFRQSKKRASSRKNFSVSESGDGVSGHLILGSTSASEKKLYDSI
                     YASKLSFYDLPPQGEITLDQFEVWAIDRLKILLEIESCVSRNKNMKEIETIIKPHLQK
                     SMPFNTDNLEAKKKDYYSHFILRLCFCRSQDLREKFVRAETMLFRLRFNMLTSQDQIK
                     FVQSLNLPSLQFISEEEKEKLKVQLYQTISPQLQFQLNLHDESQREAYFKQEKFIKLP
                     FEDVIELVGNRQVFLRGGYAYLPQFQQLNLLASEFSSKLTQDLIITQRNLPQLNEDDR
                     LLPILQHLSSGYTISDFQPDEYSKEAGDITAKSVYSADISQHYPLCVQNLFRGLKENH
                     HLRYNGRQQLSLFLKGIGLSADEAMKFWTDAFTNGGHITVDKFNKDYRYNFRHNYGLE
                     GTRIKYKPWDCRIILSKPRPARGEYHGCPYRDWSVEKLSMDLSHMNLTKTQISAVLDS
                     CQKTEYTIACTQVFEYTHGSASSRPSDDQTHIAHPNLYFERSRLLQNQQPRPAAQESS
                     S"
     gene            <182534..>184210
                     /locus_tag="HG536_0G01230"
                     /db_xref="GeneID:59327505"
     mRNA            <182534..>184210
                     /locus_tag="HG536_0G01230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285042.1"
                     /db_xref="GeneID:59327505"
     CDS             182534..184210
                     /locus_tag="HG536_0G01230"
                     /inference="similar to AA sequence:RefSeq:NP_012881.1"
                     /note="ancestral locus Anc_2.564"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140938.1"
                     /db_xref="GeneID:59327505"
                     /translation="MEIAPSNGSSSESDSSGLLTGFENRTSNGKVLNSRLMTNAGVPD
                     PVVAYKQWQYPGYGGTQHDVSRDAAAAQPVWYYYPPLQTGPVANGYQQQPYYYCNAAA
                     SQQQPQPQPQSLPQLQQGSSQYPRPKVYQFPGFQEPHQQQHQSQQPHVQQGPIASPNL
                     SSTQQQFPLRQFTPSPAPYQVSNASMAPLGYPPPQPGYDPTAQLLSPPNAPASLARRP
                     GAPLKQAGRRPVKQRDPLELPQESRMQSYDVTASSGQMTRPRVTTTMWEDEKTLCYQV
                     EANGVSVVRRADNDMINGTKLLNVAKITRGRRDGILKAERIRHVVKIGSMHLKGVWIP
                     FERAQAMAEREKIVDYLYPLFVKDIESVLKQPSSDMPEPLPPPMIPPQPAAMMLPPQQ
                     NRQEEDLTNPQPQLSYDLAPAWYGNLSNRPHTSPQSYRNTLSYGQYQNIASSSTTPPS
                     FPAPAPLQPAFHQPLPPTGYQSDFALSNRTHDRGSATSISTSSSNASGPSALSSDPTT
                     NPQSSRRETKADGHTPKNTTPGKLLTGIQPPQPNVDGSEDKIQDDKPKDV"
     gene            <184477..>185457
                     /locus_tag="HG536_0G01240"
                     /db_xref="GeneID:59327506"
     mRNA            <184477..>185457
                     /locus_tag="HG536_0G01240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285043.1"
                     /db_xref="GeneID:59327506"
     CDS             184477..185457
                     /locus_tag="HG536_0G01240"
                     /inference="similar to AA sequence:RefSeq:NP_012882.3"
                     /note="ancestral locus Anc_2.563"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140939.1"
                     /db_xref="GeneID:59327506"
                     /translation="MNISPTPRRYASRSKAMAPDNAFLYSDPVDAGENVIKDRIIPEE
                     YRLNSQMINRLIKQNKELITKIDAKQEEIDRLNILVGSLRGKLIKYTEMNKKLEDDLV
                     QAGSRVSSRNMNENEQDYIQVPKRRTETKDNVTPHDDRINALSDKLDKLTKLVLQNAV
                     PASSSPLQSPQPPVSVDNHRAVVSPSEEDIMCKESLELKQMEDQIDSLKRKLLIKREN
                     ELRKISLNQELLELMDRLSMQNPAEKERERNLNNESSLHNNSASPAYCAECHHHERNH
                     NHVSSMRQTQPVAKKNPQIPASDPLETPTPLPKRAGLSQVDLNDTVNRIW"
     gene            <185964..>187571
                     /locus_tag="HG536_0G01250"
                     /db_xref="GeneID:59327507"
     mRNA            <185964..>187571
                     /locus_tag="HG536_0G01250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285044.1"
                     /db_xref="GeneID:59327507"
     CDS             185964..187571
                     /locus_tag="HG536_0G01250"
                     /inference="similar to AA sequence:RefSeq:NP_013728.1"
                     /note="ancestral locus Anc_2.562"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140940.1"
                     /db_xref="GeneID:59327507"
                     /translation="MADISTDPVAQLHNATSALTGNETAAANFILFAVNYVKSLSYFK
                     IFVSLMCVLLVWDQVSYQIKKGSIVGPKWKWYPFIGPFLESLDPKFEEYKAKWYSGDL
                     SCVSIFHKFVIIASSRDLARKILQAPKYVKPCVVDVAVKILRPCNWVFLDGKAHTDYR
                     RSLNGLFTKPALAQYLPSLEALMDKYMDKFVEISKKNNYEPQVFFHEMREILCALSLK
                     AFCGDYITEDQVRKIADDYYLVTAALELVNFPIIIPFTKTWYGKKTADAAMKVFEQCA
                     QMAKDHIAAAGKSICVMDAWVKLMHDAKHKNDEESRLFHREFTNKEISEAIFTFLFAS
                     QDASSSLACWLFQIVADRPDVLQKIREEQLAVRNSDMSTEMNIDLIDKMTYTNMVVKE
                     TLRYRPPVLMVPYVVKQSFPVTAHYTAPKGSMLIPTLYPALHDPEVYENPDEFIPERW
                     EEGSPANAAKKNWLVFGCGPHVCLGQTYVMITFTALLGKFALYTDFKHKVTPLSEKIK
                     VFATIFPKDDLLLSFKRRDPLTGQIVE"
     gene            complement(<187731..>189131)
                     /locus_tag="HG536_0G01260"
                     /db_xref="GeneID:59327508"
     mRNA            complement(<187731..>189131)
                     /locus_tag="HG536_0G01260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285045.1"
                     /db_xref="GeneID:59327508"
     CDS             complement(187731..189131)
                     /locus_tag="HG536_0G01260"
                     /inference="similar to AA sequence:RefSeq:NP_013727.1"
                     /note="ancestral locus Anc_2.561"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140941.1"
                     /db_xref="GeneID:59327508"
                     /translation="MPKDNLLFKLDNLEYQYHYANGDLSSFRPRLGGIAKLYNAKGKK
                     SSKRVTKLLSNINLEQVAQQLDALRLQIFNNKVYYLEKNLRSLLVKNLNQYRPKKNAK
                     NDFTPLIAKIRDEYGIEHFAELVCKSKTIKVSIAKVVPSKKVSVPNWFANHEFWKVHN
                     DKKNAFNPSRVWNEVLMPNKFDQLVSTTMNNEKCRTLFSSFDSGMNVFLGINRQMESK
                     KEDNSVEKDQEVVTDASETTDTQGENEDPGDVVELGEDLLKQYDGLLGDSDEEEDDFE
                     AATLNPDVNYNEMTDEEPDHEDDDADIEAEGGVFDSDNESDQNRGRARLPELMAGYYS
                     GGDSDEDDDRVDDKVAREQISTKEKRKNRRGQRARRKIWEKKYGRQAKHIQREIEKEH
                     QERKRRLEEYEERVAKRAAKAKKLETQTAEPTHVNQTKAIREREKTEHPSWIAKREAE
                     QKLKNTKFQGRKITFD"
     gene            complement(191449..191519)
                     /locus_tag="HG536_0Gtrna15G"
                     /db_xref="GeneID:59327887"
     tRNA            complement(191449..191519)
                     /locus_tag="HG536_0Gtrna15G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59327887"
     gene            <192644..>194173
                     /locus_tag="HG536_0G01270"
                     /db_xref="GeneID:59327509"
     mRNA            <192644..>194173
                     /locus_tag="HG536_0G01270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285046.1"
                     /db_xref="GeneID:59327509"
     CDS             192644..194173
                     /locus_tag="HG536_0G01270"
                     /inference="similar to AA sequence:RefSeq:NP_013726.1"
                     /note="ancestral locus Anc_2.560"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140942.1"
                     /db_xref="GeneID:59327509"
                     /translation="MGDNHAGGMTVSTAPVEETKAKSAAAGKVQGDSSKPDNPFKPEK
                     IMQLAILGITLHLVWNKLYYSDGEYRVLFHNGLIVAVAVLAGAFSTYRHGEANSSLLP
                     KFEIIYLVYLTFMMVILFDRAHASVNFGLVLNCINMPEAFKLGAQAIFVLLNESPAEL
                     DEKLRHLLAICLNYALYTILANISQLKSLDAIDCNLFSILLTNVLFIHEPVESIYFQV
                     LRGTMWAFLTIVGVNYTIDLILAPLLNTYVKSAVLFSIFIIGFPALVRKLLTIDNHDS
                     LEWLISYITTSYTRQRILTIWLASLLTLIPNVLIFKSSFTLNSSRKIWHFLVLILIAK
                     PFEIDPNFVKISLAGSIVLFLSVEYLRYLKLEPIGGYLDSKLRLFADYRDDKGPIIVS
                     YIYLILGIATPLLINNSPVGLISLGVGDSLASIVGSKWGRKVWPGTNKTLEGTAAFIV
                     STVATAAIFKRYLGYFKHISLTNLSVICTLCGLLEGNSSLNDNILIPAFMLITEELFT
                     D"
     gene            complement(<194286..>198071)
                     /locus_tag="HG536_0G01280"
                     /db_xref="GeneID:59327510"
     mRNA            complement(<194286..>198071)
                     /locus_tag="HG536_0G01280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285047.1"
                     /db_xref="GeneID:59327510"
     CDS             complement(194286..198071)
                     /locus_tag="HG536_0G01280"
                     /inference="similar to AA sequence:RefSeq:NP_013725.1"
                     /note="ancestral locus Anc_2.559"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140943.1"
                     /db_xref="GeneID:59327510"
                     /translation="MTAEETAKDQEVKLYIKLPCSSTSGSRKNQQESNQLELLFTKDA
                     KVQHVLDVIAVTQATKFLTNVDLVAGKTVLKDNTTLAEIAGNEKTVKLQLQNRPYTTR
                     DALKHILTLREYLGFTPETSDGLSEFATSAASKFFELPLSAVKEKSKQEESEAADGDA
                     ESSKKLELNVTDEEKAQFVKLVHEIFGSISSSSACEVNASQSSIITPCLRSLCLSAYN
                     PVPAFYRTKGHLLYLQAVTLEGETLQITCIPSGFYVNKSTNSKFDPSPRTAEDGSFIA
                     TQHSLYDLLCLSSKKLSSRVSAFERKVNHIDTAAYVKPVNTLLHKPWIVSTASADNGD
                     YIRLQLDSLKFDSERNFNDEFQAIKDLPIQNIQSRMDSERLLSKIVHEFSVAATRGAM
                     SIFYHDLISMNPEAPAEEQIYLKEGIFYSFVTDVSGNYMEKGGNDAARAASNQDLRTI
                     NLLNRLNTQDLRYLLTAIIDFGGNRILAQTPVPGLLSTMGTQVIRDPETGKEVIEDLP
                     NEIAVSYGFDEAANRVVGSEKFDAIIQKEFSKVFHLTPHKVDGAQISFSSQSKGIVGF
                     DKRHYILDLANTYPLDIKFVRECFDNANAEKRYPHRQTLLRPELVEKWWHHKREAEGL
                     DYKTAYEDGKFSFNPDAYHVEGVEDPVVDEISDYLHDVVLPSLVQDYAAGNVAAPYNG
                     EHVVDTLHINGINVRYLGKVIHLAKDILAKQSQEYEERLKSIAEGNKEHEEWERNYLL
                     KVEKLIKERQEKINKYVQDGKEVPKELTENIKLDDSEIRKPTKEEPFIINRDELLPLI
                     HVCEIEIFARATKHVLRKYSKDLPVFAISALVCFVFNLLFGAEFNDSPHAEDVDCYRA
                     EDFKFSSLTRSSLLSEIFEQAFLRFRYELPEDWMDQHKKAPLFLMRAICYKFGIQIIN
                     RRYFFNKEEFENFKQSQDKKTRNKLITPMNTFSIDDFIIIPRVKSTEYNSLVSDELWA
                     EGAATIKDDQSLALKFLSQAISVKEDVSTVLHQSVAEKYLSLSTIYNNIGKVPEAVAF
                     ARKSCIIYERVCGIDSFEMLRALSNLAILELSGGSPLNAAVVYKRIVETVQSFDLTAA
                     HHPIVVSALNHLEQMALGMRDPKLAIEILKKLSELIVALDGNESLAFGYVESRVGNLY
                     ATLDDMPRALEHISSTKDIFVRELGLNHELSAQAKQWNEGLTNLIKNKQQQKMLQKQK
                     AAANESDFKKQSKAKKDQAVPEIANKSVDELLDFIEGSSDVTSSKSKSRKKGKNKKK"
     gene            complement(198831..198902)
                     /locus_tag="HG536_0Gtrna12E"
                     /db_xref="GeneID:59327880"
     tRNA            complement(198831..198902)
                     /locus_tag="HG536_0Gtrna12E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59327880"
     gene            <199082..>199756
                     /locus_tag="HG536_0G01290"
                     /db_xref="GeneID:59327511"
     mRNA            <199082..>199756
                     /locus_tag="HG536_0G01290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285048.1"
                     /db_xref="GeneID:59327511"
     CDS             199082..199756
                     /locus_tag="HG536_0G01290"
                     /inference="similar to AA sequence:RefSeq:NP_012883.1"
                     /note="ancestral locus Anc_2.558"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140944.1"
                     /db_xref="GeneID:59327511"
                     /translation="MDYVRKAIWGPDPKEQHKIIKSTLRRNGRSIDKSLRDLSILQNK
                     TQQLIKRAAKKNDVKTVRLYAKELHAINKQYSRMYTSKAQLESVGMKIEEAFRMRTLS
                     NQMADSTGLMREVNSLVRLPQLQGTMIELEKELMKAGIISEMVDDTMEAVQDQDEELD
                     EEVEKEVNRIVEQYTTQKFEKVDHVPIAEPPSIEKEEEVPEDKIDEEADNMLSEMRER
                     LKALQS"
     gene            complement(<199834..>200946)
                     /locus_tag="HG536_0G01300"
                     /db_xref="GeneID:59327512"
     mRNA            complement(<199834..>200946)
                     /locus_tag="HG536_0G01300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285049.1"
                     /db_xref="GeneID:59327512"
     CDS             complement(199834..200946)
                     /locus_tag="HG536_0G01300"
                     /inference="similar to AA sequence:RefSeq:NP_011843.1"
                     /note="ancestral locus Anc_2.557"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140945.1"
                     /db_xref="GeneID:59327512"
                     /translation="MKRGTGSSLSGRLQLSEEDVQAAEALDVLRNSHGQREHLMINVQ
                     GDRVDDKTGVPLQQSSDSLLDRVRRNSVISNVVSLYEMKSKKRTASAVSNNTEDSAKS
                     GSDDRSSDRDDCNAFVEDEQSRKESAVSKRQKITDVIAKSKGNLKEYQLNMSIESKKR
                     LIACLHLLKLANKQLTDRVSVLQEQVERERKNKKTNKRMKCEIQEGDAEENGDNDDDE
                     SEDEYFDAAESVDEQSKVIKMEVVGTVKKVYSLISKFAGNSLPEPARSQVRQTLLNLP
                     TNWTISVNKSSLSRKAHRSQKHLSANGKILILAEESLNVVRNVMQVVDCSLGRAEEWV
                     KQKQEVKELLKERFLQQQLKMQIREQIEKERQEKQA"
     gene            <201905..>203221
                     /locus_tag="HG536_0G01310"
                     /db_xref="GeneID:59327513"
     mRNA            <201905..>203221
                     /locus_tag="HG536_0G01310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285050.1"
                     /db_xref="GeneID:59327513"
     CDS             201905..203221
                     /locus_tag="HG536_0G01310"
                     /inference="similar to AA sequence:RefSeq:NP_116669.1"
                     /note="ancestral locus Anc_1.374"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140946.1"
                     /db_xref="GeneID:59327513"
                     /translation="MEEADVNSYGNFKEPSKVDGHRVSKLLHRLSGQPESFVNKKDYI
                     FGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGNDVQLQLLYDELKILQKLDHP
                     NIVKFKDWFESKDKFYIVTQLATGGELFDRIISKGKFTEKDAAKIMKQILSGVQYIHS
                     KNIVHRDLKPENVLYISPSDDSPLVIADFGIAKELKSGDDLIFKAAGSLGYVAPEVLT
                     TSGHGKPCDIWSVGVITYTLLCGYSPFVAESVEGFLEECTAERNPVKFQKPYWDDISV
                     DARKFILRALVLSPKRRPTASELLEDPWIVNCTHTKDILPSVKRVCDARAKFRDAVEI
                     VKLNNRIAKLRKMYCKGDEAETDIEENDSSSCMSAETLSSLKNLSLSEQSTNSSCLSE
                     QEKKLKSALTQDAFAQLVRAARKNQEKVMNYKEPSQNSSNAASDSV"
     gene            complement(<203398..>205890)
                     /locus_tag="HG536_0G01320"
                     /db_xref="GeneID:59327514"
     mRNA            complement(<203398..>205890)
                     /locus_tag="HG536_0G01320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285051.1"
                     /db_xref="GeneID:59327514"
     CDS             complement(203398..205890)
                     /locus_tag="HG536_0G01320"
                     /inference="similar to AA sequence:RefSeq:NP_116668.1"
                     /note="ancestral locus Anc_1.373"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140947.1"
                     /db_xref="GeneID:59327514"
                     /translation="MSDAVDHSDLPQDKSSAVSLQTGTPDVPEKKDNGSAKDKKMGQF
                     TFDDFEHIRAVDSPQDFSGHGIGLRRSKRIPQLRSNKEMQELEEEAAAAEERERRAKL
                     AQRAKARASERERLAKEKGKSSAGDSKDNAKNGTATKTAGTPELNEPPVTENNWTPNM
                     PLLSSDFRTHHSVLSRLKNPNMRPIPYAGDVVKLMSFVNKFHLFFDSELLNLSFQDFE
                     IGLDLYPGSQTGTASGMRGTDSQRTLFYQDFIPVKNVVTAQDKMNLLFMTLLKLTFST
                     SKSTEIQTKAQPQATMHQLKTSKKVFTTLVRQLRDHARSWGYPKEWRNNVVSEEELVK
                     PQSRLFEQDDNGSPVDPKNPEILTSNIYTWYHHEAVPLEKDPLQNPDLEKKGILALEP
                     RDRIICLRALTDWCGAQSPKIRTETYHLSHFKRDPAFGIQTSHAPRYLVEGPDMTYAQ
                     FNKLCSVIQSRYEIRSRKKHVKKALRNGRRPDLALKLNILKDIKGRLQEVPKEDRDET
                     NISLYNKWSKLFDGEILDNPLSDPYEDELYKLRQQEFFIGRVPHIGDFFLPRLQTYPS
                     SPLISTFLDLRNLESLFQDYANGSIDAFTLFENHGQTMSCQFKILYRDTPTMLRDVAA
                     GKYSGNNYWYEMCHDCKTLEEFLEFLDYKITPGDPSQDKPTGQEQSKESQGENVLNET
                     PAAESEKPKETSEKKVRGMTSTSTINKHPLPKEARFNLARKKLKYLKDFLSGMLPVLR
                     VFEQLKDQYGFMKPGKRLLRRSQRRGVNYDNGAVGDTEDLDDEYIDDNSNEEDGSDES
                     SELSEVDEGPEREVKKARLETREARSTRRSLR"
     gene            complement(<206151..>208436)
                     /locus_tag="HG536_0G01330"
                     /db_xref="GeneID:59327515"
     mRNA            complement(<206151..>208436)
                     /locus_tag="HG536_0G01330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285052.1"
                     /db_xref="GeneID:59327515"
     CDS             complement(206151..208436)
                     /locus_tag="HG536_0G01330"
                     /inference="similar to AA sequence:RefSeq:NP_012890.1"
                     /note="ancestral locus Anc_2.545"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140948.1"
                     /db_xref="GeneID:59327515"
                     /translation="MEIDGNTLIFIIIILFLFFSSPGGDGVSSQYEFNQLQRLRSQWS
                     TEYSEFQEMHYDSNFKNITGLKLAFQDVVDDPGVNATYPLPSKDYSHWSQDQKYLLLP
                     NEVISHVKDHVWTTRNRESPDVFPPNITSTLLGHLQLVSNNKYPRLPMPVEKFYDPPT
                     EFSDVVPPAGDRYLDDEKLSYGEIHNVTFDNGEISVQVTHLDKVYNRFGNGERTYFNS
                     QTDKWKLLNLRLDFSDKAEHEKHSLVADAVYDLKNGRILAMTQSAKFHSLFAFPHYMN
                     LQDDTESKENFNSLKKLINEYWNASNFVETLTMGNLQDWHDNAVYKCEYVAFFQLEPW
                     NQYTPDQLKMIDEELNWPLGRPANLSLVPPVAFKSGLLYSPDCGLELKFGDVEGKRYE
                     IQMRSIRTHLLFGIGLFIAQIYLLLCQMHHTNTPSSVSKISFYSFSMINLVDGSLATL
                     YFIAASVLPELYLPLVTSSFTCFILASIFETRYLILVYASQFNERNVGILTLLRRNNE
                     SEREGATDTGNTVIPDEASISGTLYGRFFFTLLSFTLLTLSSTSWPRKVRMVFEYITI
                     CVLNSYWLPQIFRNAIKGTLPRRSRIRNEALGVQRQNKMPLLWKFIIGTTIIRTLPVV
                     YVFTYSSNVFRHHRDVRFVVILCLYLLFQIAVLYSQDILGSRWFLPKMSIPEGYSYHK
                     PMSAQELMEHGSSANHTVDCAICMSEVSVYVEDVPETHKVDLQTYMTTPCGHIFHTHC
                     LENWMSYKLQCPVCRSPLPPL"
     gene            complement(<208639..>210144)
                     /locus_tag="HG536_0G01340"
                     /db_xref="GeneID:59327516"
     mRNA            complement(<208639..>210144)
                     /locus_tag="HG536_0G01340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285053.1"
                     /db_xref="GeneID:59327516"
     CDS             complement(208639..210144)
                     /locus_tag="HG536_0G01340"
                     /inference="similar to AA sequence:RefSeq:NP_011851.1"
                     /note="ancestral locus Anc_2.546"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140949.1"
                     /db_xref="GeneID:59327516"
                     /translation="MSFQKKHTKTHSTYAFESNTNSVAASQMRNALNKLADSVKDNDE
                     LRNRFENELDSFFSLFRRYLVEKSSGNTLDWEKIKSPSEEQVIPYKALAEHQPESVSN
                     LSKLAVLKLNGGLGTSMGCVGPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLM
                     NSFNTDKDTEHLIKKYSANRIRIRSFNQSRYPRVFKDSLLPVPSHYDDPLDSWYPPGH
                     GDLFEALHASGELDALIAQGREILFVSNGDNLGATVDLKILNHMIETGAEYIMELTDK
                     TRADVKGGTLISYDGQVRLLEVAQVPKEHIDEFKNIRKFTNFNTNNLWINLKAVKRLV
                     ESTALQMEIIPNGKTIKRNGHEINVLQLETACGAAIRHFNGAHGVVVPRSRFLPVKTC
                     SDLLLVKSDLFFLEHGALRIDPSRFGPNPLIKLGSDYKKVSDFSLRIPHIPKIVELDH
                     LTITGNVFLGKNVTLKGTVIIVCSDGQKIDIPNGSVLENVVITGNLQILEH"
     gene            complement(<210716..>213787)
                     /locus_tag="HG536_0G01350"
                     /db_xref="GeneID:59327517"
     mRNA            complement(<210716..>213787)
                     /locus_tag="HG536_0G01350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285054.1"
                     /db_xref="GeneID:59327517"
     CDS             complement(210716..213787)
                     /locus_tag="HG536_0G01350"
                     /inference="similar to AA sequence:RefSeq:NP_012886.3"
                     /note="ancestral locus Anc_2.547"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140950.1"
                     /db_xref="GeneID:59327517"
                     /translation="MGNRSRSSSNGSVKSELNGQEQPLVAEGSGGSAGGDGSNSPPNS
                     RRRTKASRACDYCRKRKIKCDYSEERGICSSCSRNGEKCSFERVPLKRGPTKGYAKGH
                     NRAQSVSSQQEEADMPSPPSRPASVLLPPLAQYLPQAGGAKTASASATPAANVAGAGT
                     MAQQQQFWKVPYHEFQGQRRGSLDSMQSDLSVGKSLNENLLYTTASGSQNLGSPAVVS
                     NTGGNGGDSNMAYWSFVRSSGSMIGPEEFEEMRRKSGSFPPIFRHSSNASAQQQTPAA
                     LYPYSQFTQQQQQQGKPPMNPSISSFGQYGANGFESRQGSIVSENMSPSAPAFYQGVN
                     MALSTSQNQRIIGTSVPQQQQPHRPSPAQSQASTNRAENIDSESPSAGKAPKRRKRSV
                     SERRTRRADSSGSKTSESSSIRPPSCESARTAQRNGIIYGQVSDVDLIDTYYEFIHVG
                     FQIIPLNKKTLTNEILLVNTQPISGIHEINNYVILWFRNSLELLVRISLKKRYNQFFQ
                     APRNDGTYDEKSDANLNSNSSGNNRRDYENDESLEDKSVFISALNECLQKIVDIHPRF
                     RESKAQISSKIKIIYLSTFVLLNYILALVGYDNSFVIGMSVTIFKEFKVYEQLVYEEI
                     EDSAEGEMSIIFKRLYVLLIILDSLQVCCYGGPQLLNFPIQGCTERLFQTGTQESKWD
                     IDDDPIRTKCILQSLKLGELINDLVSNRRSVRDLTGANLIWEPSVQRGIAQQMDQDEP
                     VTIMQIFHDFLFVKNGLTNNLLSLKDLKTNKFQELTIQSCVNLTGLICNLISLTLKIL
                     TLIMKLNPNNRIDYNYRPRTPLSNEDSTKDQNTSTETISQSSASLNRNGSDFYQKLLG
                     LQKNNDNGLSEVMKGVISPYCIPILHEIQNTNELIKQIPTLLIGVVMTISNKTPLAGQ
                     GDFAKPQELVVELSNSMNEVVQITSLLNMIKPLRLLGQDPGTDSSWRYLTGNAGYDKS
                     IIERLYESRNRRPEGQPTPEDSLINPEQLQILKTLNKVGWKLLDDKELGWF"
     gene            <214429..>215379
                     /locus_tag="HG536_0G01360"
                     /db_xref="GeneID:59327518"
     mRNA            <214429..>215379
                     /locus_tag="HG536_0G01360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285055.1"
                     /db_xref="GeneID:59327518"
     CDS             214429..215379
                     /locus_tag="HG536_0G01360"
                     /inference="similar to AA sequence:RefSeq:NP_011850.1"
                     /note="ancestral locus Anc_2.548"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140951.1"
                     /db_xref="GeneID:59327518"
                     /translation="MISNSSGRNIDPCVVGESTGQLANRFAAMEELQARHRKEVKDLQ
                     NRITGMKKQATKSTRKEVNSKCASLQEALRIRHEKEIRELDGSVEEVDEKGCTAEELL
                     EQLSLERSEELAEPKETNVQGPQRRRRNRQRERLAKREAEITRIKEEARLEASQQPDL
                     KKIEQDAIDQLCSVNRLKQYDIQPDGHCLFASILDQLQLRHGESARDLSVSKLRSLAC
                     AYIRQHKDDFIPYMFDEETCQPRDIDVYTEKMESTAEWGGELEIVALANQFDCPISIM
                     MSGRPKHVINEKGVNPELKLVYYKHTYALGEHYNSLHDDI"
     gene            <215494..>216717
                     /locus_tag="HG536_0G01370"
                     /db_xref="GeneID:59327519"
     mRNA            <215494..>216717
                     /locus_tag="HG536_0G01370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285056.1"
                     /db_xref="GeneID:59327519"
     CDS             215494..216717
                     /locus_tag="HG536_0G01370"
                     /inference="similar to AA sequence:RefSeq:NP_011849.1"
                     /note="ancestral locus Anc_2.549"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140952.1"
                     /db_xref="GeneID:59327519"
                     /translation="MSSLRKVFLGRPSNNLTSGIVGLANVGKSTFFQAITKSQLGNPA
                     NYPFATIEPEEAKVQIPSPRLDHLQKLYQSEKKVPATLTVYDIAGLVRGASQGQGMGS
                     AFLNDIKHVDGIFHVVRGFQNTDITHIEGSVDPLRDLSVVQDELVLKDLEFLENIKEK
                     LSKKMGRTAKNSHEFVELEQELNFLSELEEHLYEGRKIIHFKKDWTPFEVSTLNKHNF
                     LTAKPTLLLLNVTPEDYILQKNEFVADVKRWIKEFAPGDELMLFSAEFETLCAKHSSD
                     SDPFKKYLHEQLGLDPSTTWAAAESALPQAIVKMRELLGLISFFTCGPSEVRQWTVRQ
                     GSTAPEAASVIHTDLQDTFINANVIKYDDLAQLEPPFQESALKSQGKIKRVGKQHIME
                     DNSIVVFQAAGAKAR"
     gene            complement(<217357..>217716)
                     /locus_tag="HG536_0G01380"
                     /db_xref="GeneID:59327520"
     mRNA            complement(<217357..>217716)
                     /locus_tag="HG536_0G01380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285057.1"
                     /db_xref="GeneID:59327520"
     CDS             complement(217357..217716)
                     /locus_tag="HG536_0G01380"
                     /inference="similar to AA sequence:RefSeq:NP_011848.1"
                     /note="ancestral locus Anc_2.550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140953.1"
                     /db_xref="GeneID:59327520"
                     /translation="MSDFQKEKGEEQEQPQIIKIRITLTSTKVKQLENVSNNIVRNAE
                     QYKLVKKGPVRLPTKVLKIATRKTPNGEGSKTWDTYEMRIHKRYIDLEAPVPIVKRIT
                     QITIEPGVDVEVVVAKN"
     gene            <218167..>219483
                     /locus_tag="HG536_0G01390"
                     /db_xref="GeneID:59327521"
     mRNA            <218167..>219483
                     /locus_tag="HG536_0G01390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285058.1"
                     /db_xref="GeneID:59327521"
     CDS             218167..219483
                     /locus_tag="HG536_0G01390"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140954.1"
                     /db_xref="GeneID:59327521"
                     /translation="MTVCHPVKYFKSIESVRETTSVVYRYAKERNEGNYFKLNLSSMP
                     EVVEFLCGIIERDYGSEYDSIPPHGRWQHINAGGHSRLEDLVSQWLQDGVDEIEISRR
                     LVDLILISVLIDAGAGSMWSYQVNGETYSRSEGLAVASFHMFLDGALSDNAAQYPHRV
                     NGQRLKDMTMQEFCQGFQISKVNPLSGMEGRMNLVQKLGEALISNPKIFGPDARPGAM
                     VDYLHGLRDEKSNTIGLADVWNTLMDGLVAIWPKGRTTVEDQPIGDAWTLDTKIMASG
                     AQGLWRDNLLDSIVTFHKLTQWLCYSILVPLEAYGHKFNITDKSLQTGLPEYRNGGLF
                     YDFGVLELKSEHRKRGLELSKTLQSNDDIPTFTAEDGAIVEWRCLTIGLLDELLLMVN
                     QKLGAKLSLPQLIEAGSWKAGREIAAIRRPTTKGPPIELCSDGTVF"
     gene            complement(<219705..>221219)
                     /locus_tag="HG536_0G01400"
                     /db_xref="GeneID:59327522"
     mRNA            complement(<219705..>221219)
                     /locus_tag="HG536_0G01400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285059.1"
                     /db_xref="GeneID:59327522"
     CDS             complement(219705..221219)
                     /locus_tag="HG536_0G01400"
                     /inference="similar to AA sequence:RefSeq:NP_011846.1"
                     /note="ancestral locus Anc_2.552"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140955.1"
                     /db_xref="GeneID:59327522"
                     /translation="MQRLGLFSALLFLLNCLCVAANKENINQKDHQVCSGMYSKEDWK
                     GKVDPFISFNVREISEVGEDDPGMYVAIFDFQDFEHLGAILPDGSKYYICDDYAIELG
                     LCDESHKNEFIVKEVAYDPITGQNVTLSNQIMTFSQRTEGLHDTKYPVKQTGYYCVTA
                     FTRSSTTKFKATVNFRNAYGHLAASEVNKMPLYGLLAIGYVVAMALYSFAFWKHKHEL
                     LALQKYLLAFFVFLTAETIFIWAYYSIKNEKGDTAGLKVYMVFLSILTAGKVTFSFFL
                     LLIVALGYGIVYPKLNRTLMRRCQFFAAFNYALCVAFLIQSYMQKADSTSLLIFITMI
                     PLTISMFLFYFVILSCMGKTVRYLKEQRQVVKLGMYRKLLTIIYVSLLIVLAGLVLST
                     FVLVGMNAIEMIEQHWRTRFFFTDFWPSLVYFGVFVTIAFIWRPTDTSYMLACSQQLP
                     TDPENVADFDLDDLQSLGEPADEFDDTIRDEDMIFTDEEDNQPNNQQHGAQHPK"
     gene            <221748..>222530
                     /locus_tag="HG536_0G01410"
                     /db_xref="GeneID:59327523"
     mRNA            <221748..>222530
                     /locus_tag="HG536_0G01410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285060.1"
                     /db_xref="GeneID:59327523"
     CDS             221748..222530
                     /locus_tag="HG536_0G01410"
                     /inference="similar to AA sequence:RefSeq:NP_012884.3"
                     /note="ancestral locus Anc_2.553"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140956.1"
                     /db_xref="GeneID:59327523"
                     /translation="MFARVLRSSIAMRSGPRPSYLAQRWINVKTLTTPNENALKFIST
                     DGELLQDRGADSIEIKNTDEALVEHSKLAQQVFLQCPGVESLMIGDDFLTVNKDSLVH
                     WNQISPKVVELLTQALASGESAVSEQFHTVRKSVQVGYDVSVPKFELTEEEQEISDMV
                     DELIQTRIRPAIQDDGGDIVYRGFDPKTGTVYLKLQGACKSCSSSEDTLKHGIESMLK
                     HYVEEVEHVEQVLDPEEEVALKEFDKFEQKLQSKSLPESMQL"
     gene            complement(<222537..>222917)
                     /locus_tag="HG536_0G01420"
                     /db_xref="GeneID:59327524"
     mRNA            complement(<222537..>222917)
                     /locus_tag="HG536_0G01420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285061.1"
                     /db_xref="GeneID:59327524"
     CDS             complement(222537..222917)
                     /locus_tag="HG536_0G01420"
                     /inference="similar to AA sequence:RefSeq:NP_011845.1"
                     /note="ancestral locus Anc_2.554"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140957.1"
                     /db_xref="GeneID:59327524"
                     /translation="MNVDRAEGHPPAKNPEKMYNKLSKAVPVAITGYDLSKALAGLRH
                     WKLVNNVLTREVGFKDYESTWAFLTQVHMRSHLWGHHPTITTTYVNVKLELSTHDLQD
                     QISDIDLKMAKKIEEYIQVHKHNE"
     gene            <223018..>224637
                     /locus_tag="HG536_0G01430"
                     /db_xref="GeneID:59327525"
     mRNA            <223018..>224637
                     /locus_tag="HG536_0G01430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285062.1"
                     /db_xref="GeneID:59327525"
     CDS             223018..224637
                     /locus_tag="HG536_0G01430"
                     /inference="similar to AA sequence:RefSeq:NP_011844.1"
                     /note="ancestral locus Anc_2.555"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140958.1"
                     /db_xref="GeneID:59327525"
                     /translation="MSSCIFIVDENLEPLVSKNIKAVPNLQGILRLFKSAYKTQSAPV
                     ISAANFHFVHVKRDSLVFLAAIHTYDAGANIMSISTFLDQFHFLLKKYLGVQSLDRNM
                     VLDNVLLVMELIDETLDFGIVQVTDASIMKDYIRVKVNLPDDKIIEGLPDDDDDNDDN
                     DDEDRQGKNVDKSKSGEVSGKPNLYSFLQQTKRKTFSGKSSISGGSAQKSDDQNEEVY
                     NSYIARTTIMPVSWRAKGIHYGKNEFFLDVVEQVQYLMDFESKIIKKNLIHGKICCKS
                     YLSGMPKLTIALNKLSQQDDQFLSHTKFHECVSLEALNEKSIQFIPPDGDFVLCQYEL
                     KRHVRDQPMLKLVSFNVKPKLQKFKIQVSLSIETHFKARNTTSKLSLKLPLSRLFQEY
                     QIDLSKPARFKSDSGKVLFNLSDDFLLWEIDSMRGGHGETQLSMTAEFSLFNKKQYDE
                     EQQALRHSMNPPPLREGPKLEELYDQVHRESVKSNLASRLLTINFEIPYCACSGLQVE
                     YLKIVEDQLQYQSFPWVRYKTISDEEYGYFI"
     gene            complement(<224696..>226096)
                     /locus_tag="HG536_0G01440"
                     /db_xref="GeneID:59327526"
     mRNA            complement(<224696..>226096)
                     /locus_tag="HG536_0G01440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285063.1"
                     /db_xref="GeneID:59327526"
     CDS             complement(224696..226096)
                     /locus_tag="HG536_0G01440"
                     /note="ancestral locus Anc_2.556"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140959.1"
                     /db_xref="GeneID:59327526"
                     /translation="MALTRLTMLASRRTLNQWALLSQCYDKPPSKVPLMIQKDDENSI
                     IRCGLLQGSSDSQKSSTFLGALLADVYLSDQSWLEVLLNRRASSLKGPIKIQYGDRFD
                     IQCNEAIATLAVPSGFLKDHKVEFLEISEENAADEDNCHFYLDLHGESSTLCHKWPTI
                     SVKDTSKTGELPLSNEINSKQALEATLRFIRDKRSVNSYLSDLELSNFGNFSKRLAAK
                     IDDRKQIYADLGFAVLKNLENEDNSLAESYYLQSKKEEMLTDVESWRRRAHGELQDQV
                     VPLIQEFLKTYLSIGKIYTYSNTKFNLRVKKLIEEPLRDLPMQNNLYELRGRQRLLTP
                     LKAPLIDKQYFEKQISSVYTDVNRVINRSFFKLQLPLILCSTIGYVSEQFSLYSMGSL
                     ASLGIVLGLQRVLSSWELAGKNVQKRIYEDIRATIEQEYKRLMQEIKDKCATEETAQR
                     RKLDIIRALSSEESRS"
     gene            complement(<226514..>228619)
                     /locus_tag="HG536_0G01450"
                     /db_xref="GeneID:59327527"
     mRNA            complement(<226514..>228619)
                     /locus_tag="HG536_0G01450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285064.1"
                     /db_xref="GeneID:59327527"
     CDS             complement(226514..228619)
                     /locus_tag="HG536_0G01450"
                     /inference="similar to AA sequence:RefSeq:NP_116670.1"
                     /note="ancestral locus Anc_1.375"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140960.1"
                     /db_xref="GeneID:59327527"
                     /translation="MPRDLQNSLLFEVATEVANRVGGIYSVLKSKAPVTVAQYKDNYT
                     LIGPLNLATYQGEVEQIDWSSKEAFDEDLRPIQSVLFSMQSRGVRFVYGRWLIEGSPR
                     VLLFELASVAGYLNEWKGDLWSLVGIPSPENDVETNDAILLGYTVAWFLGELAHTDHH
                     HAIITHCHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCAAGNVDFYNSLSSIDV
                     DQEAGKRGIYHRYCIERAAAHTADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKF
                     QAVHEFQNLHAIKKEKINEFVRGHFHGSLDFDLDNTLYFFTAGRYEYKNKGADMFIEA
                     LARLNYRMKVSGSKKTVVAFIIMPAKNKSFTVEALRSQAVVKALENSVNEVTSLIGKR
                     IFERAIRYPHMGMHSEIPTDLDELLKNSDKVLLKKRVLALRRPDGELPPVVTHNMVDD
                     ANDPILNQIRHVQLFNHPSDPVKIIFHPEFLSANNPILSLDYDEFVRGCHLGVFPSYY
                     EPWGYTPAECTVMSVPSITTNLSGFGAYMEDLIETDQAKDYGIYIVDRRFKSPDESVE
                     QLVDNMEEFVKKNRRQRINQRNRTERLSDLLDWRRMGLEYVKARQLALRRAYPDLFKQ
                     LVGEELNDANMDALAGGKKLKIARPLSVPGSPREPRSNSAVYMTPGDLGTLQDANNAD
                     DYFRLGAGNDDDQDSDGDS"
     gene            complement(<229074..>231161)
                     /locus_tag="HG536_0G01460"
                     /db_xref="GeneID:59327528"
     mRNA            complement(<229074..>231161)
                     /locus_tag="HG536_0G01460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285065.1"
                     /db_xref="GeneID:59327528"
     CDS             complement(229074..231161)
                     /locus_tag="HG536_0G01460"
                     /note="ancestral locus Anc_1.376"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140961.1"
                     /db_xref="GeneID:59327528"
                     /translation="MDQATTASAAMSKPGQEQKMSIREIALDLTVFTLSNVNDAISFK
                     PQLCFEVPKQDYQMLKDNYISFTGTSIRKNRSRLFFLPTNVSDELQRLNPSIPEDAKR
                     VPSDGRIYYKNRLITELDYENVKRVEIACAFIAYTALNSFAHFETELPHSRMREAGFS
                     NSEAEADDSDDEMSAGESVSRALKKGNILGFRELGHLVGITPWHFHRVFKVITGLTIR
                     EYGQLCVEFIKKNKEIVNTCRVKVEQLKDVQRFSCLDDPSFLQDGSLQYAATENVVLL
                     HEYFIDPNKSKEFKTKKNGSGGSKGGGQQQLAKKESAAHDEGGASPLTHRSEIRKRRS
                     SVMYGRMQRASQSSITSNSSLYECLQTSPSGTSLRSPEYYLSNEEQHSDNDSDDSSGS
                     MLEAPSFNVFPSAIAKSVSPPGSSRKGSIISVGSAGGVSKKSSKRKSITGANIDAIQS
                     SMLHRRNRSDVCTINLNLEPLQPDSLDARLSPPPLPQQTNQLPIEFNSNIFGLKGAAK
                     MVVPAANENRVDFSIGPLDYNAISENLFETAHSKPNDASLLNVELLDQPALNLETLPE
                     TTTTNASNTPYGADNDLADLRGVPPMDDILDPATLLDSGLLTGNPAGISNLTPLSENN
                     AKIRDLDQEPFFSPFPAGEDDLLFDSVLPAADPLAIAEAGGRAGGVIASNSVRAPTVY
                     AASNRTNIDAFNF"
     gene            complement(<232012..>233604)
                     /locus_tag="HG536_0G01470"
                     /db_xref="GeneID:59327529"
     mRNA            complement(<232012..>233604)
                     /locus_tag="HG536_0G01470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285066.1"
                     /db_xref="GeneID:59327529"
     CDS             complement(232012..233604)
                     /locus_tag="HG536_0G01470"
                     /inference="similar to AA sequence:RefSeq:NP_116671.1"
                     /note="ancestral locus Anc_1.377"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140962.1"
                     /db_xref="GeneID:59327529"
                     /translation="MDRTKIISDSQRVATPRRSLDLDSIMVGIEEYLNEIDANEGEEI
                     KVNIVKDEDEDSVSAEKIVEDENEAEIALERETAIRERDHSASARPKKMLSDSEGPFT
                     AANKAEKFESSEEAIRKVENKNSATEDKANTEAETALTKSAGDVIVAETEANTPGKTA
                     GPVSEPVSSKIDARDALDIEPQEQKAQEAAAADAAVEDKEKSPVAQTITESDKDIDAE
                     QMGKADAPNSTASKEQEGGAKDSAAENKPENIVEDEADEYKAELNAEFKSQTVKSVSE
                     ISSDAGTKISTEIVKASDIVGDKDEDIAECKDDAVDLPAARDTNSQVSSREVEDAAPI
                     KDLKDEQVEDEPEHNAANLSEKEEHVKTQGPKTPIPELIEQKDRTDDDIEGKLNGSKE
                     NAENTTVEPQSILDQETEELLKQLETMEASTTNTATRAEIRAINERQPIYIYTSLAGG
                     GFHMIPRTNRLATILTANRIAFEYRDLGTDAEARSVWRSFAGGRTLPGVVRGRDDVIG
                     NWENVEDANENYALRELLYDSL"
     gene            complement(<233672..>234691)
                     /locus_tag="HG536_0G01480"
                     /db_xref="GeneID:59327530"
     mRNA            complement(<233672..>234691)
                     /locus_tag="HG536_0G01480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285067.1"
                     /db_xref="GeneID:59327530"
     CDS             complement(233672..234691)
                     /locus_tag="HG536_0G01480"
                     /inference="similar to AA sequence:RefSeq:NP_013358.1"
                     /note="ancestral locus Anc_1.378"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140963.1"
                     /db_xref="GeneID:59327530"
                     /translation="MNTNLNPDNNISTPSLVGVSVRSINDAHNPDFTDSSSRPNLHTA
                     SSSHVLNKITSQPSLVDASYTSVAELNREGALLTDEVDLDQVTNATEAENDDEKQKQL
                     QALKHKKQQQEKLKQKSKISIDSSTTSLKSMHSVDSRSLITSTDPIDDQINMSASSKP
                     GRRRAVTNDRHGSRNGQVKDDTIRNSYGEFIENKSHKPHLAGGESYQSCHESDVQSER
                     DDERPGRRSRRSLDNQSSSTEYLRSLSRSLSRDPARGRNGSTNMNDVTEKLNNARLYS
                     TNNYSISQADLENAPHIIQQTLAEEEEEEENEGALMDDQGNEEYSKELEEAAEAVEQN
                     AARHL"
     gene            complement(235284..235354)
                     /locus_tag="HG536_0Gtrna16G"
                     /db_xref="GeneID:59327889"
     tRNA            complement(235284..235354)
                     /locus_tag="HG536_0Gtrna16G"
                     /product="tRNA-Gly"
                     /note="codon recognized: GGC"
                     /db_xref="GeneID:59327889"
     gene            <237690..>239276
                     /locus_tag="HG536_0G01490"
                     /db_xref="GeneID:59327531"
     mRNA            <237690..>239276
                     /locus_tag="HG536_0G01490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285068.1"
                     /db_xref="GeneID:59327531"
     CDS             237690..239276
                     /locus_tag="HG536_0G01490"
                     /inference="similar to AA sequence:RefSeq:NP_011355.1"
                     /note="ancestral locus Anc_1.379"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140964.1"
                     /db_xref="GeneID:59327531"
                     /translation="MSSSLWKRHGETHYANIQYGYYVLGISALYFIFLMVMRKVLPSR
                     PATSSDSKFKKIIYGLYSIDPAINLCILLVLFLTPFYGHYSLAHQTSVYIKRLGRLSY
                     VLLTLNLILNLRPNWLLYRDYTYTDFIPLHKWLSRIIVLIAMVHGILFLIYWGVKDER
                     SVLSELKKAKNFVGLIVMIEAGLLLLFSLGPARRLNYNLFFATHNIFTLSLIFLTAIH
                     ARPGVGVPYLGINIFILAVHLISKTVFARSTDLLGKYTDYRNTNLVAVQLPRAALADA
                     FEPGCHIRISPFRRINPLYWLLPSHPFTVASMPSDSTVDLIIAENKHPRSFKLEMGAR
                     YTIINNYNPAIPRLCLSSATRVSIVCGGSGISFGLPLYRYFKELHPVDYLHFVWLTRD
                     RYQLKVLEDLLKESSFDGSADFHIFITRDLDSMEQEQQEQDDIDLEFELESFTPEQLD
                     ENGAVVGDTASSMGTKIKAASVNLGRRINWAVDLSNFVDASVTDTTWLLTCGPITLID
                     AGRQYAAGNGINFASEIYAL"
     gene            <239545..>240891
                     /locus_tag="HG536_0G01500"
                     /db_xref="GeneID:59327532"
     mRNA            <239545..>240891
                     /locus_tag="HG536_0G01500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285069.1"
                     /db_xref="GeneID:59327532"
     CDS             239545..240891
                     /locus_tag="HG536_0G01500"
                     /inference="similar to AA sequence:RefSeq:NP_014358.3"
                     /note="similar to Saccharomyces cerevisiae YNL040W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140965.1"
                     /db_xref="GeneID:59327532"
                     /translation="MKRTYVGSLACQRDSSLLKGFQTTVVSCEAVDSKDNKEGPPMYH
                     VELHDTILFPEGGGQPSDTGVLKVLDGPNANESVVVSHVAREGLHAKHCVDNLIEPGT
                     KVEITVDSGRRIDYMQQHTGQHLLSALLEQKYDLRTLSWSMGEIPNDKKGPLEINDYF
                     NYLEIPRRMSEQEIRDLSDAMNHYILVEPMSISIREATREAVGSLNTDKIPDDYDLSK
                     GIVRTVHIGTMDANPCCGTHLKETGQIGSILILPNQTTVRGTNSRLYFMCGQRVNKYG
                     EMASEILTKTKAKLSCQEAQIPDKIEKQKDQIQKLSKREQYWMRELAAYESKAIIEQL
                     KQNRKAYLLKDTFGTLEYLLHILKEIRPACQGMPNYILLLCGRDRQTETGSIIILSTS
                     GEDISRISGKLSSCFRCIKGGGGSSGGKWQAKMAKVTNQEWTALEEFVAFEFKLGT"
     gene            complement(241648..241720)
                     /locus_tag="HG536_0Gtrna12A"
                     /db_xref="GeneID:59327879"
     tRNA            complement(241648..241720)
                     /locus_tag="HG536_0Gtrna12A"
                     /product="tRNA-Ala"
                     /note="codon recognized: GCA"
                     /db_xref="GeneID:59327879"
     gene            complement(<242445..>246137)
                     /locus_tag="HG536_0G01510"
                     /db_xref="GeneID:59327533"
     mRNA            complement(<242445..>246137)
                     /locus_tag="HG536_0G01510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285070.1"
                     /db_xref="GeneID:59327533"
     CDS             complement(242445..246137)
                     /locus_tag="HG536_0G01510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140966.1"
                     /db_xref="GeneID:59327533"
                     /translation="MSGGSVIASTSNSASCGGKLKRKRNRIPLSCTICRKRKVKCDKS
                     RPHCEQCVKTGVAHLCHYMEQSWAEEAEKEISKEAELKQLRERVKSLEESLSKVHSVC
                     SHTPDSNILVLDNHNDISSDDSKLLSQSNKYNNDELDLTRQFDMLHLKNNGTIHLGAT
                     HWLAIMKGDPYLKLLWGHIFSMREKLAEWYSQKRKNPRQKGLGKPGAPKSKCPIDHSG
                     MGFSSNRLEDTPSPLQTLPSKCPVDHAAMSKCPVSHSVSVKVEHEAVLPRPTSLPSFQ
                     NLASRCPVIHTDPSANFKEPQMPQPQMQSLQAGNRVQSLDQILARIAELLPPKRIIVM
                     FMEKFFKQIYPVIPIIDEQNFKNHMNHILTLRCQADESDKVQRLRMTKLSDYCNMGIL
                     VIILRLTWLSLPSNACEINLGSHCSSFLMPHVNTATVTQAKEETLLIKYETPVEALEL
                     IREHLIKFDQISSISNSNVNLTTVQFAIFYKLYLMCWANDNPSHNTASDPLVPGTTNN
                     GGGQDNETHQVLLSSITQMAFSCGLHRDPDNFPQLNAVSHGNTENPSKVVVGNGNPAS
                     SSAKMSKEAQTSTERFKHTWRKTWYYIVSLDVQQSLSLGTPRLLRNLRDFSDTKLPSA
                     SKIDYVRDIKELVIVKNTTLFFQIDLCVIAVLNHILNVSLAKNVRKFELDSLISSLSD
                     LTHGKRNICDVVTSLINRGLLHTAEGMVDQNPDEVYGLPSLEEILSQQFSSSSETDVD
                     KKLDLAHESATRALFFSKHLTLRMLLYLLNYILFTHYEPMAVEDPGTTAIAKEYAQET
                     LNYAMDGYRNCMLFFNNLKSTGSMSSMFSYMEVLLAPQCLDIGHRALQFIVCLILRAK
                     CGPLTGMGEGAIVNSNAGSSSSEDEHEVSTTRKESSVELTDDVAKDISLDAGESLAET
                     LLERMALFHKMTRQMCVKYHYATRIMKSTGFFLALLKHPNAKLKNERKSGLDLGKKPV
                     FSNFLKNVPSLILSADGEQLKRCPVYQDAVGFVGPRTASNIGQTTFPHGNARFGAQLP
                     LLRSYKPITYTSSNMRRTGELEENEQKRRRLDTEPRVEPLKLADLVPAALPPMQPISP
                     PAMTPNGMVSELRAPLPSLGRIAGQFTPLQVQNENAMYVANANGLGVPKDSATGGLVT
                     FTSPVSDTSSSVNYTPAFEDFLLQNSNFNGIMINPSSIVEAVGFHNFDSTDLPIGNEA
                     VDFLPIDNAAIDGLSELTGTEFPAWE"
     gene            <246917..>247954
                     /locus_tag="HG536_0G01520"
                     /db_xref="GeneID:59327534"
     mRNA            <246917..>247954
                     /locus_tag="HG536_0G01520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285071.1"
                     /db_xref="GeneID:59327534"
     CDS             246917..247954
                     /locus_tag="HG536_0G01520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140967.1"
                     /db_xref="GeneID:59327534"
                     /translation="MNSKIVEDAEVEEFFSHAQASTFLSFLEELRVALERYSANPSII
                     PPRIVGNIPSGSTLHMYMPVIDDVYSGVKTLGYNASSHLGFVGSINITDAESGMLYGT
                     LQAKQITAIRTALASCVGLSSQLDKFEDTDVINCTVFGSGLQAFWHIVCCVSLFSGSG
                     KRFNVTILYRTREMDVKQFENICAVNESIMQLTFNQVKLSDNVLKSRAVADSHVIFGC
                     IPSEAPNLLYRDLADVETKVSHTYISLIGSFKPLMHECDQALIEEFQRQKIRILVDSK
                     EHCLLEAGELIDCDVKEDQLQEIGHLSRKPLQAIRCGQNNRKISLCKIVGLSIMDICV
                     GKKLLELSNSD"
     gene            complement(<248325..>250361)
                     /locus_tag="HG536_0G01530"
                     /db_xref="GeneID:59327535"
     mRNA            complement(<248325..>250361)
                     /locus_tag="HG536_0G01530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285072.1"
                     /db_xref="GeneID:59327535"
     CDS             complement(248325..250361)
                     /locus_tag="HG536_0G01530"
                     /inference="similar to AA sequence:RefSeq:NP_011613.3"
                     /note="ancestral locus Anc_3.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140968.1"
                     /db_xref="GeneID:59327535"
                     /translation="MGNSDIALLENSPNASVFHTVLKSLNERDELLSLVEILPIIKKV
                     VPIYPSLRQESRKILLNLLSRNFNFIAQLVSFTSSLPEKQAEKRIYKSLIVKLIVENN
                     QCLLNYLKQCATNKILYNDMKALLFGSKLFNCISTEMDITDYLRLLREHWRYALTSTS
                     QQELMQRGNQLGELLITMLTLHPVLTRVIMAEEFLLTTTEFFKSLKIIVHNSTPLNRQ
                     KLLKNLIYPYLDVHATRHNCQSVYSILRELAIGDSVDGYYILRLNSPVLQECTVRLLS
                     SNSSARLLRLLLQMFAKIDIASDEKVCEILVMVLKYSCNSDLKSRIGTDTKFLDGVTA
                     RLMHKDHVVRERTMFVAKVVSNGDVKYDSDFVIDIPDLKLSDDNLTIDFSSLSTSATD
                     PPNMSRPSTQPPVDNSFSVDSDDDDSDYDEKGREIVFLKDLVMEFARLENKRGISPLS
                     LLKLTVKLVRQKKDFPSEVSYYSTGLLSSIACLNNNLDEPHFEQGRINALVSMLVVTP
                     DKATELMRIFFTSELSLQQKISILSSFGLSARELRGFDDESIAKPQYDFPTSRLPWDK
                     PENASIDDHQLAYGQDLSMQKVVWKSKKLTTSYKKEPMKNRFRRYAGLFFYPLAQAWL
                     DGINLGTFDELFKSHYLMTLHIIYRCADPVHDYDRITELMKEVLADASQQGIKI"
     gene            <251103..>255944
                     /locus_tag="HG536_0G01540"
                     /db_xref="GeneID:59327536"
     mRNA            <251103..>255944
                     /locus_tag="HG536_0G01540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285073.1"
                     /db_xref="GeneID:59327536"
     CDS             251103..255944
                     /locus_tag="HG536_0G01540"
                     /inference="similar to AA sequence:RefSeq:NP_011612.3"
                     /note="ancestral locus Anc_3.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140969.1"
                     /db_xref="GeneID:59327536"
                     /translation="MSKPEEPLNEVSLNTPAKKQAIYPASLLTKQSFSRHGGENVFRY
                     EVKRSYVSSKYIDHHYGFISENLKRKKPIKSQIDLLHQSFSELYRIFIQVHMWEDLRL
                     LTKRHLMVIVGLLNENDVNGATSEILHLYNATNNQAVKDLHGILLADFIYPNECYLTS
                     LKLLALQAILRAKSAHEHADSILKLFALDKRYLLRDANVKIHMVIQLLLNFFMLLPSG
                     KAMLGLKFLQYVKQYKLEFEGYIKNMDDLTFQDQLKYYAREMTDDARIYLACFYDDYS
                     KYCSTPQKIMLTDFVQKSLKEHASLPDLIQQSNVTGSRSCFMNYSSKRLVQVTSSILK
                     SEDCPISTAVSLLKQSWEVIRFNGGNETNGKRILFDKTLSFLNSKISVLTENQMAIRD
                     LLELMAEYCIDDNQFKRMSNLVNVLFNSFVVLKNMEFLKLAAHLESRRYMLERESGLL
                     RPIIEKFERFISKATSREAKLQIFGYLFNLQMAGRTLGKLQSFCQLVYLRCFQKLQLT
                     KYIEFRNCSEVMLAFFYGVSPVKEINIEGWCPITQMLYSCISGKFCLGTIDVNPETNK
                     WHFLHKYEVLIKAAYCFNIEMSKHSTFNLASITSNYMNKWVMRKSPSASEKVAAFEID
                     FLRILLIYLQFNNFDKCTIDLIQCLRSRSSTYEPFLLESEGFLLSAYINLQMLDKIAT
                     MRDKIYNTPFDLQNEKLETVLNVLRMKLQLMAWENDHRLFEKVFIQEAPKLREEVFDL
                     DNATKKTSSQYIKVILFNIDVLITASALQLAKNNMVRAATESKKALKLSVSLLRKLDN
                     LSEKTRLNVVSYLTCSYLSLLNLYIHLGVARDCEFYVNELSTLLCDLNEPTIVFKCLQ
                     FLYEYYQLTGQTELAATALGKCNNAFDYIDGESNILALTSFFFINNENEKLLDSLGLF
                     FKEGIDETFLPYYWRLKMGIPVEEWTKQSKYKASYEVNKLDMLYRRVLKQLESEPFFR
                     SMFESLVIIPSCHLPAEQSSKKQLAFPGKKALILEVMASPRPSTMTPRGKHMRQKFDR
                     AVAIDNLKALKDSVEELQLSSLKNHELSRVASFYSLALSLLSNLSITTSLVDNLLDEF
                     ALSELPKCMPLYYDKALAAIGNDIYESFCLLPLSSMDDPVAIQREKSLAAQKRICQNP
                     IPFNVISIDYCSVTGSLLISKIETFNDRKVHLRMPLNRAHARDLDSKMLSFEQARREL
                     SDIIGESNASTSIEVTSSINSREQRKEWWQTRYELDRRLHELLKNIEDCWFNGMKGFF
                     GTEIVDSELLQDFKNEVNDILHQNLPSRKQIGNRDMFLQLDDWIVELVLRLSPQCPDF
                     MPMMEDLIYIILDILLYHGEENAYDEIDIDTIHVQLEEIVRKFRPRLLSMKKLSHTFL
                     VVSSSCHSFPWECLSFLKPLSITRVPSISILDDLLKKCNDGISPKVPSQNKISMILNP
                     HGDLSKTESRFSNLFKEIVKERPNSTLLINQKPDEKTFLEMATSSNLFIYLGHGGGEQ
                     YARVKEIKKFDHIAPTFLLGCSSASMKAFGKLEPTGTVYSYLLGGCPLVLGNLWDVTD
                     KDIDKFSESVFQKIGLSCDASINSSQEHTISTAVSKSRDVCHLKYLNGAAPVVYGLPM
                     RFR"
     gene            complement(<255999..>256838)
                     /locus_tag="HG536_0G01550"
                     /db_xref="GeneID:59327537"
     mRNA            complement(<255999..>256838)
                     /locus_tag="HG536_0G01550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285074.1"
                     /db_xref="GeneID:59327537"
     CDS             complement(255999..256838)
                     /locus_tag="HG536_0G01550"
                     /inference="similar to AA sequence:RefSeq:NP_015441.1"
                     /note="ancestral locus Anc_3.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140970.1"
                     /db_xref="GeneID:59327537"
                     /translation="MNGTRIAVKDLLVTRRTPGVVKSGPRPLQVPKSPLLTNFEKWSD
                     KKRKLYFDSGDCMAANGLGSFHLNQNLFASLLASPMRCDRMSRLKLPREYLTQLKLKN
                     LQPKLGKHSLQLGFGQADCKGGKSSYVVNSNELLKKNVKSASSWIPIPALMSNMRYFN
                     VSDVLVDKENFASESVIELRRGLERELGKLPKNGRGATLEGWDIVVCLEPKANSPFEI
                     VRRESLEVIMFNVKFLDSERWVREAIQSHRNHELGMVLKLPEDSELVKCIYRIWASFS
                     LLR"
     gene            <257010..>257627
                     /locus_tag="HG536_0G01560"
                     /db_xref="GeneID:59327538"
     mRNA            <257010..>257627
                     /locus_tag="HG536_0G01560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285075.1"
                     /db_xref="GeneID:59327538"
     CDS             257010..257627
                     /locus_tag="HG536_0G01560"
                     /note="ancestral locus Anc_3.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140971.1"
                     /db_xref="GeneID:59327538"
                     /translation="MRLGFFRCQSTLVRQNITREKFRECMSKIANQAMVLSAASKSVV
                     PHKSFRGLTISSLTSLSLKPQPLIQFNLQLPSFTSEALHETGFFAVHLLKPNTTSIKL
                     AREFSKGAIINEKDRTYSPTRPFENLVENEHYVTYKIEGTDLVLPLLKNSERVLICQK
                     KDVFQIGDHEIWVGQIEDIIVNEAQPTGGLLYCNRKYHSLGEKIG"
     gene            complement(<257789..>261076)
                     /locus_tag="HG536_0G01570"
                     /db_xref="GeneID:59327539"
     mRNA            complement(<257789..>261076)
                     /locus_tag="HG536_0G01570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285076.1"
                     /db_xref="GeneID:59327539"
     CDS             complement(257789..261076)
                     /locus_tag="HG536_0G01570"
                     /inference="similar to AA sequence:RefSeq:NP_011611.1"
                     /note="ancestral locus Anc_3.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140972.1"
                     /db_xref="GeneID:59327539"
                     /translation="MSDYFRLGGESQSGVDMGSRGADRMPSGGFGQENDGASIHSNDS
                     YLLELLPDSATVGNQVRSEASSGISLAAVSSAKGSKDHILPRWDPRSPYYVDVPVPKP
                     SSIDAGESGGAAEADTAEGKFVREYPTDILVDRFYKWRKVLKGLIAYLREVAYAQEQF
                     GRINFQLKSAVKFPFLTDLEDGSNRLVDPLAPKGPAKKQQPVTLAQKKQQESSLGAAG
                     VGENGLNHAENEFQAVRTAESDDTSASSGFMKFGSGSVQDIQVILKKYHVSLAHQQFK
                     ISKEITTTVIPKMEDLRKDLQLKIKEIKDLHGDFKTNINEHVAITGQLLNKYIASVKF
                     VTSNFSSDGSDHIKLHKKNNQLKPKHDPYLLKLQLDLQLKRQLLEENYLQEAYINLQS
                     SGMELEKIIYSKVQHALQKYCSLIDSEARLMIKNLCRELQQGMLSRPPALEWDHFVSH
                     HPTCLLNWKSNDPVPPARKLSEIIYPQMKSSLAKCIRAGYLSKKSKYLKNYNKGYFVL
                     TSNYLHEFKSSNFFKVTNPPEETKDHQNVSTASQNSAKTSLIPVMSISLNDCVLMEAS
                     ENKFVLVGVPTFNDLQKISSSAKSSLTNIAGTSSPSNDGPKKLKKAAFGKLLKGAKPK
                     QSAPKTAEEQEEVKQFYAAARQETNKTVNWVFRPASSNPSEEEIRLFKKWIHDLKNLT
                     SFNNTEERSKFIEERVLKAQTRVKSIPKGSASTPSMSTLGEGSNVDGSSFKKERPGRP
                     KFIQLQNSPASSSALDISAYRSKVNTPAVDDNGNLITVAERRHIPPSLYMTSPITSPR
                     MSPGSDSSSAISLVHQQLHQQSQQAAEPQQPQASVSDTPGNNLVMNTAPVVSGVPVGD
                     SYRRHYRNTSLTQSLPGVNAHAISAINSPKSIDSEGSIGGYFAIPVARSNGGSEGSTP
                     SYADDRIQQNYVPPNGNRSLGMRSASGGYSPQLINSTSHTSPVPKLRLNDQDVAHHVV
                     DETQAAQVDASLAYNRFKRNQLLGDVPSAKSDSTLASGSPSLYLRSNNSTNSLGSTAS
                     RTHPIRKHKKNVSFSSLNSLMFSKKAANAGGSHMTDQFMGGGIREDDGDSEKSSQSLK
                     LNQSIYS"
     gene            complement(<261432..>262316)
                     /locus_tag="HG536_0G01580"
                     /db_xref="GeneID:59327540"
     mRNA            complement(<261432..>262316)
                     /locus_tag="HG536_0G01580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285077.1"
                     /db_xref="GeneID:59327540"
     CDS             complement(261432..262316)
                     /locus_tag="HG536_0G01580"
                     /inference="similar to AA sequence:RefSeq:NP_015439.1"
                     /note="ancestral locus Anc_3.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140973.1"
                     /db_xref="GeneID:59327540"
                     /translation="MLSWLKNFLLELPSPAVIQTHVVPFLSERNWIVSQPILSNLHSI
                     VYVALFYQTCFLLGKWVVFPPAARWMHPDDRDRRRKLVIQSSVHFVSFVQSIVVLYVC
                     FECLVSQNYKSEYPTAADRIFTSHRDTEIVCVFAIGYFLWDIYISVFYSTLPFVLHAV
                     VSTLVFCIGLKPYIQYYAPVFLLFELSNPFLNVRWFAVRYFRRASPLLSCVKTANNLV
                     LLVTFFGARICWGWFQIGKLVYDFYQVRHDARFLELETAIIVLGNLVLDVLNLVWFST
                     MISIAFKTITKKGTPPGQ"
     gene            complement(<262511..>263557)
                     /locus_tag="HG536_0G01590"
                     /db_xref="GeneID:59327541"
     mRNA            complement(<262511..>263557)
                     /locus_tag="HG536_0G01590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285078.1"
                     /db_xref="GeneID:59327541"
     CDS             complement(262511..263557)
                     /locus_tag="HG536_0G01590"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140974.1"
                     /db_xref="GeneID:59327541"
                     /translation="MSLPKTQKAVIFEKNGGELQYKDIPVPEPKPNEILINVKYSGVC
                     HTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAKGSLVKGWEIGDFAGIKWLNGSCMACE
                     YCEKANESNCPSADLSGYTHDGSFQQYATADAVQAARIPAGTDLAEVAPILCAGITVY
                     KALKSANLRAGEWVAISGASGGLGSLAVQYAKAMGYRVLGIDGGEEKEQLFKKLGGEY
                     FIDFTKSKDVIAEVISATNGGAHGVINVSVSEAAISASTRYARANGTVVLVGLPANAY
                     CKSEVFNQVVKSVSIVGSYVGNRADTREALDFFTRGLVRSPIKIVGLSTLPEIYEKME
                     KGQIVGRYVVDTSK"
     gene            complement(<263936..>264583)
                     /locus_tag="HG536_0G01600"
                     /db_xref="GeneID:59327542"
     mRNA            complement(<263936..>264583)
                     /locus_tag="HG536_0G01600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285079.1"
                     /db_xref="GeneID:59327542"
     CDS             complement(263936..264583)
                     /locus_tag="HG536_0G01600"
                     /inference="similar to AA sequence:RefSeq:NP_015438.1"
                     /note="ancestral locus Anc_3.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140975.1"
                     /db_xref="GeneID:59327542"
                     /translation="MGERVTSQTVLWYIPNQIGYLRVATAVVSLFSMREHPVFTSCVY
                     GVSCLLDAVDGTMARKYNQVSRVGAVLDMVTDRCATASLTCFLAVVYPQWCVVFQLLI
                     SLDLASHYMHMYASLSAGSESHKQVSRDSSRLLHWYYTRRDVLFTVCAFNEVFYMGLY
                     LYGFERFARVGAVLVAVCVPGYLFKQVANVVQLRRAAVILATVDARDASERLKRM"
     gene            complement(<264663..>265574)
                     /locus_tag="HG536_0G01610"
                     /db_xref="GeneID:59327543"
     mRNA            complement(<264663..>265574)
                     /locus_tag="HG536_0G01610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285080.1"
                     /db_xref="GeneID:59327543"
     CDS             complement(264663..265574)
                     /locus_tag="HG536_0G01610"
                     /inference="similar to AA sequence:RefSeq:NP_011610.3"
                     /note="ancestral locus Anc_3.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140976.1"
                     /db_xref="GeneID:59327543"
                     /translation="MDHRDHLRKGEDAKLLASLLSGSASGLVARFATAPMDTVKIRLQ
                     ITPKGDPLHGSAGVVAVARQIACREGLRGLWKGNVPGSLLYVVYGGVQFSTYSLYNKT
                     LSPLRWSDQLHSLVVGALAGMSSSLASYPFDVLRTRLVANRSAELSTLRAAARQICAE
                     DGWRGLFKGCVSSIATITLATSVLFCTYETVKIFAERCGPGWEASALGAAASPLAGVV
                     SKLATFPLDTARRRMLLSNAQHLAHHSAVYKSYRRRTLLAVAAHIARREGVPALYQGL
                     SMALIKSVPSTAISLWAYQWLMSLAGG"
     gene            <265692..>266384
                     /locus_tag="HG536_0G01620"
                     /db_xref="GeneID:59327544"
     mRNA            <265692..>266384
                     /locus_tag="HG536_0G01620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285081.1"
                     /db_xref="GeneID:59327544"
     CDS             265692..266384
                     /locus_tag="HG536_0G01620"
                     /inference="similar to AA sequence:RefSeq:NP_011609.2"
                     /note="ancestral locus Anc_3.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140977.1"
                     /db_xref="GeneID:59327544"
                     /translation="MTTRSASLGLLTNVDGSSQFEWQDTKVVCSVTGPVEPKARQELA
                     TRLALEVIVRPARGVPNTREKLIEDRLRAVLTPLIVCEKYPRQLCQITCQILEAGEDE
                     SEFSVKELSCCVNASFLALLDAQVALRSFCASVPLAILRDCNELVVVPSAQQLQVSLS
                     THSVALELVAGAKTVQSVLLLDSNGDFTEDDLFRVLQLAEQNCLELAQFLRKTVAEKI
                     TNEVVRTEVVES"
     gene            complement(<266444..>269788)
                     /locus_tag="HG536_0G01630"
                     /db_xref="GeneID:59327545"
     mRNA            complement(<266444..>269788)
                     /locus_tag="HG536_0G01630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285082.1"
                     /db_xref="GeneID:59327545"
     CDS             complement(266444..269788)
                     /locus_tag="HG536_0G01630"
                     /inference="similar to AA sequence:RefSeq:NP_011608.1"
                     /note="ancestral locus Anc_3.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140978.1"
                     /db_xref="GeneID:59327545"
                     /translation="MHRLLRVKSPLAVAHSSLIYRKSLAVASSSKVLVQQGGGYWQPL
                     RHFTMSELENLPPVDPATGEVIINPLKEDGTEKSAKEIEKEKKKAEKLLKFAAKQAKK
                     KAAAGSSDSGASEKKEKKKSKKKEAEPVPEFVDKTVRGEKKILVSLDDPALKAYNPAN
                     VESSWYDWWVKSGFFEPEFTEDGKIKPEGLFCIPAPPPNVTGALHIGHALTISIQDSL
                     IRYNRMKGKTVLFLPGFDHAGIATQSVVEKQLWAKEKKTRHDYGREAFVDKVWEWKSE
                     YHDRIKSQIRKLGASYDWTREAFTLDPQLTKAVVEAFVRLHDDGTIYRAARLVNWSVK
                     PNTAISNLEVENKDVKGRTLLSVPGYDEKVEFGVLTSFAYPVADSETGEKLIIATTRP
                     ETLFGDTGIAVHPDDARYKHLHGKFAQHPFLPRKIPIICDSEAVDMEFGTGAVKITPA
                     HDQNDYNTGKRHNLEFINILTDDGLLNENCGPEWEGMKRFDARKKVIEELKARGLFVG
                     QEDNEMTIPTCSRSGDVIEPLLKPQWWVSQSDMAKEAIKAVRNGDITITPKSSEAEYF
                     HWLENIQDWCISRQLWWGHRCPVYFVNIEGQENDKNDETYWVAGRDLEEAEKKAVAKF
                     PNQKFTLEQDEDVLDTWFSSGLWPFSTLGWPDKTKDMEAFYPFSMLETGWDILFFWVS
                     RMILLGLKLTGSIPFREVFCHSLVRDAQGRKMSKSLGNVVDPLDVIRGIKLDDLHAKL
                     LLGNLDPREVEKAKAGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLDILRVEGYR
                     KFCNKIYQATKFAMMRLGDDYQPPAKEGLSGNESLVEKWILHQLTNCSRTVNDALEKR
                     DFLNSTSAIYEFWYLVCDVYIENSKYLIQEGTDVEKKSAKDTLYLLLDNALRLIHPFM
                     PFVSEEMWQRLPRRSTDNAPSIVKASYPVYVKEFDDEKSAAAYDLVLDVTKEARSLLA
                     EYNILKSGQVFVETDHAEYFETAESQKDSIVALIKAIDAIKVVRTATDIPEGCVLKAV
                     NPDVNVHVLVKGHVDIDAEISKVEKKLERARKTRNGIESTIGSKDYETKANDQAKEAN
                     KARLENAVAEIEGLEATIENLKRLKL"
     gene            <270241..>272808
                     /locus_tag="HG536_0G01640"
                     /db_xref="GeneID:59327546"
     mRNA            <270241..>272808
                     /locus_tag="HG536_0G01640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285083.1"
                     /db_xref="GeneID:59327546"
     CDS             270241..272808
                     /locus_tag="HG536_0G01640"
                     /inference="similar to AA sequence:RefSeq:NP_015437.1"
                     /note="ancestral locus Anc_3.432"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140979.1"
                     /db_xref="GeneID:59327546"
                     /translation="MSRIIVKGLPIYLEDEKLKEHFLKRVIEKHGSSRNAEECITDVK
                     ILRNRDGKSRRFAFVGYRSEEDAFDAVNYFDGSFINTSRIEVAMAKSFADPGVPKSMR
                     EKRREALKRLREQEEKLAGEKQGKRAKSDGEKKKERSIDAEIEKDRRLKEFIETMKPS
                     AQVASWENAGVGSAAAEDTEAPGNSLLAQALALKDESEHDSDDEYVDFGKKREAEEEA
                     AAQPAEAPEDSGPGVPAGEQNDNDDNLARDENISDLDWFKQRRVRIKEGGAQLAQASE
                     PMEEEAVKEDSKEDIAEEEAVKSSEDKMVEQIYRTGRLFLRNILYTSTEDDFKQLFSP
                     FGELDEVHIALDTRTGKSKGFAYVLFKNPQDAVEAFIALDKQIFQGRLLHILPAEAKK
                     DHRLDEFDLKNMPLKKQRELKRKAAASKQSFAWNSLYMNQDAVLGSVAAKLGLQKSQL
                     IDPENSSSAVKQALAEAHVIGDVRKYFESKGVDLTKFGQLKNESQRDNRVILVKNFPY
                     GTTVEELGDLFLPFGKLERFLMPPAGTIAIIQYRDVTAARAAFTKLAYKRFKDGIIYL
                     EMGPKECFTREAQSDETLESHGESAHVNITEVGPTSHDLMQTAGATESKLENQEDESI
                     DGPTVSIFIKNLNFSTTSVQLTELFRSFNGFIVAQVKTKPDPKDKNKTLSMGFGFAEF
                     KTKEQALAVISAIDGTVLDGHKLQLKISHRTGTTDNIQKSKSKKSGKIIVKNLPFEAT
                     RKDIFELFSSFGHLKSVRVPKKFDKSARGFAFVEFLLPKEAENAMDQLQGVHLLGRRL
                     VMQFAQQDAQNAEDEIARMTKKVKKQVATRELAAIRNSGGRRKLDLENGEGDDMNGL"
     gene            complement(<272875..>274023)
                     /locus_tag="HG536_0G01650"
                     /db_xref="GeneID:59327547"
     mRNA            complement(<272875..>274023)
                     /locus_tag="HG536_0G01650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285084.1"
                     /db_xref="GeneID:59327547"
     CDS             complement(272875..274023)
                     /locus_tag="HG536_0G01650"
                     /inference="similar to AA sequence:RefSeq:NP_011607.3"
                     /note="ancestral locus Anc_3.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140980.1"
                     /db_xref="GeneID:59327547"
                     /translation="MFNNIDLDILITKVWSVAIAGKNDSVTGNKMIDEICKKTRPRYH
                     FLFGDTDSFFELEPFAWPESNRTTRSINVAAFHSKKKWAYAFVIDVRGSDRKLEADQS
                     SSLIPNPYMDQPGKRSFSDFSSKEDLGSSSKRKKAVLPSDCHFCFTNPNVEDHMFVSI
                     GNHAYLTTAKGPLSVPSGDMDFHGHCLIVPIKHIPKLNMGQEEFFESALRKELTSYEL
                     SVVKMNHRKFDMSTVVFEIHSDQTIHFHKQIIPVPKYLIMRFQDALDRQVYLNNERYT
                     TNAKMNFQVFSSSENQEYKEIIGDSKKNFFQFTVYETSQDEPLIYLSQFNVNDRLDLQ
                     FGRRVVAFLMRLPKRINWSSPVCKQSKEQEIDEVKKFQKGYSAFDIAS"
     gene            complement(<274627..>276342)
                     /locus_tag="HG536_0G01660"
                     /db_xref="GeneID:59327548"
     mRNA            complement(<274627..>276342)
                     /locus_tag="HG536_0G01660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285085.1"
                     /db_xref="GeneID:59327548"
     CDS             complement(274627..276342)
                     /locus_tag="HG536_0G01660"
                     /inference="similar to AA sequence:RefSeq:NP_011606.3"
                     /note="ancestral locus Anc_3.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140981.1"
                     /db_xref="GeneID:59327548"
                     /translation="MFSRSERDVEALAGDMNNLSFDATGNQLKHPLRSAAIPTTPTRY
                     RGYGYAGTPSPTKSTVFNGEDSFGMDIDEPSRDVNDIRSSPKKLPRDFHAKAELHKTQ
                     RVVSVCQMYFLDYYCDMFDYVISRRQRTKKVLEYLSQQGDLKSPDQLNGEWTGYLEKE
                     HEILRKRRLKPKNKDFEIITQVGQGGYGQVYLARKKDTKEVCALKILNKKLLFKLNET
                     NHVLTERDILTTTRSEWLVKLLYAFQDTESLYLAMEFVPGGDFRTLLINTRYLKSAHA
                     RFYISEMFCAVNALHELGYTHRDLKPENFLIDAKGHIKLTDFGLAAGTVSNERIESMK
                     LRLEEVKNLEFPAFTEKSIEDRRKMYNTLRETEVNYANSMVGSPDYMALEVLEGKKYD
                     FTVDYWSLGCMLFESLVGYTPFSGSSTNETYENLRHWKQTLRRPRLENGRPAFSDRTW
                     EVITRLIADPMNRLRSFEHVKRMSYFAEIDFKALRSMSPPFTPQLDNETDAGYFDDFS
                     NEADMAKYADVFKRQTKLSAMVDDSSVDSKLVGFTFRHRNGKHGSSGVLYNGSERSDP
                     FATFY"
     gene            complement(<276585..>277922)
                     /locus_tag="HG536_0G01670"
                     /db_xref="GeneID:59327549"
     mRNA            complement(<276585..>277922)
                     /locus_tag="HG536_0G01670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285086.1"
                     /db_xref="GeneID:59327549"
     CDS             complement(276585..277922)
                     /locus_tag="HG536_0G01670"
                     /inference="similar to AA sequence:RefSeq:NP_011605.1"
                     /note="ancestral locus Anc_3.429"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140982.1"
                     /db_xref="GeneID:59327549"
                     /translation="MEEDLAKDLEFDLAGEEEEDEELGKIDKLEQGPDNDDLSFVGRF
                     IEDYKPVLGPQADVWQRFSYVPILDEKVSSLLRNVGNNLPWVLHRLNELCSLLQNEVR
                     LLHTYSRTLYRAKFGELEALVPSPKQYVQVIDIIERDGEASAEKLESQAELSKEQVLV
                     LKMSMKTSYRDDLPWPNEKKVEISRARSNMLAILAIESNVRQFIIQKVSHVAPNLCAF
                     IGPEVASHLLSHAGGILELSQIPSCNLASIGKNKHLAHEQHTSLTEVRQEGYIYRSDL
                     VQSQPYEYHKQALRMACAKVALAARVDAGITPGTKAKDTVGSRWRREIEQKILKQREA
                     VSNAVVKPLPVPKDEPKKKRAGRKFRKYKQQFQLSHLRQLQNRMEFGKQEQTILDGYG
                     EEIGLGMVNSSLKSATGVASVTKTNVNNSAKLTKAMKKRIEQANEQARNTWQQ"
     gene            <278169..>279176
                     /locus_tag="HG536_0G01680"
                     /db_xref="GeneID:59327550"
     mRNA            <278169..>279176
                     /locus_tag="HG536_0G01680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285087.1"
                     /db_xref="GeneID:59327550"
     CDS             278169..279176
                     /locus_tag="HG536_0G01680"
                     /inference="similar to AA sequence:RefSeq:NP_015435.1"
                     /note="ancestral locus Anc_3.428"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140983.1"
                     /db_xref="GeneID:59327550"
                     /translation="MSNIVGIEYNRVTNTTSNDFPGFSKEGENAWDVNKFRETFDIQI
                     SNLSEREATFDLIGVDTSIANAFRRIMLSEVPSLAAEHVYFLNNTSVIQDEVLAHRIG
                     LIPLKVDPDMLTWVDTSLPEDERFTDENTIVLTLDVTCTRNPDAPKDCTDPKILYRNS
                     SVYARDLKFEPQGRQAEIFAKCPVRPAHPDILLAKLRPGQEISLRAHCILGVGGDHAK
                     FSPVATASYRLLPDIKITQPIKGEAAKKFQKCFSPGVIDIDKSTGEAVVKDARRDTVS
                     REVLRHEEFADKVKLGRVRDHFIFNVESTGAMTPEEIFFKSVRILKNKAEYLKNCPIA
                     Q"
     gene            complement(<279252..>280136)
                     /locus_tag="HG536_0G01690"
                     /db_xref="GeneID:59327551"
     mRNA            complement(<279252..>280136)
                     /locus_tag="HG536_0G01690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285088.1"
                     /db_xref="GeneID:59327551"
     CDS             complement(279252..280136)
                     /locus_tag="HG536_0G01690"
                     /inference="similar to AA sequence:RefSeq:NP_015434.1"
                     /note="ancestral locus Anc_3.427"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140984.1"
                     /db_xref="GeneID:59327551"
                     /translation="MNSDTRRNSSRTEDERIYRLRRKNFQRNLVTKMSYLGYIVIVLY
                     YLKYGCTIWNLMLRVCVQSLLAVPFPSDIQIQRLSRARENRGSAHFFTLSGTMDAETV
                     PMPGAFPSGDDSQTAARSEAQMEEESKAIKRKIRKVLFHGSLTFNVLFIISALIFPVN
                     FIGKLEGNHLLEAGLANTPSPFNNANGIIQGERKGGFSMQMIGETLPQTNFKGNLGIV
                     MFEFTILLCQFTLFVLTCINFADLGDQKDVDGDHSEAIVSDGYDGKVDVTRIDPIGAI
                     SDIVFPMIETANNTSSMV"
     gene            complement(<280355..>283990)
                     /locus_tag="HG536_0G01700"
                     /db_xref="GeneID:59327552"
     mRNA            complement(<280355..>283990)
                     /locus_tag="HG536_0G01700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285089.1"
                     /db_xref="GeneID:59327552"
     CDS             complement(280355..283990)
                     /locus_tag="HG536_0G01700"
                     /inference="similar to AA sequence:RefSeq:NP_011604.3"
                     /note="ancestral locus Anc_3.426"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140985.1"
                     /db_xref="GeneID:59327552"
                     /translation="MSSVKRRASQIEDIAQDTLSRKKLIEIKEDNKVRVDDKTPEHDE
                     SEHSGEDSDGETQNTVRASTTAAQDIHIAKETAELFQSNIFKLQIDELMQQVKLKDSH
                     ILKMEKVLHMLHDMINEVPDWEEKTMAEADAYFKGKIIKIPFVDPKPDFEQTNYKVNY
                     KRPEILLIGSFALKAGISQPSGSTVDVLLTMPEELFEKKDFLNFRCLHKRSVYLAYLT
                     HHLLILIKRKKLDDLLQLEYSYFNGDSLLPVLKISCKGSDNPAKAEYNFYKTKFSINL
                     IIGFPYKIFDAKKLLPNRNCIRVAHQEADVSLPATPLYNFSVLSSTTYEAYLKFLYKT
                     KKQTESFKEAAKLGRLWLQQRGFSSKMAHSGGLGGFGTFEFMVLMSALLNGGGLSGNK
                     ILLHGFSSYQLFKGTIKMLATTDLCQHNHLEFHSDASAPSRVIEEGFQIPTLYDKTTK
                     VNILSKMSISSYEILKMYAKETMSMLNNVVQDQFSNIFLTNINKIENVKYDFCYDLQL
                     PVNGKNDPEFLLNSKFGPMEKIRFITLENFLVNKIANVIKIALGDRVKFVEIELDGQK
                     DTFPITKRKIYHGSGNYLNLESVKINIINNPAESEKLVTKGPVHLEEPTPEAIAFKNF
                     WGPKASLRRFKDGSITHCCIWSTSSSEPIISSILGYVLKKHISEQASIKSDTTKYFQN
                     LLPLPNLPASSKISVLNLTSFYNIKKSFDDLYRLIFEIELPLSLKSILPVGTAFRYTS
                     LCQPVPFAYSDPDFFQEVILEFETSPKWPDEIMSLEKSKAALLLKIQSELESKHNGKY
                     KCFFTRDESIPNNLDITLLNILTPEGFGFKIRVLTERDEVLYLRAISNARQELKPELE
                     KTFLKFTARYLASIRHTRTIESISHSYQFYSPVVRLFKKWLDSHLLLGHLNDELAELL
                     AIKPFVNHAPYSIPGSVENGFLKVLKFISEWNWKEEPLVLDLTRPDDEFESVDEQGEN
                     GLDAATLNKLSEKLSLAQYKGIQSNFTNLRNGDPNGLHLQFFVASKNDPSGILYSTGI
                     LLPIATRLTALAKVAINLIKTHGVNKQTIDLLFTPALKDYDFVLSLKTPVPLKSSSGI
                     ANASEFKNITNDQSSRNFPSDLSQLSERMDPTFHLVKYLNMKYRNSIIFSSHRYIGVH
                     GADKGDKNVVTGLIKPLFKKNQKFRVNSDCNVEPVDDQNVKLNKNAIFHEIAAFSKEL
                     AVKFESQ"
     gene            complement(284368..284439)
                     /locus_tag="HG536_0Gtrna8T"
                     /db_xref="GeneID:59327900"
     tRNA            complement(284368..284439)
                     /locus_tag="HG536_0Gtrna8T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACA"
                     /db_xref="GeneID:59327900"
     gene            complement(<284715..>287348)
                     /locus_tag="HG536_0G01710"
                     /db_xref="GeneID:59327553"
     mRNA            complement(<284715..>287348)
                     /locus_tag="HG536_0G01710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285090.1"
                     /db_xref="GeneID:59327553"
     CDS             complement(284715..287348)
                     /locus_tag="HG536_0G01710"
                     /inference="similar to AA sequence:RefSeq:NP_011603.1"
                     /note="ancestral locus Anc_3.425"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140986.1"
                     /db_xref="GeneID:59327553"
                     /translation="MKRHSSRPIDDSQPIAFAKKHRFKDTLALFIVFLSFNHFASLCL
                     LTSFVIATRFRNFLTNSFIALFLSKKPSPPMAEVSHVDDNIDVRYPVNGNDKKQSKLP
                     SWRVKHSLSLPLLISEILVATILKLYGENYFLKPIENLALSILASSMINDPKDCLSYA
                     TSCSVLYAMALHVYQKVGIIQRFGGSSTPSDLGITFPTSLFKPSMPQDKGAADTGSFV
                     QCQVMSWLSRYGRHLLYYVSFHVVVFQFSQSTLSQHYDDDKQKSCKKSVSLKSEPNKG
                     SGQRVSSLCTAKNASENPNVNSALQHQQQTFAERLGSNSTSQDSNSSMAFPNGFLNYA
                     KKSNKGKQRLPYFTGVVSQYEAFEASLRYESQDNSQTMATNVTIPSPTNSQGSDKVEN
                     IYTNQFYDVKVEFGANRETRNLKLDVTVTSNLENFIRHLFKRKNQHLIPPLWSIVVTL
                     KTTNFEKRYLKESKEVTLTPSNSGVASENDSSDGSITPTASNSNICDEQASESVFNKL
                     QSSKTMALIAQTAFDDYAQLHIVATNDNIFKKDDKDYKVCIVEIASNSITFHIENLHE
                     GELIVLVNGVIWSEVSCALILEHEGEELVVVGGLVPSCPYDIQFINRLRQMEDYLISD
                     LMVRTVGVKDATEKFEAIDFSFPSYYHRKFLSPLLTLKHSVLTTNTNLAEGRVKLKKT
                     KKEVSKKLNGLRQDIDHYKSKISQNATNDEKNASKVESLKTAHQQTEATLCKLEDHLQ
                     RLTNEEFKLEEEYLTQKDTHLRRQMEYSKLQESFDNTLKEAELKRSKLEQELNQLNSK
                     KEKLFAKRERLQREVNQNTVEFENLKSQFVSKREKDRVRRSELRAREANELEMVIKGL
                     EQDISRLEGENGNLQKDARGM"
     gene            complement(<287626..>291276)
                     /locus_tag="HG536_0G01720"
                     /db_xref="GeneID:59327554"
     mRNA            complement(<287626..>291276)
                     /locus_tag="HG536_0G01720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285091.1"
                     /db_xref="GeneID:59327554"
     CDS             complement(287626..291276)
                     /locus_tag="HG536_0G01720"
                     /inference="similar to AA sequence:RefSeq:NP_009962.2"
                     /note="ancestral locus Anc_1.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140987.1"
                     /db_xref="GeneID:59327554"
                     /translation="MSHPPPSKKRYYYSNGGPNHMMRYGSSFPKKSYAGNGGYGMLPS
                     GSTPAAIPAAASEIPRPSRYDPSSPSRPVSSRNPGSRYNPEVEVETQPFAGDPHMKPS
                     GSRYSGSRYNQGQAQQARPRSMEMAKKDSSYGYPMAGGNGPANASLNTASGYYSRSNK
                     WRSQSFSNLNMDHYDNYSGSAARPPFWKSQKSKFTTVPPSSQGPRRTTPSPTIASSGH
                     FSRFNGSSSRRESGDESEVIPEINGLDARDENPHSLGSSLINSVAETTRKVEKEHAAN
                     LKRTSLDKSTFLPSKEPPKATEDEELEKTSPETAKEVSKPLKKTSEMWSSSGTSLNEL
                     KELVNEDSEKQRIEEEPIFHKEPSKIYDDYEFIYEPDLLKTDLKKLSPQEPKVGYSIP
                     IKPLDKCIFPLSKAETRLWELKNQSREKVIEKQRYLLRQPIKAVSSYPFIQQNLLIHR
                     QALRPLLCRKIASVKRYEYLRKLQLKKQFSDLQATWVENCEQIDEMSRKMRKEELERK
                     RQEELEEKEREMNERKLSERNSGISGSSRRRNRADFVDDAEIENVLLQIDPDYKHHQQ
                     AADIPPMIINPVERYTLKLKNVNNLVTDKHLWASRILKDGVDTFTQNEHELFVEGYLT
                     YPKKFGKISQFMGGLRSPEECVLHYYKSKNTVGYKKLLNDKNKKRQKGATAKRRKKKE
                     RSSEVDVEISTSNNEADTSVRNADINKETTVVTSPEDKNIVSMHEKPFKQMEQVVIKI
                     PETQDMSNNMSAKVPRKEQRTVDEEAVKSQKDEQKLAEGNSNNMAHQKPYPLSPMPDK
                     SDIDASGLKKRAHDGDGIFTNAEKTILDEQPPTDNNTDSANEQPPRVAESIEQPSDSQ
                     RSEISNDDNLQRKRHKSSADHKSSYWSVKEANLFPELLKQFGSQWSLISEKLGTKSTT
                     MVRNYYQRNAAQLGWKSIVEEADFRRNATSSGSVQQSQILIQAEQNSLQTSNGIPPQQ
                     RPALGFFSNQAPSEKKLPDITTASQLYTHKSNRDSFSQALTPTSTLPPPRLPSIQLPG
                     TVPAESTKIEPLNQPLQLSPSPTENLLCKQEKPAGAVSSIMSILNTDDKKQSYVPPLV
                     LQSTNQVPHFGQLQHSQPTSAVRPSVGKVVVQDLQNSSSSSPENRRSSSISSLLNPEH
                     QQLLRAQPQTTLPRRALDKGSLACPPPLAQPQQTNFNFAVDPLGALAAIASESLLPPQ
                     APKPSGNQGNNT"
     gene            <292021..>293580
                     /locus_tag="HG536_0G01730"
                     /db_xref="GeneID:59327555"
     mRNA            <292021..>293580
                     /locus_tag="HG536_0G01730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285092.1"
                     /db_xref="GeneID:59327555"
     CDS             292021..293580
                     /locus_tag="HG536_0G01730"
                     /inference="similar to AA sequence:RefSeq:NP_012341.1"
                     /note="ancestral locus Anc_1.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140988.1"
                     /db_xref="GeneID:59327555"
                     /translation="MDCSAGVATGRVLRSRKRSNEGLIMPSTPKKARSENCALPMTPP
                     ATGVKKQCAKEPLTPCASPMRLIFGKRSMYSRTKALLQRSSGLFTELDGHLPTRKSQH
                     SDILSFLNRSVGGRVSDSLYITGPPGTGKTAQIDAIVKNRFLPVILPSAADSKITRPA
                     SAKGLKNVSYYELPDGKVETVAVTTINCIAVNDPSTIFNKIYTSLVSSPESGAPVKTM
                     SELQRFLESYEGSTGFLVILDEMDKLVHSNSNDTNSTKTIFELFLLAKLPSARFTLIG
                     IANSLDMKDRFLSRLNLRQDLLPETLVFHPYTPDEMFEIIMNRLKRVSCNEEDCVFNP
                     MAIKFAAKKCSGNTGDLRKLFDVLRSSIEIVELQVVASKLKDKDANSSSLVKVGLPHV
                     AKVFSQFMNNSSTRSRINKLNMQQRLILCAIVHREKTDIFQTHCSLDDSYDYYVNLLK
                     NKDALTPLKRNEFLETCNALETCGVTRIFQGRSTGKTRHAIKLIKSSIDEKEFEEEMS
                     KVEILRRFLTN"
     gene            <293811..>294962
                     /locus_tag="HG536_0G01740"
                     /db_xref="GeneID:59327556"
     mRNA            <293811..>294962
                     /locus_tag="HG536_0G01740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285093.1"
                     /db_xref="GeneID:59327556"
     CDS             293811..294962
                     /locus_tag="HG536_0G01740"
                     /inference="similar to AA sequence:RefSeq:NP_012342.1"
                     /note="ancestral locus Anc_1.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140989.1"
                     /db_xref="GeneID:59327556"
                     /translation="MASKNTNSSLHIVLLCLCWYLISSLGSQVTKKILTIYPKPLFLG
                     EFQFIYTALLASICCLIGQRFHGFYQCFPNGTFPRYYNNMGERRQIDCITRPSKLLLF
                     TIVPLSFCQFVGKYFGHTATSLVPVSTVASIKTLSPIFIVLTQRTLNLGKVQLGKTAY
                     FSLLCLIVGVWIIVRKDYEQKKPISTKGPIELGAYSSYGIICAICSMLIFVAQNIYGK
                     SVFTYQKKVISQKMDNAKAESPLPSYVTRKSTSCERKNYDKLTLLLYIPLVGFCLSFG
                     WFMTLEFPDIWNECKVAGFSAIPWKLFFVNGTFHFLQAMITFHLLGEISTLSYSIANL
                     MKRIAIIAVSWAFSGMQVTTWQILGLLLNVFGLFLYERSKSGTIQEKKI"
     gene            complement(<295031..>301429)
                     /locus_tag="HG536_0G01750"
                     /db_xref="GeneID:59327557"
     mRNA            complement(<295031..>301429)
                     /locus_tag="HG536_0G01750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285094.1"
                     /db_xref="GeneID:59327557"
     CDS             complement(295031..301429)
                     /locus_tag="HG536_0G01750"
                     /inference="similar to AA sequence:RefSeq:NP_009961.2"
                     /note="ancestral locus Anc_1.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140990.1"
                     /db_xref="GeneID:59327557"
                     /translation="MSDESKALAVLLQEALSVTLADSQSEAAIQDHFNEIILNYSFDR
                     VDEQDYSEGFVCCDMRTYVESELATRFELPNFELSLNVDATAVWSQLFETHWNSIEYA
                     LTLQIIISLTNFSVLNRSKIGSVKDIKKRLFHRTINADDVIPIVRDRLSDLLSLVLTV
                     DCTPADLLELYARFLKYPINRTADALAAQLCDPLSQAFFLFENCYYILNVPRYEEDNR
                     YTFQYFMEFNSVTSNRITTLGADLYLEIDDGKFCVSNDEFVMALFEGFEFEAGTLYSI
                     AVTIEGNDISLHVNGNLIDRITLLDGATNMTGQVDLGSMICSFKLYRLTVYHGSLPED
                     TIKAAYALGSTFHYAWNETTDLRAIRLALGDLFLQRSSSSMDFSNHFIDCLLETKREI
                     DSKSICLDIDPAFVHLEKHPNNGWLSPDDAFFHATTGKFLHFKPALLLAMFKSINCFQ
                     FILCSLEKVEDWDDLFRFLSHLMTLLQNNHLRAWFTQDYGFPLLSHILVTKVQRNMKS
                     TLPIQFFNLFQEFCGWNFSNITKSVIEDDTAYQALILNTDLWYRLSMEVNASRDGVEI
                     LRFSLFQISSLLQASEFRTLNSQKLRNLEALKKLCINQHVFAEKYGYPSIFTELATEL
                     SHVYVLLLKEELSRGNIQWLLQFAYFELRSGYYKNAEASLAAFDTLFVEVLDNAETSQ
                     IRLITDSISPKFSLMILDEVVNAKGDPLIALRILLKRLLVNQTVYKNFVKSNGLDLVL
                     AILKKADSRYNEDIVCLLYAHSLGHYSIDPNVKVPDVLENDSPHSEATVVMKEILILA
                     VNLLEWTVINDISSTIPLDLDRLIKAFVRRLSASVEKFNNELVLHSITMTLFQALTEL
                     HATLTRPQNSAIYEGSSNAIKKLISDTVVNAMMSLKPDDFAQYLEAMINWPDIKMKAL
                     SMNGKQYGYHELSFFWLLIPGVFKGIREMGDFFSYELFSNDCMILNFELLFEKVKRYL
                     ISFRFEWKVYIDAFKCIVICLKGARKRWRVKKSSLSSLSDIFRFTVIVALLQYVDEEW
                     EFMRAEYLDSICSLLAEHSGDIFMQEGSLWNYDFARLFLWILLRHVCTTEPSRSIMVC
                     FEMLLKYRAESLNPILESEGFKLPEILEALRLNSETNHQESKEVRAFIEHNRNTVIPY
                     ALSVTKKKTFGPVFPQERFMVELNVIKDTKMETRIEEVRKRLQLFRNDNVVLDRKVWT
                     GFRKIYVNFLTDRGEDELLHEQQCFSFAVHLKHTSSLQRSNSGDCEWGLDSVQNSNGM
                     KGHLVSVWRHLDYDKVEKQMQRTLQDEDTANISQQNQTRNTNNSFLSYDLISDIDSLK
                     QSGTENEDENRKILKLLQGSDGIKKIWNTSLIIGLKVREGVLIMGDLYLYFVSNYYFV
                     KEENKVLKLTEIPDADRDITLSLITGSPGNQRGMSTSQIVHTWRMSDLTFIVKRPFLL
                     RETALEILFENGTSYLFNFNSKSYRDDAYHILDKLPSNKEIDPVLYSTLQELNSCSGS
                     IGLKNGLYKKSLKTKLAKAFSANLTLTDGFSATQKWQKGEISNFYYLMMVNALAGRTF
                     NDITQYPVFPWVIADYTSEELDLKSAATFRDLTKPMGAQSRRREVQFIERFEMLKALD
                     DPSSPPFHYGTHYSSAMIVSSYLIRLKPYVDTFLLLQDGRFGHADRLFNSIDRAWSSA
                     AVENTTDVRELIPEFFFLPEFLINLNNFDLGKDQQGNQVNDVILPPWAKGDPKIFIAK
                     NREALESPYVSANLHHWIDLIFGVKQRGEEAELAVNVFNNLSYPGAVDLDSISDENER
                     RAVTGIIHNFGQTPLQIFHGPHPPKSVLKLKQIEERIWNEIRPAPQRVYEPDSKCSKL
                     KGIKYIYCEPHVDGSICWKGYPFLDVMIRSGPQLVPLKIREPYSLEIGGKIYEMLHPC
                     RICSFFLWKEDKFLTGDENGLIQAWGYDKPKEVELTCLGKLHGHLSAVKDIKLYFDYS
                     ALLSVDVSGTVYLWNLLDYQIIRRISSTGLRAAISQNEGNIAVYTMDRTLALYDFGGS
                     HYLSKLMDDKAIVTCLEFVNFTSPDLSSKRHAYWKEKDVLVVGYDNGELEIYELILTA
                     RWELKKLKQLHSAKNFEISSIRTQLRLYCNDDDSKISLELPKLEIMAGDSQGYLYLWN
                     "
     gene            complement(<301601..>302299)
                     /locus_tag="HG536_0G01760"
                     /db_xref="GeneID:59327558"
     mRNA            complement(<301601..>302299)
                     /locus_tag="HG536_0G01760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285095.1"
                     /db_xref="GeneID:59327558"
     CDS             complement(301601..302299)
                     /locus_tag="HG536_0G01760"
                     /inference="similar to AA sequence:RefSeq:NP_012343.1"
                     /note="ancestral locus Anc_1.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140991.1"
                     /db_xref="GeneID:59327558"
                     /translation="MEMRWIWAFISLLSVSFAATVRGRLDLGPQLNITRATVSRVHFW
                     LHQIGNYSEGHGYSSETQLNDLDGNFQFENIPLNPGLNATTHFVMYSSSMDFNLKPNR
                     ILITFTNLDEQGEAYDVKAHRNVFGKEFFPSPDIAYPEELEQIEVSPYIKIAPISAAP
                     MRVYYQQRNKGILQSGPLAKLFDTRWKQAGVITLIALVVFPIVLEKLDPETAKAVKEE
                     QQRRQRLKYAAKEE"
     gene            <303029..>303772
                     /locus_tag="HG536_0G01770"
                     /db_xref="GeneID:59327559"
     mRNA            join(<303029..303038,303366..>303772)
                     /locus_tag="HG536_0G01770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285096.1"
                     /db_xref="GeneID:59327559"
     CDS             join(303029..303038,303366..303772)
                     /locus_tag="HG536_0G01770"
                     /inference="similar to AA sequence:RefSeq:NP_009960.2"
                     /note="ancestral locus Anc_1.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140992.1"
                     /db_xref="GeneID:59327559"
                     /translation="MAKDLVQARDASQVFGVARIFASFNDTFVHVTDLSGRETISRVT
                     GGMKVKADRDESSPYAAMLAAQDVAAKCKEVGITAVHVKIRATGGTKTKTPGPGGQAA
                     LRALARSGLRIGRIEDVTPVPSDSTRKKGGRRGRRL"
     gene            complement(<303962..>304354)
                     /locus_tag="HG536_0G01780"
                     /db_xref="GeneID:59327560"
     mRNA            complement(<303962..>304354)
                     /locus_tag="HG536_0G01780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285097.1"
                     /db_xref="GeneID:59327560"
     CDS             complement(303962..304354)
                     /locus_tag="HG536_0G01780"
                     /inference="similar to AA sequence:RefSeq:NP_012345.1"
                     /note="ancestral locus Anc_1.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140993.1"
                     /db_xref="GeneID:59327560"
                     /translation="MTRTSVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQRH
                     GYIGEFEYIDDHRSGKIVIQLNGRLNKCGVISPRFNVKIGDIEKWTENLLPARQFGYV
                     ILTTSAGIMDHEEARRKHVSGKILGFVY"
     gene            <304868..>305273
                     /locus_tag="HG536_0G01790"
                     /db_xref="GeneID:59327561"
     mRNA            join(<304868..304873,305124..>305273)
                     /locus_tag="HG536_0G01790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285098.1"
                     /db_xref="GeneID:59327561"
     CDS             join(304868..304873,305124..305273)
                     /locus_tag="HG536_0G01790"
                     /inference="similar to AA sequence:RefSeq:NP_012346.1"
                     /note="ancestral locus Anc_1.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140994.1"
                     /db_xref="GeneID:59327561"
                     /translation="MPAQKSFKIKQKLAKAKNQNRPLPQWIRLRTGNKIRYNAKRRNW
                     RRTKLGF"
     gene            complement(<305780..>308044)
                     /locus_tag="HG536_0G01800"
                     /db_xref="GeneID:59327562"
     mRNA            complement(<305780..>308044)
                     /locus_tag="HG536_0G01800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285099.1"
                     /db_xref="GeneID:59327562"
     CDS             complement(305780..308044)
                     /locus_tag="HG536_0G01800"
                     /inference="similar to AA sequence:RefSeq:NP_012348.1"
                     /note="ancestral locus Anc_1.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140995.1"
                     /db_xref="GeneID:59327562"
                     /translation="MVGHSKMRQGLVEPSIAEEEDDFDMFQDEKRESATASSAKSRSN
                     NLTFYPYANHKLTRSAATLNLSLTSNELDLPPRLKGIKEVDYNSVDECIDRWSPFKDS
                     DPATPRATRSKRTSKSDLSPFVTDPELTKKWKRETVTSQLAKSWTADQETRDTENLPP
                     ENLNWPGKIAFLPPTGLISKVAQAESNYPKKLSIPDTPVKKSPLMESCKLSNSTNGSP
                     SFSNRSYNLTQETSYMQSPPMKSIPKLLIDASPLSTSFNILEDNDSERETVGRPQKSA
                     SQLHTGRYKKMRKARNSVIVNNNELKNSLQQFTDDLYGTDNSVRPTSSKKDKEMDDVS
                     FFNILPPPGGAKCYYDNEGSSSSADTTPTRKKSLLHRKTKAREESIIKFRNSKVHDSS
                     PVPTRRFINAKIETNPDSHLFEKFTNVSSIGNGQFSTVYQVTFQQTKKKYAVKAIQPN
                     KHISMRRVVQEIKILSEISESTLDDEGKEYVINFISSWKHQSSFYIMTEFCENGTLDG
                     FLQEQIVAKKTRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMITFEGNLKL
                     GDFGMATHLPLEDLSFENEGDREYIAPEIISDCIYDFKADIFSLGLVIVEIAANVVLP
                     DNGNAWHKLRSGDLSDAGKLSANDIHSDSLFSGDLKFDTNLTDISDYHGQDSVNLLKE
                     TPAIPPWVPKFLIDGESLERLVKRMIEPNFEKRPSANEILHAEECIYVEMTRKAGAII
                     QEDDFGPKPTFFTP"
     gene            <308825..>310540
                     /locus_tag="HG536_0G01810"
                     /db_xref="GeneID:59327563"
     mRNA            <308825..>310540
                     /locus_tag="HG536_0G01810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285100.1"
                     /db_xref="GeneID:59327563"
     CDS             308825..310540
                     /locus_tag="HG536_0G01810"
                     /inference="similar to AA sequence:RefSeq:NP_012349.2"
                     /note="ancestral locus Anc_1.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140996.1"
                     /db_xref="GeneID:59327563"
                     /translation="MLSFGYVRRKLLRHRIYLIAGLLAYFILSFCFFGRQGLISSRLY
                     AADTPGSKLFRFLYDAVQRCEPIKRPGVGTLRDSKRCQGGDLPFNPIDLSSKGSYENL
                     DSCLHLTDGQLKNLKSKHSEFLGRLRKFLANNKRISVDSFANETGIVTVGGGKFSVLS
                     LIMIEMLREKGSQLPVEVIIPPSDEGDADFCAALADLNAKCVFFSDMIPEKLIEQIPI
                     KGYQFKIIALLISSFKKVLFLDADNLPLVNPDQIFEQPVFLQTGLVIWPDIWGRVTSP
                     AFYQSAGVEVDLNTRVRYMGDDISPASRFHDPKWTSSDILSLVPLHDLGGTIPDPTSE
                     SGQLLVDKTKHLSTLLLAAYYNFHSEWYFRLLSQGTSGEGDKETFIAAAHVLKEPYYQ
                     VKTRLAIDGFFDEDNSFHGICLYQFNPQQDYEQHAYAKRWMAEHLQEYATYDPSYDVE
                     KDFYDKWMKPSNGESIDAMFGHASFHKFEPLALARERIYVDRSGRHFRGFKRYDITKG
                     FDIELFNYKLLHRKLCSARPLKFKFYESTMHTKEWSDMCRYLAEHIRYLHNTHHLALS
                     AQNIP"
     gene            <310786..>313254
                     /locus_tag="HG536_0G01820"
                     /db_xref="GeneID:59327564"
     mRNA            <310786..>313254
                     /locus_tag="HG536_0G01820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285101.1"
                     /db_xref="GeneID:59327564"
     CDS             310786..313254
                     /locus_tag="HG536_0G01820"
                     /inference="similar to AA sequence:RefSeq:NP_009959.2"
                     /note="ancestral locus Anc_1.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140997.1"
                     /db_xref="GeneID:59327564"
                     /translation="MPEERTKYADSILTTKSPYEATEIIRIRLSQAKLLNKDFYLLFK
                     EISDAKRNYTQQLRKIVAENEDLDKMLQTQMLETQVLTTKEMENFEFESLGDLRLLWD
                     SIIAVLRTELRANSDLYHALNNEIIQTLEKSTENDTKWSESKRLHSKLSQIAATIEHH
                     TRNGDRDGKLNAANNQWDSEVPSLFELFETIDFNRLEILKNSSLRYQTGMSDYLLNMT
                     KQSETAMTKMLEFEPQSEVDRFAREASRYSFQTLASGEAGKNSIQSSTVSKNKRKSTL
                     SSIGHRFTSNSTVLHHDLMDGEFSSSENNISLKEKKSGNKLKSKVGSIFSRNKLKSKK
                     SSTFNKPMEATIAETSHSPANNELSNRSRSATSSSEASQARRPTMQNRDSDPLYKISN
                     LQTINGSFKTKPTLPAAPEHESPSQQEPSEAIKSERDSSHTPLSITQAPLQPQTKSKQ
                     TSSELQAEQEQVVMGVPDPSTSTQKQAEAKGLHIRAPALPPSRKQNITNRNSEVFRQP
                     PHISRNGSNISAQHDHVASPLASQITGSMAILNPQTTGSSASLTGQNLFQHASLESSP
                     LGLNASIAELVNATFQDGTLVDSQLIGEIALNYVPNTVLNSPLPIEINLKIPKAANFS
                     KVMLNQAFLERIDSENFKINPQFIDGRTLGAIKYSMKDPVIPIVIHPVWRFEPHQASV
                     VLTLKFAPTVPKEIKRLVLEDLVVFVSIDGAEVTSALSKPQGSFSKEKRRITWRFKEP
                     LVLEEGGEERLIARFLTSQTAHESEKGIAAKFIIHGGAEQSAVGSDISMEYQELDENN
                     PFGGLWNAVAATRTVAAGNYHGLA"
     gene            complement(<313353..>314243)
                     /locus_tag="HG536_0G01830"
                     /db_xref="GeneID:59327565"
     mRNA            complement(<313353..>314243)
                     /locus_tag="HG536_0G01830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285102.1"
                     /db_xref="GeneID:59327565"
     CDS             complement(313353..314243)
                     /locus_tag="HG536_0G01830"
                     /inference="similar to AA sequence:RefSeq:NP_012350.1"
                     /note="ancestral locus Anc_1.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140998.1"
                     /db_xref="GeneID:59327565"
                     /translation="MSFTSFMRRRGSKSAIQATIAETSIQESFEPDEFEFGSQYQSVD
                     AFDDVRVLNDPDVGAGNGNAASTGSRIISINTGTNYEIRSEELAILSTSSSSSSGSLL
                     VGSSQQHSMIYSPAASNSQRIDEWCLRNELDGLTDTNDPLGRSANCSRVQNVVDSWGH
                     NPEDVPLTSAGPKGRYESRGAGNYTSDLLKGLNKEELSTVKQLTKELLPLLRNSRRTH
                     SVFSSRYRDIPSVFPQRDLIIACSLRYNSSETDILAPAKLSDSFSTVCLDEARSNTSL
                     SSRAWLAWSLVPRLTESDLR"
     gene            <314971..>315360
                     /locus_tag="HG536_0G01840"
                     /db_xref="GeneID:59327566"
     mRNA            <314971..>315360
                     /locus_tag="HG536_0G01840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285103.1"
                     /db_xref="GeneID:59327566"
     CDS             314971..315360
                     /locus_tag="HG536_0G01840"
                     /inference="similar to AA sequence:RefSeq:NP_009958.2"
                     /note="ancestral locus Anc_1.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037140999.1"
                     /db_xref="GeneID:59327566"
                     /translation="MFLRQQVRAFHATAKKFDLAKMTIVGRVGTEFSEFTSANNNRYV
                     KYSVASQPRKDGPTSWFNVTVFSEPQINFLTQYVNKGALVYIEADASQYAFEREDGSK
                     GVSLSLVQRDFNLLRNGKSEEAEAGGQ"
     gene            <315515..>315970
                     /locus_tag="HG536_0G01850"
                     /db_xref="GeneID:59327567"
     mRNA            <315515..>315970
                     /locus_tag="HG536_0G01850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285104.1"
                     /db_xref="GeneID:59327567"
     CDS             315515..315970
                     /locus_tag="HG536_0G01850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141000.1"
                     /db_xref="GeneID:59327567"
                     /translation="MPAHPKIHETTAICYTLSNAFKDHYSHCCHLHNKKPGPRHGIFE
                     EYQPYAYSPSIANNAGEQFPADRSASVGGLPASLNDYFSSCCKLKRMGKSKENSVTCV
                     AARASEYVDPLLQAVAVACKTAPRRRNIAKQPQSADHDSGLVSASERMA"
     gene            <316265..>316909
                     /locus_tag="HG536_0G01860"
                     /db_xref="GeneID:59327568"
     mRNA            <316265..>316909
                     /locus_tag="HG536_0G01860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285105.1"
                     /db_xref="GeneID:59327568"
     CDS             316265..316909
                     /locus_tag="HG536_0G01860"
                     /inference="similar to AA sequence:RefSeq:NP_011677.3"
                     /note="ancestral locus Anc_4.59"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141001.1"
                     /db_xref="GeneID:59327568"
                     /translation="MRRNRSVESIETEYDTRRSKQFGSHLQPMSAHRTVHQRKLSCEE
                     IINEMEKEQDAMVVRLLREVERLREENVFLRKQLAHSSRSSSERDLNYADEYASNYHY
                     SLSEASSSPRNSLASRGSRPSLVAVGSANHTFPAESSMSSQSLQRERGSNSATSGGSS
                     SVLLSEGTERRSVTDIDPRVKIPRGWALSVDPAARLADERGVDTTRKLQEYKLR"
     gene            <317788..>320037
                     /locus_tag="HG536_0G01870"
                     /db_xref="GeneID:59327569"
     mRNA            <317788..>320037
                     /locus_tag="HG536_0G01870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285106.1"
                     /db_xref="GeneID:59327569"
     CDS             317788..320037
                     /locus_tag="HG536_0G01870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141002.1"
                     /db_xref="GeneID:59327569"
                     /translation="MLLKTLAVLSLFCSRISALPTTTICHTVIDTSYYCPCQSSTSTT
                     ACETTPLPETSTETISTTCTTDSTRKISSTTCSESAFCESCTTSSTCTDSTSSGSSGS
                     CPGCTVSTSASTTSGTLFSTSSCESHTTKTQSTSQSTSSAVLQSSSSSATEGTTASTS
                     ATSSTTEGTTASTSATSSTTEGTTASTSATSSTTEGSTTSTCITSSTVPTTGSTSTSS
                     STVSTSNSIFSSTSHSRSTSTTPITGSTIVSSSTISKTESSIVSTSRSTIASSSTVST
                     NESMSPTTSMPWTTDRTSHSSASRSSSTVSTTSQLSTATTTGEKSSATSWTTSTGPSM
                     SPNSSIAGTTSSECSACSHTSSSPMVSTETATRTDTTTSTICTSCSTIADRNTSSDYS
                     NACSDRTATVTKLESIISTVTQTQVSTMPCGSNDGTPSTRTVISYVTKSPEQPSTVTE
                     TVFMQSTNNESSHDSNGFCTTLVTMKITETVSQATEVVTITSTESVIQTAAGPGTAPA
                     PIISTITTTVANEANLTQLSCASNMVTITETVTETSCPSEASISTQVTATMILTSATE
                     PPADSSVLKQVTSDTTNTVTQSSISTELIGPTTAETATESGLSSGSIVIATSSSFQVS
                     NSVTTVYSSTSEPATSDVATTTTVFSSNTGPPSVEITTPVTLRTDSVNTPIGNKVTTL
                     PTDQTPIWSSTTSASAPNQLSTSQTSNLAASVQTTQPVPTFSITTFTGSACSNGVSLL
                     MFLPMLVLI"
     gene            <320403..>321794
                     /locus_tag="HG536_0G01880"
                     /db_xref="GeneID:59327570"
     mRNA            <320403..>321794
                     /locus_tag="HG536_0G01880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285107.1"
                     /db_xref="GeneID:59327570"
     CDS             320403..321794
                     /locus_tag="HG536_0G01880"
                     /inference="similar to AA sequence:RefSeq:NP_011675.1"
                     /note="ancestral locus Anc_4.61"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141003.1"
                     /db_xref="GeneID:59327570"
                     /translation="MAKSATTTKKGSKKAVESKQEEKKAVKPVESSSSSESESSSSSD
                     SESSSSSDSESSPSSDSESSSSSDGESSSSDDESSSSESEQEEQQKEKKSQSSSSDNE
                     SSSSSSSESSSDEEEEETEKKEESKTSSSSSSSSSSSSSASGAEESDSSSDSDSSSES
                     SSSDSDSSSSSSSDEEDEEEKKQAEPEDKSSKKRKVDDSEEKKSKKQKVELSGEPATI
                     FVGRLSWSVDDEWLKKEFEHIGGVVSARVIYERGTDRSRGYGYVDFEDKSYAEKAVSE
                     MHGKEIDGRPINCDMSTGKPAGNSNNDRAKKYGDVPSEPSETLFLGNLSFNADRDTIH
                     ELFSKYGEIVSVRVPTHPETEQPKGFGYVQYGNVEDAQKALEALQGEYIDNRPVRLDF
                     STPRPNNERGGRGGSFRGNDRGGRGGSFRGGRGGSRGGRGGRPSGSGANTAPLGKPRN
                     TATFAGSKKTFDD"
     gene            <322200..>323816
                     /locus_tag="HG536_0G01890"
                     /db_xref="GeneID:59327571"
     mRNA            <322200..>323816
                     /locus_tag="HG536_0G01890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285108.1"
                     /db_xref="GeneID:59327571"
     CDS             322200..323816
                     /locus_tag="HG536_0G01890"
                     /inference="similar to AA sequence:RefSeq:NP_011470.4"
                     /note="ancestral locus Anc_4.62"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141004.1"
                     /db_xref="GeneID:59327571"
                     /translation="MSILSLFKRDGEQSLLRRRNSNYTFKSSSGILHNSVIRQFYIEV
                     KEPHRVWKPNEYISGEAVLVIKKDVTNIALRLVLSSEIKVRACTGATGRRKRAERLYE
                     KSTLLYGEDLAEGTGDGIINGLTKGEHRFPFRIKIPSGRKVFSSIKFERGSIRHFLQC
                     QIESIGSKQAEKPISCCEESFAVIVPVDVSELPSQKVKKVVLQSASMVRKQPRAVGDG
                     SSSSLTRATNQSSTSNSSNGSNKELNLVDKTVTISVNIPHSGFAIGETVPVNVAVQHY
                     KEFCHPAGLIVTLTRICRVNSGSKDEPMETFRKDLCQSISPLYVDAKTLNSNLTVYLK
                     VPIETFSTFTSLHKYFTFQYYIEVVVNLSQKNIVYTESNRAIGVPSESVHSQQGANLE
                     ENLSQIQRKFLMMVGNDSSMNEQNNIESNIFYKDMVNVEKLKRQNNVTGMSIETVIGT
                     TRSQNPPQPVELDQTTQIENVLAESPLASNTASPKHAGGDWLNPPYVYEHYPPVPQYT
                     PNKDIRVINDKQEMEYMRLKQLESSPPRDY"
     gene            complement(<323930..>324220)
                     /locus_tag="HG536_0G01900"
                     /db_xref="GeneID:59327572"
     mRNA            complement(<323930..>324220)
                     /locus_tag="HG536_0G01900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285109.1"
                     /db_xref="GeneID:59327572"
     CDS             complement(323930..324220)
                     /locus_tag="HG536_0G01900"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141005.1"
                     /db_xref="GeneID:59327572"
                     /translation="MHDAVVVELAQTDFDYVLAEHFNDKEQFILYANEQDFDLDTCLE
                     ICDGIELLNQDIIECQVEERSDIALAESDFKEMLQMEENGRIDMDSAVNDLS"
     gene            <324792..>325499
                     /locus_tag="HG536_0G01910"
                     /db_xref="GeneID:59327573"
     mRNA            <324792..>325499
                     /locus_tag="HG536_0G01910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285110.1"
                     /db_xref="GeneID:59327573"
     CDS             324792..325499
                     /locus_tag="HG536_0G01910"
                     /inference="similar to AA sequence:RefSeq:NP_011674.3"
                     /note="ancestral locus Anc_4.63"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141006.1"
                     /db_xref="GeneID:59327573"
                     /translation="MKVQDRRRILGPSNAKPIEFGADRAAASKAVKSSDEPEQLVLRT
                     GVIENCNGSSLVEVNGGGRQVSLLSSVYGPRALRGSFTAMAAISIQLQNGSQEKYDSS
                     LLREAASFLSNIFEAVVNRSRYPKSGIDIFVYLTYDLEQASRTNIAAIIPHCITAVTL
                     ALADAGIEIVDLAGGGFHGGNVFSFIKNGEEITGFWKDEGVGDDVAGSLEECKRSYLR
                     YKGLMVDCLMQKQVMKE"
     gene            complement(<325569..>328070)
                     /locus_tag="HG536_0G01920"
                     /db_xref="GeneID:59327574"
     mRNA            complement(<325569..>328070)
                     /locus_tag="HG536_0G01920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285111.1"
                     /db_xref="GeneID:59327574"
     CDS             complement(325569..328070)
                     /locus_tag="HG536_0G01920"
                     /inference="similar to AA sequence:RefSeq:NP_011673.1"
                     /note="ancestral locus Anc_4.64"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141007.1"
                     /db_xref="GeneID:59327574"
                     /translation="MSRDQKHSARTRSTGVTFDPPVTHDMVRSLFDPTVRKSFLEICI
                     TLALLSNFGLCYWLLQRCELKIVKMVFLFQYMFWRIGYNLGIGTVLHFQSHWESLTKF
                     ARRNKLFQKGTGSLLAKFCQFELFTKMSKDYKVYENPEELNVWLLFRQFVDLILMQDF
                     CTYVIYVYLSLPQEKAALINWKTAVGISMVLFNIWVKVDAHRVVKDYAWYWGDFFFLQ
                     DSELVFDGVFNISPHPMYSIGYLGYYGLSLICGDYRVLLVSMCGHYMQYLFLKYVESP
                     HIERTYGSESNAESETNSKIDDLIAKKNYNYSRPLINTGFGFANFDILRFSDYFTIAT
                     SICLILWTVFIKPSDQLLFNLAFGAKAFSSIGVSIILYKQSKEKWFTKLYLKNGHTQV
                     HSYQQWQFIYNFSLCLTYTLLGCQTFSRVRDLYPNVDNTQLIFGLLLCSLQSWCNSEI
                     RSAIYDFGWFYGDFFLTNYVTKRALTSHGIYRYLNNPEAILGVAGVWGTVLMTNFYWE
                     NIALAALWTITNFILVRFIEQPHMSKIYGAKMRIGGIEKTLLESKTWRRVSGIVDKIE
                     EVVIRALLQDINDEKESALSNNVLDEEVDQKAELQNLEDAMEDAFCNVTSQRSASCRL
                     EIESYGTGSFVVGQPITLDWSVPSSTYKTDDWVGLYDVLRSGSDRRRTKSSSLGHWSA
                     TSPAGYPEDTPNNRSIAYFKKGSLVEGKIVFDSSLLFFEPGIYEFRYHSGNSHKVLCV
                     SKPFEQVLPKLPIDSPEILCEYFLKFLTQVDALTDGRFDPQRSRNFTISHFKKLIKGS
                     LGVELSSDYIKRVKGDLHIISSRICHIKEVLDSLE"
     gene            <330623..>333880
                     /locus_tag="HG536_0G01930"
                     /db_xref="GeneID:59327575"
     mRNA            <330623..>333880
                     /locus_tag="HG536_0G01930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285112.1"
                     /db_xref="GeneID:59327575"
     CDS             330623..333880
                     /locus_tag="HG536_0G01930"
                     /inference="similar to AA sequence:RefSeq:NP_010778.3"
                     /note="ancestral locus Anc_3.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141008.1"
                     /db_xref="GeneID:59327575"
                     /translation="MTIAGEDSRPLLPTDEYQIASQLAKKHGVVQRGSANFSIRSSSN
                     RNISHLYVKKPAPLEKALTDTDNFIEIHAKRAHQMEGSEDESKPAEAVDGSSTYSLES
                     EDASEKSLGEGTASTGDEKDYLDLGHQMDLDPRLKKQREEWAERGAAKILREVTNPET
                     GKTTKHVVKKGIKDFIFGDTLGDGSYSTVLLATSKESGKKYAVKVLSKEYLIRQKKVK
                     YVNIEKSALQRLNNSRGIIKLFFTFQDESSLYFLLEYAPNGDFLSVMKKFGSLSEECA
                     CYYAAQIIDSISLLHSRGIIHRDMKPENILLDKNMKIKLTDFGTAKILDPEPDSTDSF
                     DLFSRSKSFVGTAEYVSPELLNDNYVDFRCDIWAFGCILFQMIAGKPPFKATNEYLTF
                     QKVMKVQYAFTAGFPLVIRDLVKGILVKQPDQRLTIPQIQKHHFFKDVNFKDGSIWER
                     PAPEIQPYKVNAKSMQPIPALSTSTGTSRRPVLTRPYAKSTSNLPSNSGSSGSSNLGK
                     LPPASATPTQKKALDERTAQILRNAKRAVGNRKIANQNRRTTSGAASAASVALAGKVS
                     DPPSPMVTIGSQSSALQHRTKPPATYRSSSSLSSPQMNGSDLPSKSPPAPSGTTSSSA
                     KAPSSQRVASEKTTSHTMNKTDVIWSYYLKNIDEHVLGVGEISLAVTTTDYLEKRVSK
                     AHGSLDDPVYVPNSSKTRLSQVVRAGGDVTGFRTDSNQSLPAEATFYEQTYFDHDNVS
                     MDYKKPGGELPQSPTSERKVAGSPVESNGSDDVGNLAITEKFKKLFHHSSNKLENVHE
                     PIETGDFFKRMLLVTNHGRCLVLLKKLKSTPGTAANYQSIYDIDLCQQGTRLKEITLP
                     AADNDYRMFAIQTPYNSFVCKTSKESIDSWLRTISGAMRSGHGYFMAKFRKGDNVRSE
                     AFAAARLASPGLTHGARFSDRGDSSSTVHPSSPSKAFDTGSPNTSVNDSKQDTNGGTS
                     ATAKSGRFFESFINSRERTSKKHASPVPLPTKLVNGLPPVSSPTSLRSSDPHHDPGSP
                     AATSSEARRIATFGVPDHHHDPGSPAATAKEARKIVTTANSRLLARSEQSLRSPK"
     gene            complement(<334065..>337163)
                     /locus_tag="HG536_0G01940"
                     /db_xref="GeneID:59327576"
     mRNA            complement(<334065..>337163)
                     /locus_tag="HG536_0G01940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285113.1"
                     /db_xref="GeneID:59327576"
     CDS             complement(334065..337163)
                     /locus_tag="HG536_0G01940"
                     /inference="similar to AA sequence:RefSeq:NP_014543.1"
                     /note="ancestral locus Anc_3.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141009.1"
                     /db_xref="GeneID:59327576"
                     /translation="MVFNKLISFQLDYAPQYHLTKYISSRTRLQLVHINHKSSPLVQG
                     YFAVATECATDSGTPHTLEHLIFMGSHQHPFKGLLDTAGNLCMSSTNAWTATDQTVYT
                     LTSAGWKGFKQLLPAYLDHILHPTLTDEACLTEVYHIDPQDLSDKGVVYSEMEAIESQ
                     NWFVTMLEKQRLMFKEGSGYRSETGGLTPNLRQLTSEDIRKFHKQSYSADNLCLIISG
                     NIPEGELLEILQRWDDTLPKFELVGRKRPFVDSENSKIPESLSVMSESAVEFPELDES
                     QAELLFSWIGEPYHAYVNDLAATMLMDYFTETVLAPFSKELIEIEEPYANSADYWTDD
                     FSRTIINLGIHGVPTERLEETKQKVLQIMSTHEVDISRMRKVIDNYKWDYVLRCEKNG
                     DTVLSQAVITDFLYGNEDGSSLEKSLKDLSDFDELQKWSQEKWQQFLHRLFVNNKPVI
                     IKGVPSSSMYEQLQKEREELIQKRETVYGVEEKAKLHQLLSSAKSHNSKPIPSSLLKE
                     FTIQDPSDSVNFITTRSITAIENFEHNDAADQVTKDILAQRPKDFPLFLHLEHYPSQF
                     VEVHVLLNTNNIKDCTLLPYYHILEEIFSMPMEVEDGKIIPYEDVVSRLQSETIDSGV
                     SMGLGNSATDLIDIRIRAKAENYAKAVEWIKHCLFDMVFDEKRVAVLLDNYLASIVEL
                     KREGDIMLESLTNRKLYSTRSLKKSADPLHVEDVLHQVSEDIRSGRYEQSVRPKIEIV
                     REQLRSNFSKLSFLILGDALKIGPDVFKPWKSLIERFGSISSGQEVKLPPVPKLLDAI
                     SSLCKDPREKAFIITTPASESSYMNVITSVPLNMDYRHPDYAIVALASEYLQCVEGPF
                     WKGIRGAGLAYGASVLGIPEANSWAFHIYRGADILKCYQVAKEIVEQHASGAIEIDEL
                     LLEGAASMIINRIATKENSYASAAIANFTDNFILKRGPHFNEYHIKRLSEVTIADIRN
                     IIKKYFVNLFDAQKSCVFVSCHPSKLEVTQEFLEKEGFTVEVEELDDEEEEDELEEVS
                     EE"
     gene            complement(<337731..>338645)
                     /locus_tag="HG536_0G01950"
                     /db_xref="GeneID:59327577"
     mRNA            complement(<337731..>338645)
                     /locus_tag="HG536_0G01950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285114.1"
                     /db_xref="GeneID:59327577"
     CDS             complement(337731..338645)
                     /locus_tag="HG536_0G01950"
                     /inference="similar to AA sequence:RefSeq:NP_010777.3"
                     /note="ancestral locus Anc_3.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141010.1"
                     /db_xref="GeneID:59327577"
                     /translation="MDISIDDILAELDRDTTIVERSDPSSQVPLTSDGNTTMVNSSFD
                     PGQIPLRKAGLQDDITPEKDYTRLMTLWRNERCSPELLPFPTLLMNRMLRRVQEQMEK
                     IENISMGFYEDGAAGPSQQPNESAFGSNKDKLPLLCMEAELERVKFVIRSYLRCRMHK
                     IDKYMLYLKQLEYAGNNAASLKELLSEQELVYHSRHFASLLKLFNSSVLRHMPPELQA
                     VNDTEGSISMVDEPEWGRFVFLHVKMPSERALKEDPLLERNEFGKPCYIVTIQELNED
                     VELTVGGIYVMRYEVIRDLLRDGKVELI"
     gene            <338794..>340563
                     /locus_tag="HG536_0G01960"
                     /db_xref="GeneID:59327578"
     mRNA            <338794..>340563
                     /locus_tag="HG536_0G01960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285115.1"
                     /db_xref="GeneID:59327578"
     CDS             338794..340563
                     /locus_tag="HG536_0G01960"
                     /inference="similar to AA sequence:RefSeq:NP_010776.1"
                     /note="ancestral locus Anc_3.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141011.1"
                     /db_xref="GeneID:59327578"
                     /translation="MDKLAELEEKKRQLKQLRERRLYAGRESLVDHLLQGRQQDRNRG
                     NGYMVCRSVQTDAAGEITPLAPTRITTYDKMVQTTVINGDEASTVEDSGSDELESASD
                     TELAPEHDKVKPLASVMVEDQQNTVKIKSFSVQEVLDESFPRENALLSGKCKSGILPI
                     YRWNAELEERAQAELRPVCLDNIGNLVAVLFQSTPVDRNDVLMAPWSYLFVLKWDARQ
                     VVDKIEFRGQTITKARFLRKDIASNVISLLAVSHTGKTTLTELRCVEDLDSVKKLERN
                     IISKNVFATAVPALEEYRGVPPGHERFIAASSNGVLNELSSLDLSIYADATSCQPPLS
                     NIKVVPPRPSELVVVGHHEDDEEGGNMETKSGVGEEKFRQHLLKISLFDSLAISAISL
                     SPSDSRLVYAGTEDGGIYKLNLDKIQDGTLKIFPTNDGFLPTKGRAALSGNSLPMFHS
                     SHVVALSHNADELLMSASFDWTCALWDPLNCSQLATIDMGSPVLDAAWLDDESRFCGI
                     LTWDALSIVEWQYHAVTDANTLNDRWESTMAPKIICRLSSNEASCRSFTCFKNFKRDD
                     VGHVFAVGCDDQEIRFYSMALQS"
     gene            <340791..>341435
                     /locus_tag="HG536_0G01970"
                     /db_xref="GeneID:59327579"
     mRNA            <340791..>341435
                     /locus_tag="HG536_0G01970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285116.1"
                     /db_xref="GeneID:59327579"
     CDS             340791..341435
                     /locus_tag="HG536_0G01970"
                     /inference="similar to AA sequence:RefSeq:NP_010775.1"
                     /note="ancestral locus Anc_3.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141012.1"
                     /db_xref="GeneID:59327579"
                     /translation="MSEKSTFMPIEDAVAHFRQNKFLIVMDDEGRENEGDLICAAANV
                     STEAMAFLVRHSSGYVCAPMSNEIADKLDLPLLRTGMKYESNADDRHGTAYTITVDVA
                     EGTSTGISAHDRALTCRRLAEPTAKATDFLKPGHICPLRAADGGVLKRRGHTEAAVDL
                     CKLSGLPPVGVICELVKDEDGSMMRLDDCRDFGAKHNIPLITIEQLVQYLESIQ"
     gene            complement(<341539..>342846)
                     /locus_tag="HG536_0G01980"
                     /db_xref="GeneID:59327580"
     mRNA            complement(<341539..>342846)
                     /locus_tag="HG536_0G01980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285117.1"
                     /db_xref="GeneID:59327580"
     CDS             complement(341539..342846)
                     /locus_tag="HG536_0G01980"
                     /inference="similar to AA sequence:RefSeq:NP_014544.1"
                     /note="ancestral locus Anc_3.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141013.1"
                     /db_xref="GeneID:59327580"
                     /translation="MSSEDMAEVSQGVADIKTGGPAGERKEQIITPWDVEGAVDDQGV
                     AQAIDYDKLLKQFGTKKITPETLERFEQVTGHRPHHFLRKGLFYSERDLTKILDLYEQ
                     GKPFFLYTGRGPSSDSVHLGHMVPFIFTKWLQDVFDVPLVIELTDDEKFLFKQKLTIK
                     DVKKFAADNAKDIIAVGFNPENTFIFSDLQYMGGGFYETVVRVSRQITGSTAKAVFGF
                     NDSDCIGKFHFASIQIASAFPSSFPDVLGLPDKAPCLIPCAIDQDPYFRVCRDVADKL
                     KFTKPALIHSKFFPALQGPTTKMSASDETSSIFMTDTLKQIQKKINKYAFSGGQVSID
                     LHRKLGGNPDVDVAYQYLSFFKDDDELLADLAAKYKSGDLLSGEMKKACIEVLQEFVK
                     NFQENRAKVDDATLEKFMKPHKLVWGQKERLVPVKPKESKAKK"
     gene            <343929..>344609
                     /locus_tag="HG536_0G01990"
                     /db_xref="GeneID:59327581"
     mRNA            <343929..>344609
                     /locus_tag="HG536_0G01990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285118.1"
                     /db_xref="GeneID:59327581"
     CDS             343929..344609
                     /locus_tag="HG536_0G01990"
                     /inference="similar to AA sequence:RefSeq:NP_010774.4"
                     /note="ancestral locus Anc_3.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141014.1"
                     /db_xref="GeneID:59327581"
                     /translation="MDRIFGYGNRKTHEQMLQESGKAMDQAQQGLQERVSQLDTQISQ
                     LNFQLQALQKKIASSRSAAGQRPLRQQALKLLTKRKKLEQMRDSLDSQSWSMTQAQMT
                     SDNLRNTMVTVNALKQTNKALKAQYGKINLDRLQDMQDEMADLIEQGDELQQILAMNS
                     VNGDIEDIDESELDAELDALAEEQLMGPGMEEAGLDVPSYLTDTVPQFIDEGPQTESA
                     DKALESAQ"
     gene            complement(<344630..>345565)
                     /locus_tag="HG536_0G02000"
                     /db_xref="GeneID:59327582"
     mRNA            complement(<344630..>345565)
                     /locus_tag="HG536_0G02000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285119.1"
                     /db_xref="GeneID:59327582"
     CDS             complement(344630..345565)
                     /locus_tag="HG536_0G02000"
                     /inference="similar to AA sequence:RefSeq:NP_014545.2"
                     /note="ancestral locus Anc_3.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141015.1"
                     /db_xref="GeneID:59327582"
                     /translation="MNQQGLAMKLRPSLRRIDGLCRNTYRYFTMRQKSTLTSNDEISH
                     FKELAPSWWDVNGPQKILHLMNNGRMDFIQRIMRQRVKVTNPDTYIPGFNYREFFPVS
                     VSRNIQHELDLEVDSRLQAQKLSALDIGCGGGILSESLARLPYVEHVTGIDLTEECIQ
                     VAREHALRDPQLLHKLSYDVKSLEDVETEFDIVTCFEMLEHADLPSEILRHAWLRLKP
                     NGVLFLSTINRDIVSWFATIFMAEYVLGIVPKGTHNLNKYINAAEIIDWFKNNEPHTH
                     QILETKGTLYLPIKGWVEHDCSDVGNYFMAIRKLE"
     gene            <345734..>347974
                     /locus_tag="HG536_0G02010"
                     /db_xref="GeneID:59327583"
     mRNA            <345734..>347974
                     /locus_tag="HG536_0G02010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285120.1"
                     /db_xref="GeneID:59327583"
     CDS             345734..347974
                     /locus_tag="HG536_0G02010"
                     /inference="similar to AA sequence:RefSeq:NP_010773.4"
                     /note="ancestral locus Anc_3.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141016.1"
                     /db_xref="GeneID:59327583"
                     /translation="MSDSDIENLEDEYLMATRKRRANAGSKMKKLIAQEVEEMQSKTE
                     SLNDDELDLLFKEDAEDEDFEDGKSEESGVEELVEQEAASQVEDNDLLVSESEEEVSE
                     QDDESNEKELQRQESLQQKRKRRSKPPIIKRKAAKAVGTASPAEAVKKKTAYEVLKAE
                     SLLVSDRRTSKRSHVVANKLEVYEKLSLAEQKRKIIQERLKKHKEKQNEKVLTQQDRL
                     RLSLETEKLNLQSLDKYKEQEISKKQTRLAIQQRQKTKFKPGEPILRELTTSWIVTPI
                     MEYEDKLYWDEQQRKREKKRKKYPRRQAKKKSPAPAGKDSKLESQQKNGETAVKNENG
                     KAEMAIGNESKDPGTMGPGAVKPSDVTEGQNDGAAGLNGGQKSVKNGISSSNVQRDSM
                     RQAESEPAVIETESRDQMVLIDQGMEQKGLTIESSERKVDEIAINAVTGQPAVSENSR
                     NEDQISQQDELSSSSQIKVESSQNVDGSAADQPPVCLQPENSEVFTEKNGEPSSAGGP
                     HVSFAETDTLQAGQQVSDVSKSVGVNESATPELIDDNGTEEEMILEGPAQEVSKNFVT
                     VYNFGSDSCNFDFRASLFGPQWQGSHNQRAANVENICKISLPENPLSSSEKSPIIPDL
                     SFLSNFPVFGEYGKRVVYDVGLNTGKEMEIEIKTQPPSGVLFSNGVRKKCFITSKECQ
                     YFDPKNGVPYSDVEAYKVIQELQDPLGSGSEDSPNPHFQWFGFKNGGVYLDMLQRPAS
                     GVPEGF"
     gene            complement(<347993..>350146)
                     /locus_tag="HG536_0G02020"
                     /db_xref="GeneID:59327584"
     mRNA            complement(<347993..>350146)
                     /locus_tag="HG536_0G02020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285121.1"
                     /db_xref="GeneID:59327584"
     CDS             complement(347993..350146)
                     /locus_tag="HG536_0G02020"
                     /inference="similar to AA sequence:RefSeq:NP_014546.1"
                     /note="ancestral locus Anc_3.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141017.1"
                     /db_xref="GeneID:59327584"
                     /translation="MAADLTPSQSKVVDFPYLPNSTLKVVAGPGSGKTLTLLHKVYHL
                     IESGEIAPNEILILSLTNKAVDNVITRLFDVFEQLNEKHTEEQLREIIGDLEVHTVHG
                     LANRVVIENEGIINIIEENGWRGLMKLVSEDFWKNKRPRMPSTKDFKKLFEQYKNQKT
                     GTKDVVKKLTDIMQNCGVVTNEELIDRASRYLSSDLVSESETMQYTRELKGKIKVVII
                     DEFQDLYPSLLPLLRRISLGKQLILFGDSNQSIYSFLGSNKEAMRAIEGIHTGQDFHV
                     MHLHDNFRCTPEIMAAATQVIPAKRKEMKDGEIEKVCKDKCGVKPIMENFSNPLDELE
                     FVRDQISQLVCASARLSDIAILTRTNNQMQLIADHLQSYGINSHKLTAQPDWMTDTRI
                     QFLIDLMKVISLSHREESLERKNSMNRPWKSDFSLIVTLGALKGATNQSIQILYNECL
                     RRDTSLWRYISSVPVSDWPTAVTNKRKISNCAIELQKLMNNGEFLYSDDPMHILREIC
                     SFAHEMGFQMLQPTSDGDAEQFRQHLEDMYTILKLCLTNRPNDMPLIEWFLHSHFEQS
                     LSYYHQNPVPRAGSRDVLKISTIHSSKGLEFPIVFLMGGLSWFQTFSQFEDNVLYVGM
                     TRAKNLLYLLNTKHPGLDCEPTKRNIMANEKFWRYYNTDLNRATAADSMSAIRRYDCL
                     QRKYGGFSINHRPFSTLSVARNNKLIKLVAYIARK"
     gene            complement(<350281..>352047)
                     /locus_tag="HG536_0G02030"
                     /db_xref="GeneID:59327585"
     mRNA            complement(<350281..>352047)
                     /locus_tag="HG536_0G02030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285122.1"
                     /db_xref="GeneID:59327585"
     CDS             complement(350281..352047)
                     /locus_tag="HG536_0G02030"
                     /inference="similar to AA sequence:RefSeq:NP_010772.1"
                     /note="ancestral locus Anc_3.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141018.1"
                     /db_xref="GeneID:59327585"
                     /translation="MEALENVLGVKFDNLDAFDEASRSWTDSEKAYLANCHDQRFQAN
                     NSLWKELDILKEKHKKVQMTLNDVIPPLREYIESFNQQLTDFTSDLGFIRNKSSELKS
                     LLEYNSTKLANVSPLVNDLMLSPSVINDIVHGKVNEPWLDGIAYLKDKQQIYAKYLNS
                     DEIAVPKDFDRLCEVLEYLKAMILEKSRRFVVHQIKLLRSHQPIPSQQIQKKLIEVKE
                     IFQFIVENDHSLALELRQAYAYSMRWYYKAYFARYIRSLTILQFKSIDSQYALGNGLS
                     NTSINRSTTFGISNYLTASYGRSAGTITDESIQEYFQVDKRISLLTQEDNTVMVSQIA
                     ENNTMQNYIEIGYKNLNLAILDNCRVELEFVKTFFQLSANEEESLGLVEQIFQNTFNE
                     ALEYTRQLIQHTYDLFGVLINIRVTQQLQLESEKHHLTVMKDYLDTQLMILWPKLQQL
                     VDFQCESLRKVPITTSIAKLYGSQEDPLTTPHELTVQFSRFLTSLLKLATTHEKQVDE
                     RSEPLYNSIIRIRNDFETVMTKCSKKSKSPERMLATNYMYLYNAIQHMHIHEPDSEPL
                     PLIVKETEDHCKALVEAFSKVT"
     gene            complement(<352219..>353184)
                     /locus_tag="HG536_0G02040"
                     /db_xref="GeneID:59327586"
     mRNA            complement(<352219..>353184)
                     /locus_tag="HG536_0G02040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285123.1"
                     /db_xref="GeneID:59327586"
     CDS             complement(352219..353184)
                     /locus_tag="HG536_0G02040"
                     /inference="similar to AA sequence:RefSeq:NP_014547.1"
                     /note="ancestral locus Anc_3.103"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141019.1"
                     /db_xref="GeneID:59327586"
                     /translation="MSRPQLTLQLPWVEKYRPQKLRDIVGNEETVERLEQIAKDGNMP
                     HMILSGLPGIGKTTSIHCLAHELLGDSFSQAVLELNASDDRGIDVVRNQIKHFAQKKC
                     HLPPGKHKIIILDEADSMTAGAQQALRRTMELYSNTTRFAFACNQSNKIIEPLQSRCA
                     ILRYSKLSDEQVLKRLLTIIKAEKVECTNDGLEAIIFTAEGDMRQAINNLQSTVAGHG
                     LVSGDNVFKIVDSPHPLIVKRMLLAETLEESITHLKNDLWDKGYSAVDIVTTSFRVAK
                     SLYQLKEAQRLEMIKEIGITHMRILEGVGTYLQLASLLARIHKLK"
     gene            <354149..>355132
                     /locus_tag="HG536_0G02050"
                     /db_xref="GeneID:59327587"
     mRNA            <354149..>355132
                     /locus_tag="HG536_0G02050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285124.1"
                     /db_xref="GeneID:59327587"
     CDS             354149..355132
                     /locus_tag="HG536_0G02050"
                     /inference="similar to AA sequence:RefSeq:NP_014548.1"
                     /note="ancestral locus Anc_3.104"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141020.1"
                     /db_xref="GeneID:59327587"
                     /translation="MSFEKMQFKQASTMASPLVSIKSQAIEMSEPNEEITVRRSTVIP
                     PVPEGMSKRQWKKVWKKQHYKDHQEEYAKVRKQKRQRAKENRRAKLQAFLERGEAIPE
                     ELKRPPKVNANQKPSGIKIIIDCAFGDLMNDKEIVSMSNQITRTYSSNRRENHCADVV
                     VTSFNKRLKQRFDEGLKGCKYEEWQNFKFVPDEQPIVEADKSRLVYLTADTDEKLECL
                     EPGMTYIVGGIVDKNRHKLLCYNKAKELGIPTRRLPIGEYINLAGRKVLTTTHVIQLM
                     LKYFDNRDWKEALEYVLPPRKLERSDNDQKDDSESNGTVEETSVEPANSEL"
     gene            <355373..>356260
                     /locus_tag="HG536_0G02060"
                     /db_xref="GeneID:59327588"
     mRNA            <355373..>356260
                     /locus_tag="HG536_0G02060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285125.1"
                     /db_xref="GeneID:59327588"
     CDS             355373..356260
                     /locus_tag="HG536_0G02060"
                     /inference="similar to AA sequence:RefSeq:NP_009705.1"
                     /note="ancestral locus Anc_3.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141021.1"
                     /db_xref="GeneID:59327588"
                     /translation="MQLVPIEWTSQTISGISGSISIACWVIVFVPQIYENFYRKSADG
                     LSQLFVVLWLAGDVFNLVGAVMQKLLPTMIILAAYYTAADIVLLLQCLWYGPEEKVDP
                     IHLSPANPMNENVLHDVFHENQPLLQAQSPTAGLVATADDLLNTEVEVKKNYLHDGVI
                     VSAVILAGFLSWYISYCQNPGLSKPDGPTLEVNWLGQIFGYLSALLYLGSRVPQILLN
                     FERKSCEGISFLFFLFACLGNSSFILSVLAISLDKKYLILNASWLVGSTGTLVMDFII
                     FAQFFAYHRETKTVEQDSV"
     gene            <356494..>358779
                     /locus_tag="HG536_0G02070"
                     /db_xref="GeneID:59327589"
     mRNA            <356494..>358779
                     /locus_tag="HG536_0G02070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285126.1"
                     /db_xref="GeneID:59327589"
     CDS             356494..358779
                     /locus_tag="HG536_0G02070"
                     /inference="similar to AA sequence:RefSeq:NP_014550.1"
                     /note="ancestral locus Anc_3.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141022.1"
                     /db_xref="GeneID:59327589"
                     /translation="MLDQDSNSDGDLKLQDSSEEIIGPQDSIANPQLPPLEDYHIRED
                     DDDITSSDEDTEGHRDSSFRSWFSRSRHHKPISESVSPVKLDPSSSSECAIAEGTPNR
                     SGSSSSFRKGFRSLFRRDSGNEDVLTETPKDGLSKSDDEKGTGEDNEGLPETSTNSKF
                     WRSWRSGHHHHHRHRHRHSPEACEPMCTGGEADPETLRNPSLDVGSMISHEEKRQKNM
                     AKLADQLEDISANPSPERDLVRPDNVSTPEQKSSDVESTQSDASTSSSVERALNVRER
                     VGLVFSASSADNGRQKQEEISPLTPPGDVLENPYKYVFDQKDDPISILAQDATLLYKY
                     CKTFDNFDSALKLLTRNAKGLNFSDDHSSMTLSEISNEVLDFIRHEMLSHDRSVKKNE
                     VMASDLTSLQKQIESLRADCEAKDAKSAGLQEALNAANVKIRKMGDDLEEAAQEVDML
                     AQEVESYKGQIQEIKLHERKAIEESEIKIAQINEDKESSLKDNTEVLKENTFLKERID
                     ELEKEHKALIFDHEMLQEKHSTTTARLADLVGSYNKGQGQERNMRDNLEATGTKLRRY
                     ENTIEILKIGNLKIQENFHRERRKVLDLRQEVNYLRKQLQFIECHRSQSLQFMSHLMF
                     YYRGIVTDDTLAEYDVYLKKLSASDFLPRTVHLTDDEMKAHFKEREALVVKFYNDIAK
                     RSFLDQVVSKHVSYMRSNKFLSSQLAGLRKHIDEYEQYVGRLLKEILTHKNLEEKNEQ
                     KIALLKEKNNEYKSKLSQIAN"
     gene            <359087..>361978
                     /locus_tag="HG536_0G02080"
                     /db_xref="GeneID:59327590"
     mRNA            <359087..>361978
                     /locus_tag="HG536_0G02080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285127.1"
                     /db_xref="GeneID:59327590"
     CDS             359087..361978
                     /locus_tag="HG536_0G02080"
                     /inference="similar to AA sequence:RefSeq:NP_014551.1"
                     /note="ancestral locus Anc_3.107"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141023.1"
                     /db_xref="GeneID:59327590"
                     /translation="MSSSRPELKFSDVSEERGFYRRFVNLPEKPFTTIRIVDKGEYYT
                     VIGEDANFVAENIYHTHSVLKDCKVDPVAAKEFKGPQKYVTVSPQVVSNLLKTCLLEL
                     NYKVEIYDKQWKLLKSASPGNIEQVQDIMNLSMDSSVVMASLKLQFNSQEGYCVIGVS
                     FVDTSDYKIGMLDIIDNEVFSNLESFLIQLGVRECLVPDVSKNENVAAEVKKITGVIE
                     RCGSVATFVKSQDFSEKDVELDLAKLVGDELALSLPKHSNLALGACRALLGYLQLLSE
                     QDQMGKYEIVQHSLEEFIKLDASAIKALNLFPQNQSRSFTTPNVPNVSFGGLDSNRSK
                     ISSLFQLLNNCKTNAGVRLLNEWLKQPLTDVDKITKRHILVEYLIDQLELRQMLQSDY
                     LPSIPDVRRLTKKLLRSGNLEDVLKIYQFCKQIPEITQLLDSFLNDDQISEEVKNLIR
                     MVWLEPLLAQTDPLSNLKEMVETTVDLQVYEECNEYMIKVEFNEELASIRQKLDALRD
                     QINAIHLDSAEDLGFDPEKKLKLENHHIHGWCMRLTRNDAKELRKHKQYLELSTVKAG
                     IYFSTRQLKEIASETAVLQKEYERQQSALVKEIVSITLTYSPVLERLSLVLANLDVLC
                     SFAHASSYAPIPYVRPTMWALNDKRKTRLVNSRHPVLEMQDDVAFISNDVLLDDEAGN
                     FLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAVVDAILCRVGAGDSQLKG
                     VSTFMVEMLETASILKNATRNSLIIVDELGRGTSTYDGFGLAWAIAEHIAGKIGCFAL
                     FATHFHELTALADKLPNVRNMHVVAHIEKGEQSRSDSDDITLLYKVEPGISDQSFGIH
                     VAEVVQFPQKIIKMAKRKADELESLKKFNGDIKRAKLTQEELSEGSKALKILLKDWVR
                     QLKEQGLENPEKLSEQESQEKIQELLRSLTQKATASNDNYLKYLSETLL"
     gene            <362313..>363299
                     /locus_tag="HG536_0G02090"
                     /db_xref="GeneID:59327591"
     mRNA            <362313..>363299
                     /locus_tag="HG536_0G02090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285128.1"
                     /db_xref="GeneID:59327591"
     CDS             362313..363299
                     /locus_tag="HG536_0G02090"
                     /inference="similar to AA sequence:RefSeq:NP_009707.3"
                     /note="ancestral locus Anc_3.108"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141024.1"
                     /db_xref="GeneID:59327591"
                     /translation="MAEMLHPKLTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVK
                     AAVKAGYRHIDTAWAYGSEPFIGEAIKELIEEGVIKREDLFITSKVWPVLWDDVDRSL
                     NESLKSLGVEYVDLLLQHWPICYNKRNDPHGINGLARNPVREDGSPDYNESADWIETY
                     RQLEKIYSDPKDRRVRAIGVSNFPVEYLERVLKECNVKPAMNQVEMHPRLPQFELNKF
                     CREKNIKLTAYSPVGSHGAPLVDYPPIKEMAEKYNISPNDILTSYHVRQGSFVVPRSV
                     NSVRIASNIEFAPLSKEDIDKLSDLGRTDPKRYINEEWNKVVPGFTGTGPPV"
     gene            complement(<363895..>366942)
                     /locus_tag="HG536_0G02100"
                     /db_xref="GeneID:59327592"
     mRNA            complement(<363895..>366942)
                     /locus_tag="HG536_0G02100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285129.1"
                     /db_xref="GeneID:59327592"
     CDS             complement(363895..366942)
                     /locus_tag="HG536_0G02100"
                     /inference="similar to AA sequence:RefSeq:NP_009708.1"
                     /note="ancestral locus Anc_3.109"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141025.1"
                     /db_xref="GeneID:59327592"
                     /translation="MNGPNVFSKSDGTTLPEQFWSESGALSAAAAGNGGANQGKNTLS
                     ESRMSGTGNLNGSCCPGGFVGYPNFIDMRQYQQMQSQYQAPGLQSVSSNPGTGLVGSG
                     SNHSSPQPGDGILKKRVARACEHCRKRKIKCDAVNPETQKCSNCSKYNAPCTFKVREE
                     IERRRKGCDIRETVGAGPEDLGVLNFAAPSSAAENAPQLGIYPEDQMYQSGLQSSFQR
                     SSERVTSAGLSGRVEKLDRKVSSISKTLKDVESLLAELVGRKGKLKDTGELPKPKIKR
                     YYTAILTPQILTWADKRLNTYGTEKSIMSPINELLTITLKWQMIEKKALTDFSAPMIR
                     NGKFQLHPLPPRAQAKRIMENFRSAMLVSSAPGLVTADYYASLIDEFYSGKLLSYAEL
                     LLLHVSISFGAARMRILNPGDSYTLRKDRYDPTKEELQTIEYDCLLNAIYYYNKVSIS
                     GPSLTATQGLMLLSLHLRETRDSSLAFGVFTTAVKFAFDLGLHQRVSHLNLTLEEEII
                     RRTVWWHCANTDKWFALTQSRPALIKEQDMDLLSDQAYFDYMKTLLRLKGPSVAQDVE
                     KLTDLQSCLDYVINYCDLLPTYVSYFSLKLTRIEGRVAQHCFSVRSTMDSSIDEIIDQ
                     LLYLREELNDWDDNLHPSMQLSSYKSYLSLLYVRDAADNPALTYEVACSRVVRCHFRS
                     MHARILVGLFASSFLVDNISLLKGSRHPTSSIYRLFLNDTVEICMKMLRVFTTVDYEG
                     NIYSSSLYCLLTGVFALILYIIKYSEEEDTHRLTEILDLLISSHSHLIGENEEYLISD
                     NPKWNTSIFFYTILLSATIQYCQYLNLDIKYYALNLEAYKNMLTRIIDHSNIIKNRSL
                     DSLVLYTKRFKLTEDQTVSSDGSEPKPVSKDIHASTRLLYPSFSTFIGTNEDTLTFFR
                     SSEPFEVSTKPNPGYKGLEHQIFTNGSLFRIGGPNLLSSLESIGIESLGHGIENQNSA
                     VNSAIDVNDGSNDAQELFYPYALFYDRDLFFSNLIAEVLVPPK"
     gene            <367460..>368392
                     /locus_tag="HG536_0G02110"
                     /db_xref="GeneID:59327593"
     mRNA            <367460..>368392
                     /locus_tag="HG536_0G02110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285130.1"
                     /db_xref="GeneID:59327593"
     CDS             367460..368392
                     /locus_tag="HG536_0G02110"
                     /inference="similar to AA sequence:RefSeq:NP_009709.1"
                     /note="ancestral locus Anc_3.110"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141026.1"
                     /db_xref="GeneID:59327593"
                     /translation="MVGITDFFRRKKDGVDPKATEDIAKVVDICDGTSSCGSDCEEIA
                     ELAKGDQVYEGLKIDHEEPLYNSSKPPKVHFVVPTSQIDWEHDACLEDKSSVQYQVYQ
                     WCQKHNDQFSGVGKGQTLSCAVSSLPKDIMDVEVMRGTKNNVLVLPHFIWINGLESDK
                     VDQTLGELVPKLLSPDLVVDRLLEEHSMLSRAVERSFVLVCSHTRRDKRCGVLAPYLK
                     KAFDKHLQKQGLYRDNSDFRPDGVNVAFVNHVGGHKFAANVQIFLRDPCILIWLGRVK
                     PTNVPFIVDDILVPEKPRLQWPEKVRCVQKYAAW"
     gene            complement(<368422..>369228)
                     /locus_tag="HG536_0G02120"
                     /db_xref="GeneID:59327594"
     mRNA            complement(<368422..>369228)
                     /locus_tag="HG536_0G02120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285131.1"
                     /db_xref="GeneID:59327594"
     CDS             complement(368422..369228)
                     /locus_tag="HG536_0G02120"
                     /inference="similar to AA sequence:RefSeq:NP_014553.1"
                     /note="ancestral locus Anc_3.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141027.1"
                     /db_xref="GeneID:59327594"
                     /translation="MVARLIPFLLLVSILLGFGQAKQGPNTVDLVMSLDQYYDAVNSN
                     ESYTMVEYTTSWCHHCKKLAPNFVQLKQSFDADTAKPPVRFLEVNCEIFGTTICSGFP
                     GFPMIHLIQPRTKPLEMPDQNQPVPLWRRIFNYLTSKYTNPRWQLDPDRVIEYRGSRD
                     PESMKSFIEAVRKKDKLLRAVNRVLDESYDCNSEPEEQDKQLCEYGKKFIRDTERLSN
                     EDLAKERLKLENILQHNKELKDNLKVYNEVKLKLQLLNQLLVSSSTHDEL"
     gene            <369406..>370146
                     /locus_tag="HG536_0G02130"
                     /db_xref="GeneID:59327595"
     mRNA            <369406..>370146
                     /locus_tag="HG536_0G02130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285132.1"
                     /db_xref="GeneID:59327595"
     CDS             369406..370146
                     /locus_tag="HG536_0G02130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141028.1"
                     /db_xref="GeneID:59327595"
                     /translation="MLAAFGLVLNLLLLLVAANSHRERHAAVVARRMVNFESNLHFNS
                     LRTDGTPVSLVEYYVSSDSCPDVDGLSNNGNPILLLSKMSTSYKNWQRNSSVSLTIEK
                     EKWGHFDSAMRKPRGNFFGTLKKLELSHRDARHLARHFVIRHPDARHWLPGQGESHVH
                     DTQWFEFQVESVYFIGGFGDRAYIGNISGEAYHKKLGIDKIVDPCEYLHLDERRGHEE
                     ATQQQDSAFDRDSLQGFFQFIKSIVTRY"
     gene            <370300..>371016
                     /locus_tag="HG536_0G02140"
                     /db_xref="GeneID:59327596"
     mRNA            <370300..>371016
                     /locus_tag="HG536_0G02140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285133.1"
                     /db_xref="GeneID:59327596"
     CDS             370300..371016
                     /locus_tag="HG536_0G02140"
                     /inference="similar to AA sequence:RefSeq:NP_009710.3"
                     /note="ancestral locus Anc_3.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141029.1"
                     /db_xref="GeneID:59327596"
                     /translation="MSMSVRHFRGKSSRVDDSLESVVEDTTQPVISRQDEISDSESSD
                     DEPEETSSSEEDEKVVAIQRPQFLNKVKRQQTDAAAEDREAKRRDTLNERIRQENLAS
                     EAREKLESQLSTAFGTNDDLLRRILALDDNDAVDPEHERQEWLIRCAIRKKLRRDALL
                     AKQLEMEQYEANKLNIGQPADPVNKCETALLKPELESTGNARFKKPSQQWKPSKALNP
                     RFSSSTGMPEQKEETEYSYI"
     gene            <371083..>371817
                     /locus_tag="HG536_0G02150"
                     /db_xref="GeneID:59327597"
     mRNA            <371083..>371817
                     /locus_tag="HG536_0G02150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285134.1"
                     /db_xref="GeneID:59327597"
     CDS             371083..371817
                     /locus_tag="HG536_0G02150"
                     /inference="similar to AA sequence:RefSeq:NP_009711.3"
                     /note="ancestral locus Anc_3.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141030.1"
                     /db_xref="GeneID:59327597"
                     /translation="MSLQPLRDDLPRFLEPYLPQPSGSQAAKPFVTLTYAQSLDSRIS
                     KGKGIRTTISHAETKTMTHYLRYHHDGILIGSGTVLADDPGLNCKYGSEEGYSHSPRP
                     IVLDSRQQWRFEGSKMKDLYLKSQGQAPIVVVSEEPREREKDVAYLLCPYLSSSRVDW
                     KTLLKKLHDEFDIKSIMVEGGATVINDLLLKPALVDALIITIGSRFLGSSGVEVSPIQ
                     SVELEAVAWWNGTADAVLCAKLSGSK"
     gene            complement(<371858..>372505)
                     /locus_tag="HG536_0G02160"
                     /db_xref="GeneID:59327598"
     mRNA            complement(<371858..>372505)
                     /locus_tag="HG536_0G02160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285135.1"
                     /db_xref="GeneID:59327598"
     CDS             complement(371858..372505)
                     /locus_tag="HG536_0G02160"
                     /inference="similar to AA sequence:RefSeq:NP_009712.1"
                     /note="ancestral locus Anc_3.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141031.1"
                     /db_xref="GeneID:59327598"
                     /translation="MDQDNERNISRLWRTFRTMKEMVKDRGYFIAQEEIDLSLEDFKV
                     KYCDSMGRPQRKMMSFQSNPTEESIAKFPNMGTLWVEFCDEPTVGVKTMKTFVIHIQE
                     KNFQTGIFVYQNNITPSAMKLVPSIPPATIETFHEASLVVNITHHELVPKHIRLSDEE
                     KKELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRNSETAGRYASYRICM"
     gene            complement(<372729..>375692)
                     /locus_tag="HG536_0G02170"
                     /db_xref="GeneID:59327599"
     mRNA            complement(<372729..>375692)
                     /locus_tag="HG536_0G02170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285136.1"
                     /db_xref="GeneID:59327599"
     CDS             complement(372729..375692)
                     /locus_tag="HG536_0G02170"
                     /inference="similar to AA sequence:RefSeq:NP_014554.1"
                     /note="ancestral locus Anc_3.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141032.1"
                     /db_xref="GeneID:59327599"
                     /translation="MDELTISYGLLAPQSKVSRDLHILPITKILYPEGQDGFFLTCSR
                     DGSIIKNRFDAFGRLIRGKRMQAHSDWVTDIIQISRNKFITVSHDFSIVLLTLHDDSD
                     TWETKIIGDHGDYIKCIVHIPTDDNEFVFATGGLDRKVKFWNLKDDQAYLIDEFLNSS
                     DHDETGSIYAMAAIDHGMGFNLLIGDCNGDLILYSTTDKREFGRLTKAHKANIKIVKS
                     LDHSSKLVTACSDGLICVWDLKEDDKLVKCASYQWDCSVWGIYGTDLNMVYIGDSKGR
                     IKTADLSKSDQMSAVTIYDEAQHVSGDFSGKESKHGGILDLMISPDGFIMFSQSINSN
                     LSMLDLRTGKLEVIKGGFALIKSSLLTNRRHVITENTKGEIQRWDIVVCELVNTFEPA
                     EGGFDEVVTKYTSKEVLSHWCSVSVKVGMLFVKLNPRMSNTEVYGSALEGYRILNEVE
                     LNSDERYNLGKIVINSLFKEFVSYEMEKDKTYRKQLSSRKKDQNVAASAMELNLNFTE
                     SKIKDKRRKSAFYRFGSATPYQEYNMTSLSAPNTPLFSGEATGLPVDEHPLLPPPMTS
                     AGDKLTYEENELGVLSPFGASESRTLSSGSLIARKFKKLRPYSRNGSGTHTTVDSQAT
                     NSDFEDSTPEDEHPGERIVWNQAYNGENLSSQQAAEPLHAKFKPIETPATAAHQDIEP
                     NTLIKDRATYISDFFEQLHETYKQHQNSNSTSLKLLSRKLPESKIIRDPSLPIIRIRN
                     GVLLVVHSWNKRCCGGKVLFSSYLPASRSLDDDDASILQESDEDVDSNEDEERLSKYD
                     LMDNEYGNVMNRRQMFEQLEENLPFWFAKYLFCDERTAKQQPKLSFVIAPWQDHDGPI
                     SSGSQPQQSHHRLKFGRTKSADVSLGTTELPKISEINTKLVAPGMIKVKKIKVYIADR
                     FEAKTPEMKAKIDPSEWIELLCKSQVLDNDMTLSTVRTLYWKSQSDIVFKYRRKMADA
                     TLVTGGDGNSGSGDI"
     gene            <375947..>376240
                     /locus_tag="HG536_0G02180"
                     /db_xref="GeneID:59327600"
     mRNA            <375947..>376240
                     /locus_tag="HG536_0G02180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285137.1"
                     /db_xref="GeneID:59327600"
     CDS             375947..376240
                     /locus_tag="HG536_0G02180"
                     /inference="similar to AA sequence:RefSeq:NP_076910.1"
                     /note="ancestral locus Anc_3.116"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141033.1"
                     /db_xref="GeneID:59327600"
                     /translation="MSTRKAENDKILAQLKGKLWYCIERQIAEETPFDTSCTASFTNA
                     LVELCYLQLVEMGKDLEAFARHASRDTITVDDMMLLLRKTPHLQKMLLPDDLR"
     gene            complement(<376282..>377127)
                     /locus_tag="HG536_0G02190"
                     /db_xref="GeneID:59327601"
     mRNA            complement(<376282..>377127)
                     /locus_tag="HG536_0G02190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285138.1"
                     /db_xref="GeneID:59327601"
     CDS             complement(376282..377127)
                     /locus_tag="HG536_0G02190"
                     /inference="similar to AA sequence:RefSeq:NP_009704.1"
                     /note="ancestral locus Anc_3.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141034.1"
                     /db_xref="GeneID:59327601"
                     /translation="MLIRRLLSDSYRPLVRPLSTLPALRQQRQQQNATEFPLRTIPKL
                     ATFYSANPVHEHRVNRLESLLRRYVKLPTVSATQQQEQRPAWISFDEYALLGGGSRLK
                     PIQYQELLSLLNKLHAIDPQLVNDEIKVEVAQYFKKTKIQSVQNSVKSLDEFGRSTAI
                     GRRKTSVAKVQVVRGTGQILVNNRQLNDYFVKLKDRESIMYPLQVVDSVGKYNIFATT
                     SGGGPTGQAEAIMLAIAKSLITFNPLLKPRLRKAGVITRDYRHVERKKPGKKKARKMP
                     TWVKR"
     gene            complement(<377589..>378641)
                     /locus_tag="HG536_0G02200"
                     /db_xref="GeneID:59327602"
     mRNA            complement(<377589..>378641)
                     /locus_tag="HG536_0G02200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285139.1"
                     /db_xref="GeneID:59327602"
     CDS             complement(377589..378641)
                     /locus_tag="HG536_0G02200"
                     /inference="similar to AA sequence:RefSeq:NP_009703.3"
                     /note="ancestral locus Anc_3.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141035.1"
                     /db_xref="GeneID:59327602"
                     /translation="MSTGIPKTQKAVIFYENGGELQYKDIPVPVPKPNELLINIKYSG
                     VCHTDLHAWKGDWPLPVKLPLVGGHEGAGVVVGMGSEVKHWKIGDLAGVKWLNGSCMM
                     CEECELANESNCPNADLSGYTHDGSFQQYATADAVQAARIPVGTDLAEVAPILCAGIT
                     VYKALKSADVKAGQWVAISGAAGGLGSLAVQYAKAMGARVLGIDGGAEKEELFKKLGG
                     EYFIDFTKSKDVIAEVIKATDGGAHGVINVSASEAAITASTRYARANGTVVLVGLPAN
                     AYCKSEVFNQVVKSIKIVGSYVGNRADTREALDFFSRGLVKAPIKVVGLSTLPEVFEK
                     MEKGQIVGRYVVDTEK"
     gene            <379435..>382398
                     /locus_tag="HG536_0G02210"
                     /db_xref="GeneID:59327603"
     mRNA            <379435..>382398
                     /locus_tag="HG536_0G02210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285140.1"
                     /db_xref="GeneID:59327603"
     CDS             379435..382398
                     /locus_tag="HG536_0G02210"
                     /inference="similar to AA sequence:RefSeq:NP_014557.1"
                     /note="ancestral locus Anc_3.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141036.1"
                     /db_xref="GeneID:59327603"
                     /translation="MADPSQASSSTSAFVSTLIFSGILGLIFLLVFVLLRPKKRRVYE
                     PRTLTDLQTISEEQRVERVPDGWFSWVPYLLNQPHSYLMQHAGVDGYFFLRFVGMVAS
                     LSIVTCFILFPILLPVNATDGRDYSGFELLSFANVTNKNRFYAHVFLSWIFFGLVIYV
                     IYRELYYYVVVRHAVQTSPLYDGLLSSRTVIMTELSDTFSHPGELERRFPEATKIFFA
                     LDHTQLQKYCKDRAETVARYEKTLNKILNKAVGMNLKAARKGKLDELYHNGSEAQDSL
                     ETYVPTNKRPTQRLGKVKLPYLSKKVDVIHYSQDHIAELNEKIHDEQRDWDQKATRPT
                     VFMEFGTQLEAQRCFQSLESVMGKSAFGKRFIGVAPEDVNWDNVSFTKNKRRSKRAVA
                     NTLLTLMIIYWAIPVAVVGCISNVNFLANKVFFLHWINNIPSVILGLVTGVVPALALS
                     ILMSLVPPFIKKLGKMSGCMSVQEADLYCQSWYYAFLVIQVFLVVTATSSASATVEAI
                     IKNPSSAMTLLANNLPKASNFYIAYFLIQGLTMPPFALAQIINLILSQLLGKILDKTP
                     RQKWNRYNTLAKPDWGVVYPTVQILVCIWICYAIIAPLVLVFSSVTLGALYLADVYSY
                     NFVQGFSADNRGRNYPRALFQIFVALYLAEICLLGLFIMAKAWGPLVLEVVIMVVTVL
                     AHVYFKMKFIPLFDTVPLSAIRFARGEEGYGYPSDLGLKEIKIVAEDAKSSFESDETS
                     GVLRPATSVELKRAHLLNTAEGNSNEGNEIPEESISEKPANAFDEHRRNSSESSSSAG
                     IGNSSTAAVAPAKNKSTFAPDENFHKLSYKDLENRPREPREEYRNVHGALLDNTDVAK
                     VYADPQAIVTDERSFPPNINKTMALKQRFINFFSPSKNYPFETVRMRLPHVFNTTIEY
                     DEQFLEAAYSDPSVKEKDPIVWICRDHMGLSKQLIADARSKDVVVNDEFTKYDEKGKA
                     MYLFNPPDFEYKAKR"
     gene            <382619..>384061
                     /locus_tag="HG536_0G02220"
                     /db_xref="GeneID:59327604"
     mRNA            <382619..>384061
                     /locus_tag="HG536_0G02220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285141.1"
                     /db_xref="GeneID:59327604"
     CDS             382619..384061
                     /locus_tag="HG536_0G02220"
                     /inference="similar to AA sequence:RefSeq:NP_014559.1"
                     /note="ancestral locus Anc_3.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141037.1"
                     /db_xref="GeneID:59327604"
                     /translation="MSLGNAGIVYGTRGEVFEGQRDGSLKDFIASTFNIHNVFQTKLV
                     MGRCICHGKKALETDKLLDNEEEANKFISSRDSKKPHVILIYDKHGDSSSVKESNPEK
                     NDKGNVVISPEQWDDLVSLLKKVEITLKEKEKDQHHGGDVVHPHVICDGCYPTEQTDA
                     SEIRGPRFKCLTCHNFDLCSSCESKGYETFGHKRSHNMVKVNKPTENDVLSAPVGATL
                     QSANKVFNTDKEVVVDIPADRKDLFDMFSNLENLDGVVHGYTMYKKWTEKYDDDKIDE
                     ILKSASAKPAVKASRSNKKRATQAKPSIKQGGVVVEVAKKDNAMIFHLRNRDKVAVPG
                     GLTFVGSAIENGGHDDGCWELPMGPHELQPGSHKVLKYNCHPGVFNFPTSAKSRITLV
                     DEQKDVKYEGFTNFEPGSHFILHHSGAKPQQDLVLINDVDTLQLLDKDDSDSVISSST
                     VTNDNDTSQSVSNHESFDWEDYDFLSESDV"
     gene            <384415..>385728
                     /locus_tag="HG536_0G02230"
                     /db_xref="GeneID:59327605"
     mRNA            <384415..>385728
                     /locus_tag="HG536_0G02230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285142.1"
                     /db_xref="GeneID:59327605"
     CDS             384415..385728
                     /locus_tag="HG536_0G02230"
                     /inference="similar to AA sequence:RefSeq:NP_009701.3"
                     /note="ancestral locus Anc_3.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141038.1"
                     /db_xref="GeneID:59327605"
                     /translation="METDAEKNIEIWKVKKLIKSLEQARGNGTSMISLVIPPKGQIAL
                     YQKMLTDEYGTASNIKSRVNRLSVLSAITSTQQKLKLYNKVPPNGLVLYCGDIITEEG
                     KEKKVTFDIEPYKPINTSLYLCDNKFHTEVLSELLEADDKFGFIVMDGQGTLFGLLSG
                     NTRTVLHKFTVDLPKKHGRGGQSAVRFARLREEKRHNYVRKVAEVAVQNFITNDKVNV
                     KGLILAGSADFKTDLAKSEMFDQRLASKVIKIVDISYGGENGFNQAIELSAETLANVK
                     FVQEKKLLTDYFDEISQDTGKFCYGIDDTLKALDLGAVETLIVFENLETLRCVYKDSE
                     NKEVIKFTKPEQEDKSYAIDKATGQEMDLVEEQPLIEWLAENYKNYGATLEFITDKSS
                     EGAQFVTGFGGLGAILRYKVNFEQLVDESEDEYYDENEGSDYDFI"
     gene            complement(<385841..>388111)
                     /locus_tag="HG536_0G02240"
                     /db_xref="GeneID:59327606"
     mRNA            complement(<385841..>388111)
                     /locus_tag="HG536_0G02240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285143.1"
                     /db_xref="GeneID:59327606"
     CDS             complement(385841..388111)
                     /locus_tag="HG536_0G02240"
                     /inference="similar to AA sequence:RefSeq:NP_009700.1"
                     /note="ancestral locus Anc_3.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141039.1"
                     /db_xref="GeneID:59327606"
                     /translation="MASADRLRKNNKSSTRKAKRAPLRRAPSKNSRKEGIVVGASDLK
                     WKAVQVPDTLGDFGGFYGLEEIDGVDVKVVDGKVQFIARDESKVRQSNGGNSSDQESS
                     EEKQSDELIEFKNLDDVDEGELEASSFSETSDISADETNENEEQEADDNASAHDDNDE
                     LQPNVFQTDIDLDDIEVSELPEWGKLGPLSLTTLQGLAKLGFSKPTEIQSRAIPVAMQ
                     GKDVMGKAATGSGKTLAYGIPVLERLVKSKNNTSPVALIFTPTRELAQQVNKHLQALG
                     KAVLKNSPYAIIPLTGGLSIHKQERLLDYQGSGRIVVATPGRFLELIERNTKLLDRFA
                     RIETLILDEADRLLQDGHFEEFEKILKHLGNSRRKNVRDQGWQTMVYSATFAMDLFSK
                     LSSTSWSKMKRDKHSDEMEAVLQQLMKKIHFKSKPIIIDTNSEQRISSQIKESLIECG
                     PLERDLYCYYFVTMYPGTTLVFCNSIDSVKKLNAYLNHLKVPTFQIHSSMTQKNRLRN
                     LERYQQQSEKNRTLNKSTVLIASDVAARGLDIPNIEHVIHYHLPRSADVYIHRSGRTA
                     RAEKEGVSVMLCSPEEAQGPLRKLRKLLALKSGSDETANKKKKWQKTVPLLPIETDIV
                     TQLRERSKIASKLADNEIASTSLKKDDNWLKKAAEDLEINISSDEEDKDVILAKNKTK
                     KINKTISKDRVRGLKAELDELLGRPLRKDLRKKYLTGGLVNLADNLVKKRGHDFIIGH
                     EKVDALEQLKKKRSKH"
     gene            <388283..>389224
                     /locus_tag="HG536_0G02250"
                     /db_xref="GeneID:59327607"
     mRNA            <388283..>389224
                     /locus_tag="HG536_0G02250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285144.1"
                     /db_xref="GeneID:59327607"
     CDS             388283..389224
                     /locus_tag="HG536_0G02250"
                     /inference="similar to AA sequence:RefSeq:NP_009699.2"
                     /note="ancestral locus Anc_3.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141040.1"
                     /db_xref="GeneID:59327607"
                     /translation="MLSRRKRSITGNKISKFAEVNIKPSKARRIIRRYHFLNNKKRII
                     CNRLGIDTDHPDDEPQQKRTGTFDSTDMEKLLLKVQDKNLSREQLHRCLQYIEAEITN
                     QGGLEEYQRASRIGQSNARGGDSSKLLVSWLRELKYNRGKPMTALEIGSLDSENCIST
                     CGIFNPVTRIDLNESNNSRGILRQDFMERPIPSNDDSRFHLVSCSLVLNFVPTPVLRG
                     QMLKRFHQFLKGPKLLFLVLPLPCINNSRYMDQTYLVKMMAHLGYHLLKHHESKKLYY
                     SLFTLQRQPSPDDKDITFATKKILHDGPKMNNFCIVL"
     misc_feature    389955..395126
                     /note="contains an internal stop codon and 4-bp deletion
                     near amino acid 1725, relative to T. globosa strain
                     CBS2947; CBS764 sequence confirmed by independent Illumina
                     and PacBio assemblies"
     gene            complement(<398966..>399808)
                     /locus_tag="HG536_0G02280"
                     /db_xref="GeneID:59327608"
     mRNA            complement(<398966..>399808)
                     /locus_tag="HG536_0G02280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285145.1"
                     /db_xref="GeneID:59327608"
     CDS             complement(398966..399808)
                     /locus_tag="HG536_0G02280"
                     /inference="similar to AA sequence:RefSeq:NP_014561.1"
                     /note="ancestral locus Anc_3.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141041.1"
                     /db_xref="GeneID:59327608"
                     /translation="MALSSNWLKLQESEKVSAKDRHSSRKSKKNAAAKPIGTNRKQKQ
                     SRIMSMVYSMSREIEKSEQNKREGREFEFKETKTGVGKPDAEGIEHLFGKISGEKATA
                     IGKYLAMDCEFVGVGPEGKESALARVSLVNYYGHVILDEFVKPREKVTDWRTWVSGVR
                     PEHMKDAVPFREIQKKVAGLLQDRILVGHSIKHDLESLLISHPKSSIRDTSRHLPFRQ
                     AYAKGKTPSLKKLAKEILKREVQVGEHSPIEDARITMLIYRSDRKEFERLNRARHKSH
                     TGNS"
     gene            <400021..>403338
                     /locus_tag="HG536_0G02290"
                     /db_xref="GeneID:59327609"
     mRNA            <400021..>403338
                     /locus_tag="HG536_0G02290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285146.1"
                     /db_xref="GeneID:59327609"
     CDS             400021..403338
                     /locus_tag="HG536_0G02290"
                     /inference="similar to AA sequence:RefSeq:NP_014563.1"
                     /note="ancestral locus Anc_3.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141042.1"
                     /db_xref="GeneID:59327609"
                     /translation="MDTVACLNRLRAQFLWDCPENEQMRRIIKPYMAGQEGSIDEVAT
                     LYIAPDGHDMLPEMESPPLSLTNMDGYLSKNRPLLANARHYSKSKELTKNARGEVSVA
                     RNKSNKDQKDVERERQSISAQNQARHSAFDTVTERRLPVSIKSDTTYRKHDSDSQTDS
                     DEPEADDFKKKASRRLSISRIFKGRHESNGRKDNKKRRELQKKRRDINFDINFDYDED
                     LEEDDDEEEDEEGENLQSRFFQLDLESSKSSHANGDEDKDPGLNRPNSSTTGFSSRAN
                     NVAPGTSATLSANNRKSHFPQNIMPRASLVDGGRNGSLRSDRLQRVNGHENAIIGDQK
                     DNRTAVEGEEYGSDLESYINEQDLDNLDLDGEALTDDNDNFSKVNLRLSSTNKNVENQ
                     EEGSVPNGDHRSSSGSSYGRSLLDSDFSGSNFMKKESSAIDSTSFLDDSDMQPATMSH
                     SIPMTLEDYGIYHGQDDSTLNNVFDEAVMNMKKSSRTQLRERRSSNCLISHSLGSTRH
                     SSSSNTGIKGKGHTRSLSTASNDSSKVRSELEKKCALGPGGRQGKLNLPPSIYRNGST
                     PRGSSLVIQKITDFPKPDTSDSLLSSLFSRRKQAKASAADILEYFSFVSGNKVPRGEA
                     STISVYIQSSAKYKRHPFEANIRNSATIFETIGYILYLFSTKFKPDKSEGDGLNEDEI
                     KDPNKFCLKIVDEDGEPFEDDFGKIDRLKTIQSLSDNEVVLCKVSATEEKLNEKETPL
                     PYDLHGEIIDNAQIHSGGNLRLNQFSYYKPILSDETNKKNENSKIISVKVYLFPCGNK
                     EFNYTIVEVSVTSSLNDILVRYCKMKKMDPNEYLLKVPDKKVALNLNDTVLRLDGHHE
                     VEVVSKREARELHLEKCRPDLAKPNLPTIQSTDLTPMTLDPSAYLKPESPTVTKVASL
                     ENKPSTKYRKAGSKHKLVLSTQISGSSNTSGSTVNAFFKAKNSSKASLHGSYYAPDHS
                     TPVSGTMNTGGSNSNYPELLSGAYHKYKVWRRQQMSLMNKHERALALDGDYIYIVPPE
                     KHLHWHENVKTKSIHISQVISVAKSKRVPEYFKLFIRRGQHDLKRYYFEAVSSQECME
                     IVSRIQNSLNAYKMNHK"
     gene            <403622..>403831
                     /locus_tag="HG536_0G02300"
                     /db_xref="GeneID:59327610"
     mRNA            <403622..>403831
                     /locus_tag="HG536_0G02300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285147.1"
                     /db_xref="GeneID:59327610"
     CDS             403622..403831
                     /locus_tag="HG536_0G02300"
                     /inference="similar to AA sequence:RefSeq:NP_014564.1"
                     /note="ancestral locus Anc_3.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141043.1"
                     /db_xref="GeneID:59327610"
                     /translation="MGAGYQILGRHVPSHHLALGTLGLVALIVVPNPFAAKKPKSVNF
                     GAGSKEEEQFIENYLAKHTEAAEKH"
     gene            complement(<403961..>404851)
                     /locus_tag="HG536_0G02310"
                     /db_xref="GeneID:59327611"
     mRNA            complement(<403961..>404851)
                     /locus_tag="HG536_0G02310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285148.1"
                     /db_xref="GeneID:59327611"
     CDS             complement(403961..404851)
                     /locus_tag="HG536_0G02310"
                     /inference="similar to AA sequence:RefSeq:NP_014565.2"
                     /note="ancestral locus Anc_3.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141044.1"
                     /db_xref="GeneID:59327611"
                     /translation="MSSIYKALAGKDKRSQSDKKIVRNEKQFMNKQRTLLISSRGVNF
                     RHRHLIQDLYSLLPHSRKEPKLDTKKDLQQLNEIAELYNCNNILFFEARKHQDLYLWL
                     SKPPNGPTIKFYLQNLHTMDELNFTGNCLKGSRPVLSFDHRFDTSPHYQLVKELLIHN
                     FGVPPMARKSKPFIDHVMSFSIVDDKIWVRTYEISHSARNEDEYELKADQQEDISLVE
                     IGPRFVMTVILILEGSFGGPKIYENKQYVSPNVVRAQMKQQAANAAKERAEAAVQRKI
                     KLRDNVLAADPLSNEALFKD"
     gene            <405146..>407521
                     /locus_tag="HG536_0G02320"
                     /db_xref="GeneID:59327612"
     mRNA            <405146..>407521
                     /locus_tag="HG536_0G02320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285149.1"
                     /db_xref="GeneID:59327612"
     CDS             405146..407521
                     /locus_tag="HG536_0G02320"
                     /inference="similar to AA sequence:RefSeq:NP_014566.1"
                     /note="ancestral locus Anc_3.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141045.1"
                     /db_xref="GeneID:59327612"
                     /translation="MTSRVDDEISNLMKRGSYKLCLQKVVQSRKQLPNSSYLKVLEIY
                     IKFRMSPRKFNYEDSLGRLYGTNGTEITSDTRALNLLHTFFVELGRYEEALQVYERAN
                     FKYQGFEIALTWFEKTLRDSNYKQMVKSCQQLAKLGGDLGEGLSHRDYIFWYALSIVV
                     LFRFQSHKVADQEKRLLPQLAYRSLCNVKPFQSAQEVYVFCTVCEELFPDDEQKAQEI
                     IQEVIPRLERSVDLYMKNFFLRNLKKDEYSTAFDLCGKLLERLNDFELITRYIHAAKN
                     LSKSKEETLQNIALYVGDSRNSRLAHLEADRVYDNRISKAALGHYVQKFHNKSCCTTD
                     LNGYRDFIDESSIRETFNECDGIDLLHEVNLFKLGLSEFTPVQAYVKYESTLVSKPIT
                     DYSACSTYILRIMQDLILTEDEPPLENVLLALTLLENYQIKDPHNYETSVWIVALYMY
                     LGCVPLAFPQYLMLKTKNVQVDIADFIVYSRFATMFPLKTHDYIKRAYENLEKFYQSS
                     AGRLSQLAQIAFERKSYSKIIGILEFNDRIDRSSMKWLMASESVKMARLCNDKRGELL
                     QSMHEQWRLMEMIGNISFSDNRDYRIFGPDIQQDKLPHVLRYLSVSDEIIMLDCIKEF
                     MIELIPSRERDAKLESYLEKMRASGESPIHAADSVDAWSFEVFHDLYANDGANLLELV
                     KNLSLHPQSTSTWRLSHEYLTKMHTLKTLDSFKRIKDSALKDSIKTNIKLLRDSCDSL
                     FSQYISHVTEMCGKLETGPSGQLLQSLGYAPLDAENITKGLLTVQKATRNL"
     gene            <407806..>409188
                     /locus_tag="HG536_0G02330"
                     /db_xref="GeneID:59327613"
     mRNA            <407806..>409188
                     /locus_tag="HG536_0G02330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285150.1"
                     /db_xref="GeneID:59327613"
     CDS             407806..409188
                     /locus_tag="HG536_0G02330"
                     /inference="similar to AA sequence:RefSeq:NP_009696.2"
                     /note="ancestral locus Anc_3.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141046.1"
                     /db_xref="GeneID:59327613"
                     /translation="MDNASHSRILEPIDPNSVSLISSSSGSNLYSGIQDETSHSPFRT
                     PGSPSVVDSEGALTAKWQFDRKEFEFKSNSTPSRSIDPQHQKILHVRKRRSQLMGAKP
                     RVPSKLHHSTSKLDLLDKEKLTSFPIPPPRGSQPSQNVKRLKLNPINEIRIHNTKEDR
                     RISYGFPGKRGPLQEEEGDEDDSNEHPIVLVEDYIPIEEWSRGNAAGKRLSLSNLRSK
                     MSKRSDMHLPVRLINTSRKECSKTPSSSVTLIPHILDDNFMHEDSVCSLQENGAQTLS
                     LRDDEAVSSSFQHMIRSLIKNEEKEDSDEYLSGLRLNSSLKKCVVCEKPLYEISSILG
                     EASHFKEIVCDKCTERYEEAAKIFEDYEFETSLDSSHDSSLNSLEGAVQLSHTENPEQ
                     QVTSFTAQQRTRFSNELIRRLQLQSSGVSTPQRKDNLDNGLLLWFMEAKKRITELLTK
                     NRNAASGVSK"
     gene            complement(<409285..>409827)
                     /locus_tag="HG536_0G02340"
                     /db_xref="GeneID:59327614"
     mRNA            complement(<409285..>409827)
                     /locus_tag="HG536_0G02340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285151.1"
                     /db_xref="GeneID:59327614"
     CDS             complement(409285..409827)
                     /locus_tag="HG536_0G02340"
                     /inference="similar to AA sequence:RefSeq:NP_009695.2"
                     /note="ancestral locus Anc_3.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141047.1"
                     /db_xref="GeneID:59327614"
                     /translation="MGAIELDQKLLQKLVSRKASLEELEKLESNCVLDTFHYEDAFEL
                     GSLVRRTARELFPERCVAIDVSASNGHSLFRAVTFRGSSLDNDNWIERKRKTALRFSR
                     STFYMGNKKGNLSPEDKFFVDSKEYAFHGGAVPIFLNQCDYPVGCLTVSGLKQEEDHL
                     LAVTCLTKYAQRTAPALDLD"
     gene            <410298..>410867
                     /locus_tag="HG536_0G02350"
                     /db_xref="GeneID:59327615"
     mRNA            <410298..>410867
                     /locus_tag="HG536_0G02350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285152.1"
                     /db_xref="GeneID:59327615"
     CDS             410298..410867
                     /locus_tag="HG536_0G02350"
                     /inference="similar to AA sequence:RefSeq:NP_011592.3"
                     /note="ancestral locus Anc_3.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141048.1"
                     /db_xref="GeneID:59327615"
                     /translation="MDTLFNSTKTNPRGIPEAPFVEKVEAYIKDPNDFDMCFSKFQER
                     LSKYKFMQESKLSNIRQLNTRIPDIENTLKICRTLKSQNKPVGTSYQLNDTLFTKALV
                     ETGEDMKVGLWLGADVMLEYPVDEAIDLLTEKLEKAKKDLEISTEDMEFLRENITTME
                     VNCARLYNWDVERRQAMKQTEEATQNLTI"
     gene            complement(<410889..>411746)
                     /locus_tag="HG536_0G02360"
                     /db_xref="GeneID:59327616"
     mRNA            complement(<410889..>411746)
                     /locus_tag="HG536_0G02360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285153.1"
                     /db_xref="GeneID:59327616"
     CDS             complement(410889..411746)
                     /locus_tag="HG536_0G02360"
                     /inference="similar to AA sequence:RefSeq:NP_014568.1"
                     /note="ancestral locus Anc_3.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141049.1"
                     /db_xref="GeneID:59327616"
                     /translation="MSMETPSGLFRFPITKLCMVSTGAVALSASVANYKYIFLARYEP
                     FISDYKQYYRYFIFQLGCANETDVALVILLWYQFRNLERIMGSYKYISVLSLALVYTT
                     LCLAGLNLLLNSLLPWKMLNSLCTGPLALILAMFHFYKEYTPQIYEFDILLTQPWTRR
                     SNKKQHKWQLNDQFLVNALVIILLLNQGFSGIGCGFIGWLCGIFLDRGLFPGVDRWRL
                     PFIERLLISTGFNDSNDAILDDADRYRDIDTDAAGGNGNEPLSLDDENANDEPARPLG
                     VQFLDTFRR"
     gene            <411910..>413643
                     /locus_tag="HG536_0G02370"
                     /db_xref="GeneID:59327617"
     mRNA            <411910..>413643
                     /locus_tag="HG536_0G02370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285154.1"
                     /db_xref="GeneID:59327617"
     CDS             411910..413643
                     /locus_tag="HG536_0G02370"
                     /inference="similar to AA sequence:RefSeq:NP_011591.1"
                     /note="ancestral locus Anc_3.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141050.1"
                     /db_xref="GeneID:59327617"
                     /translation="MSMPIDTDDQAINHLLTVLAQDKSVSSPAVLNNLVYYTPRTKSV
                     PQLIRLVNAIFKGTSRPEFNVLELFEMSQAIAQWKLEISEPAIPPAEFYKIWDSCFRE
                     CYSWTRSKLSILAGILSTRENFRSLETGNFIDDSRQIIKLYDSWKRDIFIPTWCEFVK
                     RSNRDIASLILIYAAISSPSDACRYGFLPWNVVTIHLSRLFLRHMTAPGQAEPFFEKN
                     LSRMAKTLQTSLTKSDKSVVSDFLSLLCRGSYDLAFFELRNQTQTKDYSKQYYSHVLF
                     TAVVSLNSILQTTAKAPTSWYAQVVMILFNLNFIAEDIGIVGFDSYQSVYEIVCKGIT
                     LADDQAVYYDTVKVMNGNIWGGTWSGNKVNRAKLLFMLRFMGSTLSELSSIPIPFIND
                     FIQPLQKVYMDSTEEDIRESAHIMTLSIFSSHNNDADFLRWECQNYLPYLDLSTNQFL
                     RQKISDKQLILIYQKMSSQLPILQHVDGHLSREALHYTYLTILNCPPQQLKEQAVLLK
                     CLIFQILYSNEHHLVDWLDTTQELLSSIKFTNEQRHDIITTLWDVVSHSKSDVAFKWW
                     YGRLDAIRSRL"
     gene            <413797..>414261
                     /locus_tag="HG536_0G02380"
                     /db_xref="GeneID:59327618"
     mRNA            <413797..>414261
                     /locus_tag="HG536_0G02380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285155.1"
                     /db_xref="GeneID:59327618"
     CDS             413797..414261
                     /locus_tag="HG536_0G02380"
                     /inference="similar to AA sequence:RefSeq:NP_011590.1"
                     /note="ancestral locus Anc_3.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141051.1"
                     /db_xref="GeneID:59327618"
                     /translation="MSTSQFFDLLPAQLKRFFNRYPPSIKFASKPISTHSIEANPFLP
                     NKHPVTGRYHEPKYSLRRSSVLYKMAYTYGVQDMLPPMKKKFFEDKYHNKKMMKGVLL
                     PKGHKHELQREAKLAKMQEAIKNADKFIIEAKGAKYKRKLEAKKNSNARTWF"
     gene            <414413..>415084
                     /locus_tag="HG536_0G02390"
                     /db_xref="GeneID:59327619"
     mRNA            <414413..>415084
                     /locus_tag="HG536_0G02390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285156.1"
                     /db_xref="GeneID:59327619"
     CDS             414413..415084
                     /locus_tag="HG536_0G02390"
                     /inference="similar to AA sequence:RefSeq:NP_011589.3"
                     /note="ancestral locus Anc_3.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141052.1"
                     /db_xref="GeneID:59327619"
                     /translation="MSFEFHVESYLSSKQLNNQSVSLVIPRLARDRIHNVMYYKVNLH
                     PVAMRGDTLKQLINIIVRDFGTLKDQSVNATHVLGGFEFKCILMKLVELRPTWDQLQV
                     LLQEGESGFSNKYIVALVLTYLRIQYYYLQDESDLAKSIVGIFKMYICDYRKMKSVAL
                     DMDCWSPSQSVSVCIVHTDELVDWLVTRDEVWGFPLGKCQWCQGLDRDSSSSGESSSE
                     SDEED"
     gene            complement(<415081..>415533)
                     /locus_tag="HG536_0G02400"
                     /db_xref="GeneID:59327620"
     mRNA            complement(<415081..>415533)
                     /locus_tag="HG536_0G02400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285157.1"
                     /db_xref="GeneID:59327620"
     CDS             complement(415081..415533)
                     /locus_tag="HG536_0G02400"
                     /inference="similar to AA sequence:RefSeq:NP_011588.3"
                     /note="ancestral locus Anc_3.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141053.1"
                     /db_xref="GeneID:59327620"
                     /translation="MKLVYFLKKLRNEQVTVELKNGTTVWGTLQNVSPQMNATLTNVK
                     LSLARSASSTAGSSALAGMYLSDSQLSLGSSSDGSVRPTASLQYINIRGNTIRQIILP
                     DSLNLDALLVDEEQWRRLKRTDRITSESSKKRRADFVSNPVKRIRRGV"
     gene            <415987..>416628
                     /locus_tag="HG536_0G02410"
                     /db_xref="GeneID:59327621"
     mRNA            <415987..>416628
                     /locus_tag="HG536_0G02410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285158.1"
                     /db_xref="GeneID:59327621"
     CDS             415987..416628
                     /locus_tag="HG536_0G02410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141054.1"
                     /db_xref="GeneID:59327621"
                     /translation="MSKEPGSGSIISIYNGLLAKHPLLVKSITGALLSSLGELISQWT
                     TILYGSYKSESTEKYRSPKAICGQLIREPKILKVLVMFCYGGLINAPINHFMYRRITA
                     ITGKYCKSAKARSFVQLLAALSIVSPLQVLFLVAILTINTHFDGDVNRLWTHIKRSVK
                     SKYVKILTSSCVSTTVLVSFAQKYIEPEKWSVFFSFAYAILGTSQNIYLKLKK"
     gene            complement(<416631..>417752)
                     /locus_tag="HG536_0G02420"
                     /db_xref="GeneID:59327622"
     mRNA            complement(<416631..>417752)
                     /locus_tag="HG536_0G02420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285159.1"
                     /db_xref="GeneID:59327622"
     CDS             complement(416631..417752)
                     /locus_tag="HG536_0G02420"
                     /inference="similar to AA sequence:RefSeq:NP_011586.1"
                     /note="ancestral locus Anc_3.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141055.1"
                     /db_xref="GeneID:59327622"
                     /translation="MDGMQPSIPRDPFRNKEAGSLKPNQVNEDENCSRTTSTSSRKPG
                     TSKSKVGRARRRDRHGRKSDDSGFKLVLRLLPPDLSEDEFLKTLKTEIGDMINLGIDG
                     WYYVQGHYSVKFRSEPVYSRCYLYFNDMEQLGKFASRVQPIRFVDDKDNAANAVAKVS
                     PYNKRLVTDPPKNAQSKQSLEGTIKEDPLFQTFLKSLKILEERTSDYSYADVSIMKPL
                     EKELAKRRSIESEIEKRTEMALIALTGDIEKKSKSKGKKKNKKKDKVSKEAGEVATEP
                     TSSVDRKRKKAKKKTTKPDVKTNNVEKNNNVVILEAAGRKELQRRKKLQMEKEKMAGR
                     ADPAVTKKKSRSKGKPSDSSGDIQNLSNLKLKRETAEHS"
     gene            <417898..>419325
                     /locus_tag="HG536_0G02430"
                     /db_xref="GeneID:59327623"
     mRNA            <417898..>419325
                     /locus_tag="HG536_0G02430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285160.1"
                     /db_xref="GeneID:59327623"
     CDS             417898..419325
                     /locus_tag="HG536_0G02430"
                     /inference="similar to AA sequence:RefSeq:NP_014569.1"
                     /note="ancestral locus Anc_3.141"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141056.1"
                     /db_xref="GeneID:59327623"
                     /translation="MMDYSLAQFYQDVSNGAFQVMVVDLDLNGQRIAALQRELQGRPN
                     DGHLMDDKALEEAVESQDFRFNGRGWTRFNIMITSFLQFCRDVDPWSLWRSCDLIFKF
                     YQDLGNCLLNDSYPIDPLVPLFTELTNYVVNLATILDANSVKLNTRPHQFLSHTSAVI
                     SKVFNSVKPPRTSEDDVSNGNAVGLPEKQRILLYLVNKLNNLYFRIKSPQLCSNIFKN
                     FKPKAMTSSFAQYPIREQIEYRYLLGRYYLLNHRVTNAFVQLNTAFSQLMLIAMTAGP
                     DSQPQIRRNLSRILRYLVPAGLMLGKSPRIAYLSEIDPSLSEKYASLLHHMRNGNIRA
                     LNAWLAHHENSLRRDHLLLILLEKLPMICYRNLIRTVVQTCTIPQNTGKIPYAQIEAA
                     FKLSIGELTPEKIDIHTAIHRPDNVENVLVTLINLGLLRGNCFPMLRLCVVKKTQAIR
                     EILPSIQERILATFPLNSEDSWLDD"
     gene            <419673..>420608
                     /locus_tag="HG536_0G02440"
                     /db_xref="GeneID:59327624"
     mRNA            <419673..>420608
                     /locus_tag="HG536_0G02440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285161.1"
                     /db_xref="GeneID:59327624"
     CDS             419673..420608
                     /locus_tag="HG536_0G02440"
                     /inference="similar to AA sequence:RefSeq:NP_010236.1"
                     /note="ancestral locus Anc_3.142"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141057.1"
                     /db_xref="GeneID:59327624"
                     /translation="MVEKGPDEWLERIKKCQSLTENEMKQLCEMVKELLMEESNIQPV
                     QTPVTVCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLMCLKV
                     KYSSRITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKI
                     LCVHGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDPDNVEAWQVSPRGAGWLFG
                     SKVAREFNHVNGLNLIARAHQLVMEGFKYHFPEKDVVTVWSAPNYCYRCGNVASVMKV
                     EEDLEPTFKIFSAVPDDYIQEATASHNNQRGGYFL"
     gene            <421084..>421641
                     /locus_tag="HG536_0G02450"
                     /db_xref="GeneID:59327625"
     mRNA            <421084..>421641
                     /locus_tag="HG536_0G02450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285162.1"
                     /db_xref="GeneID:59327625"
     CDS             421084..421641
                     /locus_tag="HG536_0G02450"
                     /inference="similar to AA sequence:RefSeq:NP_010237.1"
                     /note="ancestral locus Anc_3.143"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141058.1"
                     /db_xref="GeneID:59327625"
                     /translation="MHFASVFIRVLSLLTVGALAGLVNFLPVLPFDNKPVPGGSPFYQ
                     CDVSEKQYLEISTVDLAPNPPVRGKNLTISAVGKLHETIQQGAYVDVEVRLGYIKLLT
                     QTYDLCETLEENNVDGLTCPLTAGLYNVVKEVEIPAEVPPGKYVVLARAYNVDDELIT
                     CLTGEIVFPAVDRGIRRKVLDKLHW"
     gene            <421812..>422303
                     /locus_tag="HG536_0G02460"
                     /db_xref="GeneID:59327626"
     mRNA            <421812..>422303
                     /locus_tag="HG536_0G02460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285163.1"
                     /db_xref="GeneID:59327626"
     CDS             421812..422303
                     /locus_tag="HG536_0G02460"
                     /inference="similar to AA sequence:RefSeq:NP_014570.1"
                     /note="ancestral locus Anc_3.144"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141059.1"
                     /db_xref="GeneID:59327626"
                     /translation="MIRIRRSLPPLAGSFGLLRPLNVRTVSPLQFYSSKSKPEEKDDV
                     FLRIKVQPIDREGESLDKKRARLIYQSRKRGILETDLLLSRFAAKYLKHMSEKELDEY
                     DELLDELDWDIYYWATKNFETSPLPKKWENSQLLKQLQEFSENKEREILRMPDLKNYW
                     LNE"
     gene            <422496..>422783
                     /locus_tag="HG536_0G02470"
                     /db_xref="GeneID:59327627"
     mRNA            <422496..>422783
                     /locus_tag="HG536_0G02470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285164.1"
                     /db_xref="GeneID:59327627"
     CDS             422496..422783
                     /locus_tag="HG536_0G02470"
                     /inference="similar to AA sequence:RefSeq:NP_010238.1"
                     /note="ancestral locus Anc_3.145"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141060.1"
                     /db_xref="GeneID:59327627"
                     /translation="MSGKPPVHRLPPLPRLKVKKPILTQEANKCLVLMSNLLQCWSSN
                     GHMNPACENLAKELKICSKERALGKGNTVEKSNINYHAARLYNRISGKPHD"
     gene            complement(<422844..>423764)
                     /locus_tag="HG536_0G02480"
                     /db_xref="GeneID:59327628"
     mRNA            complement(<422844..>423764)
                     /locus_tag="HG536_0G02480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285165.1"
                     /db_xref="GeneID:59327628"
     CDS             complement(422844..423764)
                     /locus_tag="HG536_0G02480"
                     /inference="similar to AA sequence:RefSeq:NP_010239.1"
                     /note="ancestral locus Anc_3.146"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141061.1"
                     /db_xref="GeneID:59327628"
                     /translation="MDLGQISEYCYNLTNSYLEITNQSQVIADTQDAIRLTKRYFLQD
                     IFPRWSPLSSEISFSYNGGKDCQVLLLLYLGCIWEFFLNSLQDTQYDRQYHKYPLRSL
                     PTVFIDQEETFATMEDFVASTSERYCLSLYESLRGDGRKLSMPEAFELYLKSHSETKA
                     IVIGIRYTDPYAADLKTIQPTDADWPDFLRLQPLLHWKLSNIWSFLLFSNEPICGIYG
                     MGFTSVGSIKNTLPNPHLNVDRTGKPSLLFQWEIAHAFGKAEGQHDQVNVSKVSRKDL
                     ALLKGSNGKYLPGWYLTDDSLERAGRIKSC"
     gene            complement(<424033..>425322)
                     /locus_tag="HG536_0G02490"
                     /db_xref="GeneID:59327629"
     mRNA            complement(<424033..>425322)
                     /locus_tag="HG536_0G02490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285166.1"
                     /db_xref="GeneID:59327629"
     CDS             complement(424033..425322)
                     /locus_tag="HG536_0G02490"
                     /inference="similar to AA sequence:RefSeq:NP_010240.1"
                     /note="ancestral locus Anc_3.147"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141062.1"
                     /db_xref="GeneID:59327629"
                     /translation="MLRSKAVGHLRVLGRQSYSLKLTDQKSHIPSRSSDLNTHFKDEE
                     ELSSVQERALFGAVFNKLMMREELRSKNSEEVLSQAAAIQPDVTTAHKEEGRGLQVVF
                     EKKSQEIRPEDRKLFDFFKNTSGSTQLGDIGESAKLTTDDIRNYPVSLISSMFSDAED
                     VKVPESEKASRELANAEKAPISEDEFGLKADFKLRMNKEVLETLKAKESFKAAMQTAM
                     EPYLTSIFSQIETDYDLFVLVRKLLKSYVDRDKTLDNNNYKSSSEIVQHIKEQCLKNS
                     KELPRPLGVSLPYTLVELFTSEELNFPSERKFSLISYIYQECKKDISLYLNVCNVDFY
                     NLLLRLSWDNYREIYQLKQLTTEMSINGIRGDLYTIEILDKIAHDLRHINDGILNEDT
                     GSMQGNPLTVGVVWCRENSTDLQLVENYLRKLKENLA"
     gene            complement(<425556..>427187)
                     /locus_tag="HG536_0G02500"
                     /db_xref="GeneID:59327630"
     mRNA            complement(<425556..>427187)
                     /locus_tag="HG536_0G02500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285167.1"
                     /db_xref="GeneID:59327630"
     CDS             complement(425556..427187)
                     /locus_tag="HG536_0G02500"
                     /inference="similar to AA sequence:RefSeq:NP_014571.1"
                     /note="ancestral locus Anc_3.148"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141063.1"
                     /db_xref="GeneID:59327630"
                     /translation="MSGEGSSKVMLNNKRLSAMIDSLQKEDIESELLRIGKPVSANKN
                     DQFELPHEEPSDSRNSSPSKLFRSPAGLISLHSADKRSSMLSDYSGVVQEGIGISFVV
                     QNQGKGTNESHPDLPALPSVETLGLNDNFSTEADSRMPTEDLVIKTVPNAKPVERLSS
                     NYSKMSRVSEMTERDPNQNLEPNNSLRLLSINKHHLAPSSVGSGNLASESGSSSYNHL
                     RNYEKQSPVLQPPVSQAEDSQETYSAKNLESSHISDDVSIVTSIIPPLSTTVREDQEG
                     IKPVRSETTSYNPTVPPRSKNRPRSRLFIRDTLDDIETQLMAQMRDPSPDLKSASAVT
                     RSSTNTYHSDAYFSATSHQNTGEDNSREHSEEPDEFNDDDIYLERPLPKVPSPVRRDS
                     TIRAQEKQRGDTQPSPDKPTCDDDDDMYEDIDVTVNLDLDETEDKRPTTNKTQDGTKS
                     KVKPSPKKKHGKRKKQELRSFDVDTLTQLLNVTKGTLIGSEFANLGMKIEEKRALERL
                     VDSLSRLTADMVLDPDRYEEGLRRLDKATKALEGF"
     gene            complement(<427421..>429136)
                     /locus_tag="HG536_0G02510"
                     /db_xref="GeneID:59327631"
     mRNA            complement(<427421..>429136)
                     /locus_tag="HG536_0G02510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285168.1"
                     /db_xref="GeneID:59327631"
     CDS             complement(427421..429136)
                     /locus_tag="HG536_0G02510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141064.1"
                     /db_xref="GeneID:59327631"
                     /translation="MIRKVAVIGGGPAGLTTVYNFLKVNKDSDLAVQCVGFEAKSKLG
                     GVWSDTPGSNLDTHPMIFEKLGSLRDERTAADSRALFYEGTPLAGIDGGEVNLSGLSG
                     SSSSKPVKLARKSGLTRDGIYFSDKTGLYDDFMSNVPEDLMRYEDDINDYGQNACARN
                     DRIAPLTDLPSIKYHLDNFISKNDLEENYRMNTSVEYVDKTGASKWMVVAKRSVPEND
                     YDEWYIEYFDAVVVASGHFQIPYIPFFMSKPEGRGAAETAIHRFNQKYPGTLVHVKDI
                     DIWYHKVLPSFEKTSRYRRIIIVGKSFSCMDVLKRIIHLKKSMSLEIFISTDVPPMPE
                     NTANPFYWFDEWLAETQQVVVKPQITEFVSQTTPTLRFADGSELGGVDCVIFATGYLY
                     GFPFLSSRLLDECRISITPDPRNTDNQPSNISRVSGLYLHTFSIADPTLTFPGVSSNA
                     NFQSFHISAKAIVGAYHRFNTLSQQQNPTDAPYYDSIWRQILPSLDDQLVWSKKRLAK
                     TGNTGAYHFYYPLPLLIEGWEKPCEAVFPFGQDAKNLFPPNAPQLSTDGIAKLRDIFL
                     EVMEQ"
     gene            <429750..>431114
                     /locus_tag="HG536_0G02520"
                     /db_xref="GeneID:59327632"
     mRNA            <429750..>431114
                     /locus_tag="HG536_0G02520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285169.1"
                     /db_xref="GeneID:59327632"
     CDS             429750..431114
                     /locus_tag="HG536_0G02520"
                     /inference="similar to AA sequence:RefSeq:NP_014572.1"
                     /note="ancestral locus Anc_3.149"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141065.1"
                     /db_xref="GeneID:59327632"
                     /translation="MSMDIFPLLDTLELATCLQSCDFSLATEDNIARPTSQFVITLYK
                     QIIDSFMGISPDYLPGNGKRKIEESEPGYGEETGFSESMQVLVLNKICYRFFQNIGVA
                     DFNLTDLYRPDAHRTKRILSAVVNYARFREERMFDCNKFISETETLLGQLRSRFDDYN
                     LLQQQIKRYEDEERKIEGLASQGNGDELQALEENNRSIEMQLKKLTQLQESLSIDYNN
                     YKEEKQKLLKELEALGFQIVELDSEREKLKRYSESNMDELENSIAELQRSLDSKREKL
                     ATLEDRQRNFHTSTQTFNRVIEEVYDVLQVLSTKIRDSHREEENLIDFKQQLLMRRDK
                     LRNVLNSGVMVKLAILDEQIESQKTKLASFYQSSKASHEDNADQISKLQEKYTKEIVP
                     KIQETEIHIEQNLLVGQVKKLEEDMHKLKIDFQREVDQIDTEHSLLANHMNNYMTIML
                     ERMD"
     gene            complement(<431125..>431904)
                     /locus_tag="HG536_0G02530"
                     /db_xref="GeneID:59327633"
     mRNA            complement(<431125..>431904)
                     /locus_tag="HG536_0G02530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285170.1"
                     /db_xref="GeneID:59327633"
     CDS             complement(431125..431904)
                     /locus_tag="HG536_0G02530"
                     /inference="similar to AA sequence:RefSeq:NP_010241.1"
                     /note="ancestral locus Anc_3.150"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141066.1"
                     /db_xref="GeneID:59327633"
                     /translation="MDYQNRAGSKKGAAGIASDAQANLARRKQVEELLKDGEQIPYTF
                     QDEDGQSEKLRKNPYIYKNHSGKLICKLCNTMHVSWSSVERHLSGKKHGLNVLRRGNT
                     TGKAENHERSELQDDRDREFQREVMLRRENLKNTGLIPKCTVVNVQGKSTNSHGVAIR
                     VDYNVDESPSLDFSASEERLSPMVRIVSGLELQEIEKKDKKYVVIAYEPFENVAVEIP
                     SDMSIMMNESEVNSVAIDDVNSKCTFWDEAHRKLYVQFFLE"
     gene            complement(<432116..>433774)
                     /locus_tag="HG536_0G02540"
                     /db_xref="GeneID:59327634"
     mRNA            complement(<432116..>433774)
                     /locus_tag="HG536_0G02540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285171.1"
                     /db_xref="GeneID:59327634"
     CDS             complement(432116..433774)
                     /locus_tag="HG536_0G02540"
                     /inference="similar to AA sequence:RefSeq:NP_010242.1"
                     /note="ancestral locus Anc_3.151"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141067.1"
                     /db_xref="GeneID:59327634"
                     /translation="MSVPEIVGDQTNKRHLEQENGDAAESINLGKSRQQKPEGSSESA
                     AEVIEEPNKRPKIAESAADIALEVPLKGDELQEVVDEYDVSQERDGHDVGRTTNDGQT
                     DEGEHVLAPRTPSKPIEISRSKRTGKYIFPPITKDDSINARMFLKYHGLRQFLDTYLP
                     EELNSLYLYFLIKLLGFEIKDREMMSAIHNFVEPRVVGEEEVSVTTFEDPLEKRRAVR
                     LIKDLQKAINKVLSTRLRLPNFSTVDVFVEGLKNAKKILVLTGAGVSTSLGIPDFRSS
                     EGFYSKIRHLGLDDPQDVFNFDIFMQDPSVFYNIAHMVLPPENIYSPLHSFIKMLQDK
                     GKLLRIYTQNIDNLESYAGINEEKLVQCHGSFATASCITCHWKLPGEKIFSNIRNLEL
                     PLCPYCYPKRREFFPNDSLSEDESTNGHLVNGAMKSYGVLKPDITFFGEALPSKFHRT
                     IREDILKCDLLLCIGTSLKVAPVSEIVNMLPAHVPQVLINKDPVRHAEFDLNLLGFCD
                     DVAAYVAQKCGWDIPHEKWDQLKKTTFNANETERGVYNISAKSS"
     gene            complement(<433992..>434600)
                     /locus_tag="HG536_0G02550"
                     /db_xref="GeneID:59327635"
     mRNA            complement(<433992..>434600)
                     /locus_tag="HG536_0G02550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285172.1"
                     /db_xref="GeneID:59327635"
     CDS             complement(433992..434600)
                     /locus_tag="HG536_0G02550"
                     /inference="similar to AA sequence:RefSeq:NP_014574.1"
                     /note="ancestral locus Anc_3.152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141068.1"
                     /db_xref="GeneID:59327635"
                     /translation="MTSVPGSVSSSVTSTASNQLGKVDRKRRDNINERIQQLLTMIPS
                     EFFQEYYKSTNGCDSENGSGDASSSATPKPNASSAKMKSTGTRDGKPNKGQILTQAVE
                     YIMSLQNDIDTRNREEVELILKVQELSNVTGTIVNDINLENTSAEIALAKIGVGTLAG
                     EVPPESDQTRQGSQSSRHPAAQYNPHISNFEYGGYAEYGDGN"
     gene            complement(<434812..>437364)
                     /locus_tag="HG536_0G02560"
                     /db_xref="GeneID:59327636"
     mRNA            complement(<434812..>437364)
                     /locus_tag="HG536_0G02560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285173.1"
                     /db_xref="GeneID:59327636"
     CDS             complement(434812..437364)
                     /locus_tag="HG536_0G02560"
                     /inference="similar to AA sequence:RefSeq:NP_010244.1"
                     /note="ancestral locus Anc_3.153"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141069.1"
                     /db_xref="GeneID:59327636"
                     /translation="MSKKRSGKGKGQPLLGRGKEHTQFLEALKLYESKSYKKSIKILD
                     GILKKDSEYVDALALKALDLVSLGEKSEAQSYCKNALSKIDGTAVSPICCHVLGIYMR
                     TVKEYAESVKWFQASLSNGSTNQQIYRDLATLQSQIEDFKGALVSRKKYWEAYLGYRA
                     NWTALAIAQDINGEHQQAVNTLSQFEKLVEGKLGKAELYENNECLMYKSDIMYRIAGN
                     NKEKLQNVLRHLNEIEPNVYDKCSLLEEKASIYMKMGELKEASKVYRILIKRNPDDFR
                     YYKLLEVSLGIQGNNALRKALYEKLEKFYPRSEPPKFIPLKFIEDEDLLSKKLQEYVL
                     PQLKRGVPAAFCNVKPLYRGRSSIVPALLEKIVSEYLLNIDPISEPIPYIWTCYYLAQ
                     HFLFLKQFQSSQEIIDKAIQHTPTLVELYLFKGRVLKHLGLFEEAAEVLEEGRKLDLQ
                     DRFINTKTVKYFLRANNIGKATEVASLFTKNDDAVNGIKDLHLVEAAWFVIEQAEAHY
                     RLYLLALRKLHNLISEAEKAEDSEQTNNEDGDNLIHNIKVTEWEMQKNQGLVLKRFHA
                     IAKFYNQFEDDQLDFHSYCMRKGTPRAYLDMLKWGKTIYTKPMYVRAIQGSFKLYSSL
                     HDQSLLDQDDSIQSKIKTIMKNHAKKAKKETSAINKRKEEDKKHFAAYAEAEDNDIYG
                     IELLSKKEPLEGFQGIYKNYCRQVGEVDKDYTLEFEYQYRKGKLALCLGALSKYTKIH
                     GTKSGLADAMAIVLLLSTKEGAPFDVIGKKVAYKGCEDVCPGLPIAERDNEDFDWLEY
                     YNQKFKNQDLEALRFLNGHKHLFDAAKLKEMILQELSNREPLIQNHVLQYEL"
     gene            complement(<437667..>439526)
                     /locus_tag="HG536_0G02570"
                     /db_xref="GeneID:59327637"
     mRNA            complement(<437667..>439526)
                     /locus_tag="HG536_0G02570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285174.1"
                     /db_xref="GeneID:59327637"
     CDS             complement(437667..439526)
                     /locus_tag="HG536_0G02570"
                     /inference="similar to AA sequence:RefSeq:NP_010248.1"
                     /note="ancestral locus Anc_3.154"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141070.1"
                     /db_xref="GeneID:59327637"
                     /translation="MLNKLWKSSSLLYRRRMSSIRKNENQPLIDESGSGSDARGSSAF
                     DEQLQKEIESFKRTQQVRLKRQKAKKPGQTAELRDEAGFKLRLADTNQKKHKQTDPDY
                     EVTIEGPLRKIAPYYFTYMTFCKLRWRDRNLLDVFETEFRDRDKSYYKKTIASGSVLL
                     NGQPANLETIIRNGDLITHKIHRHEPAVTSRPIGVVFEDDDILVIDKPSGIPVHPTGR
                     YRFNTITKILEKQWGKTVHPINRLDRLTSGLMFLAKTPRGADEMSDQIKAREVSKEYV
                     ARVVGEFPVGEVCVEEPVRSVEPRLGLNAVCKNDDEGAKHAKTVFKRLSYDGQTSIVK
                     CKPFTGRTHQIRVHLQFLGHPIANDPIYSNVTVWGPNLGKGYISDFQDIISKLDQYGR
                     TKCAESWYEPDAQGEALLGEKCSVCETDLYSDPGPNDLDLWLHAYRYESFETDPNTNR
                     KKWSYRTNLPFWALEPHRQYMELALEEAAKCGPTTTAFSVGAVLVNGTEVLSVGYSRE
                     LPGNTHAEQCALEKYFAKTGQREVPPGTVLYTTMEPCSFRLSGNEPCVQRIIAQKGRI
                     TTVFVGVIEPDTFVKNNTSSKMLSDEQIEYIHIPGYEKICTELATKGHSTNVT"
     gene            complement(<439708..>440817)
                     /locus_tag="HG536_0G02580"
                     /db_xref="GeneID:59327638"
     mRNA            complement(<439708..>440817)
                     /locus_tag="HG536_0G02580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285175.1"
                     /db_xref="GeneID:59327638"
     CDS             complement(439708..440817)
                     /locus_tag="HG536_0G02580"
                     /inference="similar to AA sequence:RefSeq:NP_014576.1"
                     /note="ancestral locus Anc_3.155"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141071.1"
                     /db_xref="GeneID:59327638"
                     /translation="MSSRWKVYVTTLNCAKKFPFDSGNDISEILREVLPESFEHDIYA
                     LGFQELMSTWEASFPSLTTPLFEDVSNAIATYVNAQSSVRKFRLVGRAITGAVGLVVL
                     ADERFKIEKVTTSIFRCGLFNSSLKGAASICCGLAAPNDVQDTFTFICSHLSANEGVK
                     NAELRVSNYECIMSACATDLRMTSFRNSHIFYFGDLNFRVKGWQDMATDYSNAQVLNN
                     LLKDHDELNKLRESNLVFQGFDESPISFPPTYKYLISTQNTFDTRKTPSWCDRVLFRR
                     YLPESFKIRSYRSVDRTSPLRFTDHQGVVLDIEVPSNFSASPLDIPASIIPAHQLLIG
                     DVMDTAIGYVGWGIAKKLHYWVAIILGLMIIYNFI"
     gene            complement(<441010..>443637)
                     /locus_tag="HG536_0G02590"
                     /db_xref="GeneID:59327639"
     mRNA            complement(<441010..>443637)
                     /locus_tag="HG536_0G02590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285176.1"
                     /db_xref="GeneID:59327639"
     CDS             complement(441010..443637)
                     /locus_tag="HG536_0G02590"
                     /inference="similar to AA sequence:RefSeq:NP_010249.1"
                     /note="ancestral locus Anc_3.156"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141072.1"
                     /db_xref="GeneID:59327639"
                     /translation="MSQFNSTSGIVPMIGKIHNRVEVPKQLLHRNTTTVNQKLGLPGM
                     FSTFVARDLRNMRILALTASSASIVACAVSIFFLVNIDRRRRVFRHDLIFFLIICDLV
                     KALVLMIYPLVILVRNSVYAQPAFFNTLGWFTAYCVEGADLAIFFFAVHFALLIFTPS
                     WKWRRRGSGKIEGGLYCVRAYIWPITALVPVLLASLAFVNFELIDVKTLMEQTTVVLD
                     NDNYHFRDYARLGGYKPYSAWCYLPPYPLWYKLVLSWGPRYFLIIFILVLYISIYVFV
                     KRESNKIKRQLFDFKEISGEREAAKATTKREFIRLQCNRFFYKPMKRFLMNVVGFLSF
                     SVEDTSSSSRGLGSMYSGSFYTTDNSTSSDQVPDKVSFDFPAQGNHKPQLSPDCEISN
                     DTAGKKDSLGLPGRMGTVGDIESRQQVGDGTNGCESRNGSFIEQLEPTYAHVPQGKRS
                     SFSAQSRPPARTYLSPMQSLCAPQRREAEQNDQAEVNYSGQNYQPPTANVKDVQASFQ
                     KQTYAAMKRRRVQIQKNLRSIFIYPFSYIAIWIFPLIVDITQYNYEIVHGPIVWLVYI
                     ATIAQPLNGLVDTLVFVYREKPWKCSWRVVQTKELLDAYSLKGGFSEKDIAELYHSDL
                     GKKGWYYCSRFDKYSCWKHKPQRWKRAAWYIHRFFRGFIRNDYNFEDHCDELASLHNG
                     SVAEAHPPGPNVLKSPYDQRERQISFPSDSTAASAPFAQPNRNAESNDHVEVSSFWRL
                     VHLFPMLHGIDLDELSQELRRRPDDNDFILPGLKQALNKNSAGGPKNLDELAKPNFKP
                     GYSVDRNAKAVENGEDKSSAQAQPNYANFTMSANLDFSDVVRGQSPGAAEKDDKKSDA
                     GSSEGDEMGMLAFLNDIPH"
     gene            complement(<444051..>445145)
                     /locus_tag="HG536_0G02600"
                     /db_xref="GeneID:59327640"
     mRNA            complement(<444051..>445145)
                     /locus_tag="HG536_0G02600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285177.1"
                     /db_xref="GeneID:59327640"
     CDS             complement(444051..445145)
                     /locus_tag="HG536_0G02600"
                     /inference="similar to AA sequence:RefSeq:NP_014577.1"
                     /note="ancestral locus Anc_3.157"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141073.1"
                     /db_xref="GeneID:59327640"
                     /translation="MGYEKELFVATQAVLKASFLTLRIQSKVIAHRDTSTITKSDKSP
                     VTIGDYAAQSIIINAIKANFPEDKIVGEETSEGLEDAFVSEILNEIRENDQVFENEYP
                     GQQASRVLANEIFPLKTIRDVRTVIDFGDYEGGDKGRVWCLDPIDGTKGFLRGEQFAV
                     CLALIVDGATQLGVIGCPNLSLGQYGGEDLPGYERFGYVFRAARGQGTSFAPAASLTT
                     AAEAHWTRIHARKLDSTNEMVSLEGAERSHSSHEEQSVIKNRLGIRKSLHLDSQVKYC
                     MLALGLGDVYLRLPVRMDYQEKIWDHAAGNVIVEEAGGVHSDSLDNVPLNFGRGRTLH
                     TKGVIASSGPPELHRLILSASGEVLRSRDR"
     gene            complement(<445311..>446546)
                     /locus_tag="HG536_0G02610"
                     /db_xref="GeneID:59327641"
     mRNA            complement(<445311..>446546)
                     /locus_tag="HG536_0G02610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285178.1"
                     /db_xref="GeneID:59327641"
     CDS             complement(445311..446546)
                     /locus_tag="HG536_0G02610"
                     /inference="similar to AA sequence:RefSeq:NP_010251.1"
                     /note="ancestral locus Anc_3.158"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141074.1"
                     /db_xref="GeneID:59327641"
                     /translation="MFSQWAKLVAARRLPGYRPQVLPGKFDNVIIAMSSGVDSSVAAA
                     IFADQYPNARGIYMQNWSKSQSLTDPSKEACYERDWKDVVRTAEHLAIPVDKVNFEQE
                     YWIDVFEPMLDSYSRGWTPNPDVSCNKFVKFGKLRHHLNAKYGKGNYWLVTGHYARAL
                     DCEWDNETHLLRSYYLQKDQSYYLSLIPPSFLPRVLFPMGHLTKPEVRQLAKDIGLPS
                     AAKPDSQGICFVNNSQHGKFKNFLQHYLPESKGHIVTVDEATGKKRTWGEHGGLWSYT
                     IGQKIGFSMPQGDPRYAGAWYVSDKLQDTNELVIVRGSNHPALYKKALDVQNFTIQGL
                     KQAKIKAEIAAAAMSGTLTMQYRSLQEPIPVLATELPDNKLLHVELVEKQRAMAPGQN
                     CCLYLGDRILGSGTISKVE"
     gene            <446629..>449649
                     /locus_tag="HG536_0G02620"
                     /db_xref="GeneID:59327642"
     mRNA            <446629..>449649
                     /locus_tag="HG536_0G02620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285179.1"
                     /db_xref="GeneID:59327642"
     CDS             446629..449649
                     /locus_tag="HG536_0G02620"
                     /inference="similar to AA sequence:RefSeq:NP_010253.2"
                     /note="ancestral locus Anc_3.159"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141075.1"
                     /db_xref="GeneID:59327642"
                     /translation="MSLKIEKLQYSKRLSSSHQGVVSGFIIRIPISMGMKGSLKRKAV
                     GESALSGDEGAESGSDIEYDIVNNIAINSSDSDDDESEDLDAYEEQDVIEYSDDEDQP
                     KIQAKKSTDKMKTMPKLEMSDGEGDDDPDDVNEYFSTTAMDTKKHKKGSFPSFGFSKL
                     VLSNISRKGFHQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMIEKLKCHSSK
                     VGARAVILSPSRELAMQTHRVFKDFSRGTDLRSVLLTGGDSLEDQFGMMMSNPDVIVA
                     TPGRFLHLKVEMNLDLKSVEYAVFDESDRLFEMGFEEQLNELLAALPANRQTLLFSAT
                     LPNSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLTTKHDEREANLLYLLQEIIKIP
                     LATEEQIKLLKSRSQDNDSDDDSDREQGKRKHAKGKKGKFKKVRMPAANELPSEKSTI
                     LFVPTRHHVEYIANLLKKCGYLVSYIYGTLDQRARNRQLYNFRAGLTSILVVTDVAAR
                     GVDIPMLANVVNYTLPSSSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLELELFLG
                     RKVLTTEMYETAADALKKKWIEQGKDEILFQQPSISYTNRLVLGSCPRLDLESMGDLH
                     KNLMSDFELETLKGVAKRAEKLYLRTRTAASAESVKRSKQLISAGWDEQNVRFGKNLE
                     KEKIDFLAKLQGRRNKETVFEFARNADDETSMLMKKRRTQVAPIQEKARRRRELSEME
                     KAAGMSHGLQDEILDDHSGISTNTVSEEVLQSFEDADKVLQEQELGRKMPKSFRDPNF
                     FLSHFAPRGGQQDNELQLTSGFTTDAAHAAYDINGDDKVQVHKQTATVKWDKKKKKYI
                     NAQGADNKKYITGESGQKIPASFRSGKFAEWSKARNLQPIKVGAKESPAAMNLLKNPA
                     QSNPADGQRRIHGKFKHKQIKAPKLPDKHRDDYEKQKKKVKEALERGTRVKGYNNQGG
                     ARNELQSASQIRKQRQTKEKRKAKNARPSKKRKF"
     gene            <449816..>451411
                     /locus_tag="HG536_0G02630"
                     /db_xref="GeneID:59327643"
     mRNA            <449816..>451411
                     /locus_tag="HG536_0G02630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285180.1"
                     /db_xref="GeneID:59327643"
     CDS             449816..451411
                     /locus_tag="HG536_0G02630"
                     /inference="similar to AA sequence:RefSeq:NP_010254.1"
                     /note="ancestral locus Anc_3.160"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141076.1"
                     /db_xref="GeneID:59327643"
                     /translation="MQKGSIMDTLESRRAQLEDLEIIEESISSRFERNPEIFYSYLEN
                     KASIDNEPLNQYTENASKANRIYKRNRLRRSRKQIVVQQNEINILLEESLKRLKSLSD
                     LAGPVNTNSLEDDDATFETFRHNLDEIKARFNEEATPPRFQLRDKRSGYAMFSASTAK
                     AHPTTILSRNAQDLNVNDVFDREEQYGEILSLERFHSRWFSVIRDTNCSLLEYYGTLE
                     LFLDDAKYLLYPPMDRKNERYTAYLIDLSSYLENFFKRANVLINHTLLDRKMQSAFSK
                     YLSNALEHEQKGCYCVACCKWFKLRTVFDSHQSGKAHKKNLSKRSKGLLAEYKVHAYL
                     VLLKRQFMRTKELTERKLAFTAEERMQEMSKLHQEYQASEYATDEQEQDDKTDDLKSG
                     RDANKHAPTSGSFDLPLGPDGLPMPHWLYKLQGLDVTYSCEICANQTYKGRRTFEKHF
                     LEPTHTFHLKCLGIEPSLAFKGITSIKEAQELWQKSAAHRQASPRREDTPQQAKIELE
                     VEDQEGNVLSEKVYQELKKQGLV"
     gene            <451818..>452831
                     /locus_tag="HG536_0G02640"
                     /db_xref="GeneID:59327644"
     mRNA            <451818..>452831
                     /locus_tag="HG536_0G02640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285181.1"
                     /db_xref="GeneID:59327644"
     CDS             451818..452831
                     /locus_tag="HG536_0G02640"
                     /inference="similar to AA sequence:RefSeq:NP_010255.1"
                     /note="ancestral locus Anc_3.161"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141077.1"
                     /db_xref="GeneID:59327644"
                     /translation="MIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKL
                     ATTSNGKVLLTEPPMNPVKNREKMCEVMFEKYEFGGVYVAIQAVLALYAQGLSSGVVV
                     DSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYNFNRSADFETVRQ
                     IKEKLCYVSYDLDLDTKLARETTTLVEKYELPDGRDIKVGQERFEAPECLFQPNLVDV
                     EQPGIGEMLFNTIQAADVDVRSSLYRAIVLSGGSSMYPGLPSRLEKELKQLWYTRVLH
                     NDASRLDKFKVRIEDPPRRKHMVFIGGAVLANIMADKDHMWLSKQEWEESGPAAMAKF
                     GPR"
     gene            complement(<452956..>455334)
                     /locus_tag="HG536_0G02650"
                     /db_xref="GeneID:59327645"
     mRNA            complement(<452956..>455334)
                     /locus_tag="HG536_0G02650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285182.1"
                     /db_xref="GeneID:59327645"
     CDS             complement(452956..455334)
                     /locus_tag="HG536_0G02650"
                     /inference="similar to AA sequence:RefSeq:NP_010256.2"
                     /note="ancestral locus Anc_3.162"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141078.1"
                     /db_xref="GeneID:59327645"
                     /translation="MMPNYSSIYPPTMERSKLRGSYKDDSDDEKITAPPKLSDFGTAL
                     VMDKENIAPSGTFQSKRPLHDSLKDAKQRLGSTSTEYFSGNTNQTSFSQTYVSAHSGE
                     PSQSTIFAQSRLNQQPSMTTMNADEVGLPVTDLDSSFRKIKSMQQSMREELTTRHAQR
                     RSRRFLNGTRAGILGPAKRAPSTSGAEVSDLSLENISAAVPRTNPEPEERRFSTEKLR
                     LEDATREKQFLKGKDENLIDFGDMNPVQYMKLHKLPSSELPRISRLYFERQRRQTHQL
                     ALQKNFASREALVNQGLRSLSSIASLGSENKKDSPAPLAYPRRKLSDTAISSASKTNF
                     QTSIFSPEKNSPKDAAAALQSRRARTATNRDEEPHKAYAHRAFNTLNHTKREALANID
                     INRSVQEQLQQPKRLKPVIDLVKPSLPESELHANREELINKEPSKVRATKRVEILEPN
                     PNQSQARRNVVKVNDVEYEKVELLGRGGSSKVYKVRDSGNRIYALKRVVFDEFDDTSV
                     DGFKGEIELLKKLENEKRVVQLIDHEMEHGVLYLVMECGDHDLSQVLNQRNGMPLDME
                     FVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYR
                     ENQIGTPNYMAPEALVAMNYTQGESKLQQQNRWKVGKPSDIWSCGCIIYQMIYGRPPY
                     GGFQGQNRLLAIMNPDVKIMFSDRTSKDEAIPRSALDAMKSCLLRNPDKRSSVDELLE
                     SNFLKPVMVTPFFIRDLIKNAVKYGADQKDVSKEKVEELADDVLNRLADFRL"
     gene            complement(<455748..>456905)
                     /locus_tag="HG536_0G02660"
                     /db_xref="GeneID:59327646"
     mRNA            complement(<455748..>456905)
                     /locus_tag="HG536_0G02660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285183.1"
                     /db_xref="GeneID:59327646"
     CDS             complement(455748..456905)
                     /locus_tag="HG536_0G02660"
                     /inference="similar to AA sequence:RefSeq:NP_010257.1"
                     /note="ancestral locus Anc_3.164"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141079.1"
                     /db_xref="GeneID:59327646"
                     /translation="MQTLATRSVMYPALRVKFDSRIVLSNIRSYGLRRLLPVQHFGTA
                     NLSAKRNSLAERQVVSSSRFPRIPSYSNNVSMLHIGLARKRFFHNTSSREIFFSFKGG
                     RPLYKIYRISPVMLFFAGVGFFVLAFAVIPIVFTFFLPLFIGTVVVFQFNKWRRNVML
                     REIIGSLKRSTMHVKYKTVRALHIKGLENVLKVEQQSSESLKDVLKRFNVALESQIDR
                     SSVADADRLSGFINDRLLEAVENDEKGVRSFFLGNDVNSWVSDNYELELDTKQIKTNG
                     RVLGDDVLIVLTFPLYLKSTSHGRKQLANVSLVISHKSPEGALNAPFPFQLLSMNNEE
                     CQMVLSIRPLSVLSTRQFILTSPGRSGDWYSKYEVRQTPDNHTEYTIRRNE"
     gene            complement(<457034..>458458)
                     /locus_tag="HG536_0G02670"
                     /db_xref="GeneID:59327647"
     mRNA            complement(<457034..>458458)
                     /locus_tag="HG536_0G02670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285184.1"
                     /db_xref="GeneID:59327647"
     CDS             complement(457034..458458)
                     /locus_tag="HG536_0G02670"
                     /inference="similar to AA sequence:RefSeq:NP_014579.1"
                     /note="ancestral locus Anc_3.165"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141080.1"
                     /db_xref="GeneID:59327647"
                     /translation="MISAVLIFSSRGELIVAKILKSSLKRSISDVFRIQVINNLDVRS
                     PILTLGSTTFHHIRSSGSDSLWLVAVSRTNANSGAIWEFLYKLNAIMDVYGLIREETL
                     KEEFMVCYEMLDIVLGEGGIPVDTEVNSVIGKMSAKPTKQLNGNSLDRPELLSSSGDS
                     PALSMPRFLTRSNRSMSQDLGLNYPSSFPWRPHGIKYKKNEVLLNVNEKISILVSRDG
                     SILKSHVDGTIDLTTHLSGMPICQFGLNDSLSVDFGDEPAFGSEDFANEKAIPKAAAG
                     RVLLEDCKFHQCVSLDKFNRDRVIKFVPPDGTMELMKYCVRHNLNLPFKVTPNVTNFG
                     RGNTLDYRVTLKSLFPSKLSARDVSLRIPVPPGTVDCEISVSNGKCKFVPEENAMIWK
                     FSKYTGLTENTLSAITVPTSDTTQLTIQQWPRPPMSLDFSIVMFSNSGLVVRYFRVSD
                     KEEKYRTVKWIKYISNSGSYEVRY"
     gene            <458925..>460286
                     /locus_tag="HG536_0G02680"
                     /db_xref="GeneID:59327648"
     mRNA            <458925..>460286
                     /locus_tag="HG536_0G02680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285185.1"
                     /db_xref="GeneID:59327648"
     CDS             458925..460286
                     /locus_tag="HG536_0G02680"
                     /inference="similar to AA sequence:RefSeq:NP_014580.1"
                     /note="ancestral locus Anc_3.166"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141081.1"
                     /db_xref="GeneID:59327648"
                     /translation="MGDIVIFGGGSHPELVKMICENLGIHPSSVQLGKFSNGETSISV
                     NESVREKDVYVIQSGCGHVNDCFMELLILISACKTASASRVTAVMPYFCYSRQPDIPY
                     TAKGAPLISKSQSLDGKVGEAPLSSTLMTHRPGEDSPFKSLESAIRATAPKMNLHSSG
                     SGTNLKKSASSSRIPMIPGGKEVGSANADAGELFNAQNAGYKLWVAQAGTLIANLLTT
                     AGADHVITMDLHDPQFQGFFDIPVDNLYCQPIAQNYIQHRIPNYKEAVIVSPDAGGAK
                     RATAIADALKLSFALIHKERRSQLLKGPPTTTGLPMSSKPLLTTLNAAEMQPSPSNSK
                     YVQTTMLVGDVRNKVCIIVDDLVDTSYTITRAAKLLKDQGATKVYALLTHGIFSGDAL
                     SRISQSCIDKLIVSNSVPQQDTIEYLGKGNVDIMDVSRVFAEAIRRIHNGESISMLFE
                     HGW"
     gene            complement(<460477..>462540)
                     /locus_tag="HG536_0G02690"
                     /db_xref="GeneID:59327649"
     mRNA            complement(<460477..>462540)
                     /locus_tag="HG536_0G02690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285186.1"
                     /db_xref="GeneID:59327649"
     CDS             complement(460477..462540)
                     /locus_tag="HG536_0G02690"
                     /inference="similar to AA sequence:RefSeq:NP_010259.1"
                     /note="ancestral locus Anc_3.167"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141082.1"
                     /db_xref="GeneID:59327649"
                     /translation="MVMPSHDSDLDKLVPHDSGNSQHSNASGSSIPSVFAKSKLIGLG
                     KLFGGNKLDHKQNAGHSAQEKVFDREQLSSGREFLGHLLSPKMSNSSTGSHGKTQSPT
                     RLQEQAKVNNFGGNNSDSTNGSSAYSASGDPTLIAVANPSSHHFHNPLNYITLSPSSS
                     SELAHMHPVEILQKQIEDQQKLSRSRNTSSSSVPKLSTKKSGEHRDKTKKPLRLKRFF
                     KKLHDDAIAYTKTKLEEEQKLEKDLEDLSVSSSHGVYVRTDESQTTHKTIFQTDNAKE
                     LIDKYGIPGRKLGEGSSGSVSVVERTDGKMFAVKMFRLRNTKSKQNQLAFSKKVTAEF
                     CIGSTLHHPNIIETLDMLQEGRTYLVVMEYVPYDFFTLVMSGMMTKLEIACYFKQICS
                     GVHYLHSVGLAHRDLKLDNCVVTSQGVLKLIDFGSAVVFQYPYEPDIVQAKGIVGSDP
                     YLAPELLVRVSYDPRPVDVWSIAITFYCMSLRRFPWKAPRTNYTSFRLFCEEADDPRD
                     TTKGPFYILKLLPRSSRKVIGQMLKINPKERILMDDVMKDEWVQSINACEPDQDGNVS
                     PPTDHEHHLITEDELNRKVAEEAKMAQEKETAEQEGKAKHTQGHGHSHVHSHCSHSHH
                     RGQCHKHHHKHSHDVNRQSQNHSSQPSIDQTESREDNKEHEHTDLNTLVDVADEGRRN
                     GQIPS"
     gene            complement(<462804..>464684)
                     /locus_tag="HG536_0G02700"
                     /db_xref="GeneID:59327650"
     mRNA            complement(<462804..>464684)
                     /locus_tag="HG536_0G02700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285187.1"
                     /db_xref="GeneID:59327650"
     CDS             complement(462804..464684)
                     /locus_tag="HG536_0G02700"
                     /inference="similar to AA sequence:RefSeq:NP_014581.1"
                     /note="ancestral locus Anc_3.168"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141083.1"
                     /db_xref="GeneID:59327650"
                     /translation="MLKHRVYFVLATVVLPRLIHSLPLQSQLEDGRGEGDAVGEGVSR
                     DYYLFISAVLVLLGGVFAGLTLGLMGQDEIYLKVISSSGTAQEQRLAKKVLGLINRGK
                     HWVLVTLLLSNVITNETLPIVLDRCLGGGWQAVFSSTVLIVVFGEIIPQSVCVKYGLQ
                     VGAFFAPFVLVLMYVMYPVAYPIAALLDYMLGEDHGTMYKKSGLKTLVMLHRTMGVER
                     LSQDEVTIISAVLDLKEKKVREIMTPIENVFTISADTVLDEKHVAEIFDSGFSRIPIY
                     LPNEPTNFIGMLLVRILISYDPEDCLPVSHFPLATLPETSPSTSCLNILNYFQEGKSH
                     MCVVSEDPGSSMGAIGVLTLEDVIEELIGEEIVDESDVFVDIHQKIIRAQPGPLSKRH
                     VTSYLHHLYTSRSRSDSPSAEDSRQPLEVRNDHLACNANSPHPLDAAHNHMALPSNPA
                     SNPLKVNKPYVTIKKPNYNLPANEEHLYRKHLDMSQRAVDHTEMTGQPTQVTSALAPA
                     TGAHHSSPELASEDGRSSSHSTKPNAIISSSYKSTKNGIVESVITVKGVPKTIIEATN
                     NWDETSRLVSPNHVGSYTEGPIDGPKSHFTQLSPVNSRSSTKGKKSASDRSGSSGAVS
                     YR"
     gene            <465244..>466551
                     /locus_tag="HG536_0G02710"
                     /db_xref="GeneID:59327651"
     mRNA            <465244..>466551
                     /locus_tag="HG536_0G02710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285188.1"
                     /db_xref="GeneID:59327651"
     CDS             465244..466551
                     /locus_tag="HG536_0G02710"
                     /inference="similar to AA sequence:RefSeq:NP_010262.1"
                     /note="ancestral locus Anc_3.169"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141084.1"
                     /db_xref="GeneID:59327651"
                     /translation="MILNYLGRSTRSSASFRRLYLFTHKRYRVATSRRIQTIIDQMAA
                     TDRLNQTSDIISHSMQHSDSTTSLAALEKPFKVTVVGSGNWGTTIAKVIAENTALNPQ
                     LFARRVDMWVFDEKIEGRNLTEIINTQHENVKYLPGIELPENLYANPDLLDSVRDTDI
                     IVFNIPHQFLSRIVQQLKGHVSKHVRAISCLKGFEVGPKGVQLLSTYVTEELGIQCGA
                     LSGANLAPEVAQEHWSETTVAYHIPADFRGEGRDVDHKVLKALFHRPYFHVSVIEDVA
                     GISIAGALKNVVALGCGFVEGLGWGNNAAAAIQRVGLGEIIKFGRMFFPESKVETYYQ
                     ESAGVADLITTCSGGRNVKVAKAMAKTGKSAEQCEKELLNGQSAQGLITCKEVHQWLE
                     TVHHLDDFPLFEAVYQIVYNNVPMDKLPDMIEELDLGLKDAAQ"
     gene            <466747..>468003
                     /locus_tag="HG536_0G02720"
                     /db_xref="GeneID:59327652"
     mRNA            <466747..>468003
                     /locus_tag="HG536_0G02720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285189.1"
                     /db_xref="GeneID:59327652"
     CDS             466747..468003
                     /locus_tag="HG536_0G02720"
                     /inference="similar to AA sequence:RefSeq:NP_014583.2"
                     /note="ancestral locus Anc_3.170"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141085.1"
                     /db_xref="GeneID:59327652"
                     /translation="MSKGKVCLAYSGGLDTSIILAWLLEQGYEVVAFMANVGQEEDFD
                     AAREKALKIGATKYVLVDCREDFVKDILFPAVQVNAAYEDIYLLGTSLARPVIAKAQI
                     DVAKQEGCFAVSHGCTGKGNDQIRFELGFYALKPDVKVIAPWRLPEFFERFAGRKDLL
                     DYAAEKGIPVAQTKAKPWSTDENQAHISYEAGILEDPDTTPPKDMWKLIVDPQDAPET
                     PQDLAIEFQRGLPVKVSYQRDGQQVVVTEPLEIFAHVSSLARANGVGRIDIVEDRYIN
                     LKSRGCYEQAPLTVLRRAHVDLEGLTLDKEVRALRDQFVTPAYSRLLYNGSYFTPECE
                     YVRSMIQPSQESVNGVVRLRLYKGNVIVLGRSSATENLYDPTESSMDELTGFSPVDTS
                     GFIAIQAIRVKKYGEAKKAKGQEITL"
     gene            <468338..>469243
                     /locus_tag="HG536_0G02730"
                     /db_xref="GeneID:59327653"
     mRNA            <468338..>469243
                     /locus_tag="HG536_0G02730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285190.1"
                     /db_xref="GeneID:59327653"
     CDS             468338..469243
                     /locus_tag="HG536_0G02730"
                     /inference="similar to AA sequence:RefSeq:NP_010263.1"
                     /note="ancestral locus Anc_3.172"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141086.1"
                     /db_xref="GeneID:59327653"
                     /translation="MTVASNTLKVILLRHGQSELNHENIFCGWIDAKLTEKGKTQARN
                     AARLIQDYCQKNGVSLPQVGYTSRLCRTQQTMEVMLDEMGLEGSYEVVPGVDCDIGET
                     LNKDVVRVLQSWRLNERHYGSWQGQRKPQILKEYGKEQYMYIRRDYQGKPPAADLKRE
                     MMQEVNDPGSSTGYEFKEPNRHQKYQLEEKSGVQLPDSESLRDVVERMRPFLTQVVLQ
                     VARQHNLESCLMVGHGSSVRSILKILQNISDDEIKNVDIPNATPLVVELDKDTFKFVN
                     RYYLDPETASIDAEKVRQEGFQNNP"
     gene            complement(<470291..>471757)
                     /locus_tag="HG536_0G02740"
                     /db_xref="GeneID:59327654"
     mRNA            complement(<470291..>471757)
                     /locus_tag="HG536_0G02740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285191.1"
                     /db_xref="GeneID:59327654"
     CDS             complement(470291..471757)
                     /locus_tag="HG536_0G02740"
                     /inference="similar to AA sequence:RefSeq:NP_010264.3"
                     /note="ancestral locus Anc_3.173"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141087.1"
                     /db_xref="GeneID:59327654"
                     /translation="MTSTELALNRTLTDILEDELYNIREEHHIGHSKSKNVLELSLPL
                     PFDEYMTGNDENIVSSEYNWARPSISPGSSEVTDSNSQRHHQHAHIPDRSIFNKYADP
                     SLTTTSRRRSVTESDLKSNGRGSLSNSGTPIQKTVNLNSVMKVANPFHLAREQLPFDV
                     KVTGDVLDGSDSAYSTQPYDDNANHDASYDPKTYWPLQDNNVALSNEDAKMIFDHEFA
                     AEDDDDLSEDEEDEREYTRDYKKIPLGYAGELASNKLDMEDKVFSSCNFVDSNMAGTS
                     LNEDESVLDITSDFDNMIDEDDLYEPSSRNGRKESVVSDATSRDGSNEGKLQSISPAF
                     TMVKSQSGKAGARQKSSPNLVNSSPSVSSRRGGLTNKKNTHSPYPQDHTVSETSNGTE
                     IFTCMIINSITKQPCSAQFSRSYDLTRHQNTIHAKKKAVFRCFECISLLGQEGYQKTF
                     SRLDALTRHIKSKHEDLSLERRQEVTRYARENIGYVVG"
     gene            complement(<472219..>473886)
                     /locus_tag="HG536_0G02750"
                     /db_xref="GeneID:59327655"
     mRNA            complement(<472219..>473886)
                     /locus_tag="HG536_0G02750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285192.1"
                     /db_xref="GeneID:59327655"
     CDS             complement(472219..473886)
                     /locus_tag="HG536_0G02750"
                     /inference="similar to AA sequence:RefSeq:NP_014586.1"
                     /note="ancestral locus Anc_3.174"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141088.1"
                     /db_xref="GeneID:59327655"
                     /translation="MGLTTIKINTPPPYLTLSRDEYLPVVLTVAGSDSSGGAGIEADT
                     KTITAHRCYAMTCVTALTAQSPVAVSDVHPIPKEFVQKVLDVNLADMKCNVIKTGMLT
                     VDAASVLSAKLQSMAEKERPKLVVDPVLVATSGSALGDSKLVEVLKKELTPLADLLTP
                     NIPECFELVGEKVEIGSLAQLCDLAERVSRVTSCSNVLVKGGHIPWEDEQKKYITDVL
                     YVGSEGKCIVYKGSYVDTTHTHGTGCTLASAISSNLARGYSLGQAVYGGIEYVQNGIA
                     IGCEVAKDHVTANGPINHVYAIEIPLEKMVADECFSAHEVLPKQTVASPVPGDGDFFQ
                     YLIEHPKVKPHWESYVNHEFVKQVANGTLPRNKFRFFIEQDYSYLIDYARVHCVAGSK
                     APALEDIEKELVIVGSVRNEMGQHEKRLIEEFGVKDMDYFRNIKRGPALNNYSRYFND
                     VARRGNWQELVASLSPCLMGYGHALLNHEKYISVKEGDAYHEWCHTYLSTWYQDAMSK
                     GKELLNQIASVYPREDIDTLITIYADVCELETKFWDAALNYTEDQTD"
     gene            complement(<474306..>478223)
                     /locus_tag="HG536_0G02760"
                     /db_xref="GeneID:59327656"
     mRNA            complement(<474306..>478223)
                     /locus_tag="HG536_0G02760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285193.1"
                     /db_xref="GeneID:59327656"
     CDS             complement(474306..478223)
                     /locus_tag="HG536_0G02760"
                     /inference="similar to AA sequence:RefSeq:NP_010265.1"
                     /note="ancestral locus Anc_3.175"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141089.1"
                     /db_xref="GeneID:59327656"
                     /translation="MSSLNRSSASMREQSKEQSPHLPHKTTTSTDTASRSDQDELNEI
                     GNCDGDKGSQIISRPLLKLKLLDSLRQGNFENLKQLIHGQFQPADDPNVKAVRSLTLH
                     YAVQVAPLSLIKEIVQEWCKDNQKDAGDLDVCLDINQTDENGNTPLHLAAFQTRGDVV
                     AFLMDQPNINDCVLNNSHLQPIEVCKNLNIAQMMQVKRASYVAETAQEFRTAFNNRDF
                     SHLESILSAPRNAELLDINGMDPETGDTVLHEFVKKRDVIMCRWLLEHGADPFKRDRQ
                     GRLPIDLVGKVSESSTATNTKAAIEVELKKLLSKAAKEQSAIDVTNNLNEPPTYKGYL
                     KKWTNFAQGYKLRWFILSKDGKLSYFKDQSDTRNACRGSLNMSSCYLHLDSSEKLKFE
                     IIGGSDGTIRWHLKANHPIETNRWVWAIQGAIRFSKDREMMTKSGNIPPSLAMSRGAS
                     SSTTVQKLHSYESQRHSSQLHLTHDRREPSADHPQAKQHNRIPSSSSSRGKLSSTPSI
                     ASSDMGLSDNLTESGKMYVNKILENRLESTSRASSIKNFGAEFPNKEAYVASVHSSSK
                     SNVVDANGNEALPGNRSITGSELNYVDDQTASVDFGTVSDDAEDNEEVTKEDDEDVAV
                     QYGPYAEKLAILQRTISMDLASLTELLDSGIPGKEEWEIIRRSLASVLGTFEKLNSLT
                     SARDKKLVMMLSKQRDVNNVWIQSVKDLEIELIEKSNRLASLDKERKNLKKLLQKGLL
                     DAGEASNTSLYNLNLNGPNATEETPNALDQIAKFIDATKDEDAGSEADEFFDAEELVE
                     ASNIEQELIEPVENEVTESKAALRKGKEMVTEVHPVKEDKLPSYDEAERIPSEEVTKP
                     GATKEKTLPKEKEGNIFAIVKTAGQTKKARLMMEEGSYLGYEDGVRNRLKLDKDDRPS
                     IGLWSVLKSMVGKDMTRMTLPVTFNEPTSLLQRVAEDLEYINLLDEAASFEDSTLRLL
                     YIGVFTASSYASTIKRVAKPFNPLLGETFEYARPDKHYRFFTEQVSHHPPISATWTES
                     PKWDFWGESNVDSKFNGRSFAFRHLGLWYIKMRPDNQSPDEIYTWKKPNNTVIGILVG
                     NPQVDNHGDVKIVNHTTGDYCMLNFKARGWRSSGAYEVRGEVFNKQGKKMWVLGGHWN
                     DSIYGKKVTSNDNDDFALQKTITTSSPATAGPNFDGSKFLIWKVHPRPDAPFNLTPFA
                     ITLNAPQPKLLPWLAPTDTRLRPDQRSMEEGRYDEAGEEKHRLEEKQRAARKRREAAK
                     EQYHPRWFVKEIHPITKSPYWRFKGDYWNLRKQHKLDNCEDIF"
     gene            complement(<478663..>480789)
                     /locus_tag="HG536_0G02770"
                     /db_xref="GeneID:59327657"
     mRNA            complement(<478663..>480789)
                     /locus_tag="HG536_0G02770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285194.1"
                     /db_xref="GeneID:59327657"
     CDS             complement(478663..480789)
                     /locus_tag="HG536_0G02770"
                     /inference="similar to AA sequence:RefSeq:NP_009420.1"
                     /note="ancestral locus Anc_3.176"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141090.1"
                     /db_xref="GeneID:59327657"
                     /translation="MPDTALQSNLLKRLPIPDLKDTLNRYLDRIEPLQDEKQNKRTRK
                     CVLSDENLELMQTLHEKLLQYDESLAHENPNSSYIEQFWYDAYLLYEASVVLNSNPFF
                     QLQDDPTIKDTSETGTGPYGIFTGQVKRTAKLVTSILKFIKEIRHGTLKADTVRGKIP
                     LSMDQYGKLFGSSRIPPGPGQESCHLQTDTTSHHVIVMYKSQFYWFDVLDVNNVPIFS
                     TPEELEWNLYSIIMDNEKRSNDGESDYTANVPFGLFTTENRRVWANIRDYVFHSVDSS
                     NWKNLKIIDSALFVICLDDVSFYKGQENELVKSLLCGTSQIDLGSANAARPLGVQQGT
                     CSNRWYDKLQLIITRNGKAGINFEHTGIDGHTVLRLATDIYTDSILSFARGVTENVPD
                     IFHADGTTGIKKPSRANLITIPRKLEWKVDSFLLSSLHFAETRVSDAISQYEFATLNF
                     DKYGSSHIKSTFKTSPDAFVQQMFQIAYYALYGKFETTYEPAMTKMFLNGRTEAIRSV
                     THQSKKFVKSLFDRRSNDEGRIKLLQQACAEHSRITKECSMGMGQDRHLYALYCLWNE
                     SYKDKIPLPPLFNDRSWNLINTNVLSTSNCGNPSLATFGFGPVTANGFGIGYIIRDNS
                     VSVVVSSRHRQTHRFISLIEKSFLEVDHIFERQEAMANEADPPEKESRTSSMSKGKPR
                     TYSSLKSDDLRFLLGGYDYFDVSVSG"
     gene            <481318..>484086
                     /locus_tag="HG536_0G02780"
                     /db_xref="GeneID:59327658"
     mRNA            <481318..>484086
                     /locus_tag="HG536_0G02780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285195.1"
                     /db_xref="GeneID:59327658"
     CDS             481318..484086
                     /locus_tag="HG536_0G02780"
                     /inference="similar to AA sequence:RefSeq:NP_009411.2"
                     /note="ancestral locus Anc_3.177"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141091.1"
                     /db_xref="GeneID:59327658"
                     /translation="MDGDERVNLTPAQQVDQNGVVTPLLHPRQRKNQVQYQLKQVIGK
                     GSYGVVYKAINRKTEQVVAIKEVTYDDDEELTDIMSEIGLLKNLNHINIVKYHGFIKK
                     SHNLYIILEYCSHGSLKNAISRGKGIPESKAKVFVKQTLNGLRYLHEQGVIHRDIKAA
                     NLLLDANNVVKLADFGVSTKVSTMSMAMTLAGSLNWMAPEIIGNRGASTLSDIWSLGA
                     TVLELLTGSPPFHNLVDVNIYYAIENDTFIPPVSLSQDAQEFLLNCFQKNMYKRPTAA
                     QLLKHKWLSNTDADRLELFREECEDFNYRWDHDFKDSTILNNHTTEQSKLTSHDYIND
                     CGKQTILKSPEGLLKANNTSALSDDDVKTIFDQLGVESIYLKIMDHVGENPELLSILL
                     RFDRKFYASDLKRYFMKMGGIATVLDKSDIIAEFFLKDEYKTLIQCGILRKDNLEKLD
                     DSIKLELIFRLLEVSGSVSFWCSWCSQNLSVATLISNLQNKYAQSIILKLSLLQESSS
                     WFHEQLIDRLTRLENVAALDQQLISFLFKALSSILIKSRRSSPSSTTGSLSYSPTSSQ
                     TSMNSLASTLSKPVSSSAQGNPLILPPKLLPWLLDLLNDDIFYNMKNLHLWKYYFLVI
                     HHSTHLDKVRLNRLLHSQKFLQLNWRLLYVKDDPSFFHKECQGPVVQLSLSIITELSL
                     EMDTFNPLLQHLALTFLRYDDECIAGGLEILFNHLQFALHHNFKVIRTIKGFSIIAPN
                     IGKSASAFSPKEFSNILEYQELINPFFSIHEDNLQFGNFIAKFIKIYSLGPFDAAAMS
                     IVLDSDFAKRSILFFEQYCNSLLIQIDLLKFIKLVFSRALEYFEFKKRSGDPLNDDVL
                     KCILMRLQEMNVFLENNWNSQQPGQVGCDSILIHQLCHDIQALSLQTPSSLSATRSSA
                     FDLDTTAD"
     gene            <484289..>485539
                     /locus_tag="HG536_0G02790"
                     /db_xref="GeneID:59327659"
     mRNA            <484289..>485539
                     /locus_tag="HG536_0G02790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285196.1"
                     /db_xref="GeneID:59327659"
     CDS             484289..485539
                     /locus_tag="HG536_0G02790"
                     /inference="similar to AA sequence:RefSeq:NP_009410.1"
                     /note="ancestral locus Anc_3.178"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141092.1"
                     /db_xref="GeneID:59327659"
                     /translation="MYTRRPIPNEYCPSQPSAPTVAQPANQFQVLEEIGRGSFGAVHK
                     VIHLPTKKVMVRKDIKYGHMNSKERQQLIAECTILSQLKHENIVEFYSWDFNEQKEVL
                     YLYMEYCSRGDLSQMIKHYKQEHKYIPEKVIWGILAQLLMALYKCHYGDDLLPLTTMY
                     DRMKPPARGKNVVIHRDLKPGNIFLSNEDNEDKDNKNHRNMDYSQVVVKLGDFGLAKS
                     LEASIQFATTYVGTPYYMSPEVLMDHPYSPLSDIWSLGCVIFEMCSLHPPFQAKTYLE
                     LQKKIKAGKFEKIPEYYSDGLNLMVHSMVDVDLETRPSTFELLQDIQIRTARKSLQLE
                     RFERNLLDYENELVNIEKILERQAMEYEREYSQLKEQFVRAVEDRVSEVVNGKKIGKV
                     PESIHGYYNKRLPRPAYHWQTRYR"
     gene            complement(<485573..>486496)
                     /locus_tag="HG536_0G02800"
                     /db_xref="GeneID:59327660"
     mRNA            complement(<485573..>486496)
                     /locus_tag="HG536_0G02800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285197.1"
                     /db_xref="GeneID:59327660"
     CDS             complement(485573..486496)
                     /locus_tag="HG536_0G02800"
                     /inference="similar to AA sequence:RefSeq:NP_009409.1"
                     /note="ancestral locus Anc_3.179"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141093.1"
                     /db_xref="GeneID:59327660"
                     /translation="MGVTIAQTNLDGILPLIARGKVRDIYEVNSQTLLFVATDRMSAY
                     DVIMDNTIPDKGILLTKLSEFWFQFLSKDVRNHLVEIPAGKTIFDFLPKELSEAKYKE
                     QLAGRSLLVHKHKLIPLEVIVRGYITGSAWKEYTKSGTVHSLAQPEGLQESEEFPVAI
                     FTPSTKAEQGDHDENISPAQAEELVGKDLCKRVAELAINLYTKAREYAKTKGIIIADT
                     KFEFGIDEKTDEIILVDEVLTPDSSRFWSKATYQLGKSQDSYDKQFLRDWLTSNKLAG
                     VEGVKMPDDIVERTRAKYLEAFESLTGSKLQ"
     gene            <486960..>489017
                     /locus_tag="HG536_0G02810"
                     /db_xref="GeneID:59327661"
     mRNA            <486960..>489017
                     /locus_tag="HG536_0G02810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285198.1"
                     /db_xref="GeneID:59327661"
     CDS             486960..489017
                     /locus_tag="HG536_0G02810"
                     /inference="similar to AA sequence:RefSeq:NP_009408.3"
                     /note="ancestral locus Anc_3.180"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141094.1"
                     /db_xref="GeneID:59327661"
                     /translation="MINSGSKVGTTSIAAIMTSLSPPGQGLESGNLAMDAENHDLLRD
                     PNLVENYSDILEKKPNRFTNGGGGNGSETDNESESVSGSVVVTRNSANSSPLKNRASL
                     LSNTSSHYSVQLGKHGPLQEGELEKGEEQEQDVQEVEDEGEIRNGDSMKELELDSPND
                     SKDQTSIGSMDVDKSPTGDMAHEYEYSDSDFEESMEKRLHDMNNSTSLDKHDDRSESE
                     LEDPVLRLSLSEVEGSESDGELAEETRSLTLGSDGDSEADSELDEYQPLTPPKELDPE
                     KLYALYAFNGPDPSHCQLKQDESCTLLNDQDSYWWLVKRSQDSKIGFAPAEILETFPE
                     RLARLNCWKNENMSSSLDDSPKASDIKNCDELVNGKDKESSSLENYMKNSKSVSFNDV
                     VSYADRFIEANDDAEDYDTTHYDQFSEAKLKLTRFPDDEEMSEVVSDVSFNTAAMTPL
                     TVEKIRRPRAHPVEEAITTSTTMSSQNESDLRREANRAVREESDDLRKIFEAPIPPFS
                     KTQSSNGPNMQPSNSDYSISTIGDFSPSSSEWTNESPQLHDAQFNAGTDTAAIPPSRA
                     IQDFSKYVEEEQSDGEATSICKSVESNADLDKKASDTENLPENKHGSLVSTSFSSEQI
                     FLDSGRANSFTSINSATSLSRQHSSAQSCSTKRHPVIDRLYNPVFDKMDELMAQLDEV
                     ARE"
     gene            <490453..>491103
                     /locus_tag="HG536_0G02820"
                     /db_xref="GeneID:59327662"
     mRNA            <490453..>491103
                     /locus_tag="HG536_0G02820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285199.1"
                     /db_xref="GeneID:59327662"
     CDS             490453..491103
                     /locus_tag="HG536_0G02820"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141095.1"
                     /db_xref="GeneID:59327662"
                     /translation="MSSGLNSSNVASGVQSYKDFTSLNAFGTISLPNLTLDHTGMTPF
                     LKGGNNPRSSNRLQDDTPSQGQPGGIPLQANHLTDPLKSQPSSDDGDNRRTQDKDEDG
                     FQEDDDDINDSHGSYDDEDDGGRTDARRQGVSPHPNYETATVLTDNKGRHWGIKAFSN
                     KHLSSKNERVPCKDGDSDLSCRGNKPRKDDSKRNDASGVHDEDYRLPATWRSVWSA"
     gene            <492960..>495677
                     /locus_tag="HG536_0G02840"
                     /db_xref="GeneID:59327663"
     mRNA            <492960..>495677
                     /locus_tag="HG536_0G02840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285200.1"
                     /db_xref="GeneID:59327663"
     CDS             492960..495677
                     /locus_tag="HG536_0G02840"
                     /inference="similar to AA sequence:RefSeq:NP_009573.1"
                     /note="ancestral locus Anc_3.181"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141096.1"
                     /db_xref="GeneID:59327663"
                     /translation="MWVPDANSLLQLGMLLKSSMAQNHDERSQAMDALKSFELQPEFL
                     DYLCYMLIEGETNETLRSHFSAEDLQTNRATAGLLLKNNMLEQGSLIHGQHNLEYVKK
                     NIIHGLYNSNNVLVSNVTGIVITTLFSTYYRQHREDPMGIELLSQLLELAKKGNEASI
                     KALSKIMEDSAQFFQLKWSGDIKPIELLIDTFLNFASDPSSKTVIRAESIKCLNNIIP
                     LQSQSFLVRLDEFLAIIFKLAQIDESELTRGQICVAFSMLLESRPDKLIDHLPGIIKF
                     MLHLIGTVDDEKVAIEACEFLHGFATSSQIPEHIVQPYVNDIVPVLLAKMVYNEDSIL
                     MLEASNEEDAFEEDKDEDIKPVAPRIVKKRDGDDQSDDEDGDDEDVDTQWTLRKCSAS
                     TLDALTSILPRDVMTVAFPFLREHLTSDRWYIREATVLALGAMAEGGMKYFDDQLSTL
                     IPFLVQQLKDIWAPVRKIACWTLSRFSPWIMNDHTEFLIPVLEPIVNTLMDKKKDVQE
                     AAISSVAVFIENCDAELVETLLYNDLLNSFSKCFDFYKKKNLIILYDAVGRFAEKCEL
                     NDHAMQVLLPHLISKWSSLPDDDKELWPLLECLSYVATSLGEKFMPMAPDVYNRAYRI
                     LCQCVELETRSQHDPTVIVPEKDFVITSLDMIDGLVQGLGPRSQTLLFPQEGRDTTLL
                     QVLLRCLQDPVHEVRQSGFALLGDIAYYYEPRVLSNSLPEFLQLIGSEIMHNDDPDGI
                     PALINAIWCLGLIGERMNLSDYIIHFARILLDLFTNSAQQLDQAVKENLAVTIGRLAI
                     TTPEVFASGSFASDLVWRKWCLALQNLDSREEKSSAFMGFIKIINLCGNQVSVSEETL
                     KKIIECMSANVDTTAFSQDFYAFLVQYASKIQGIHLTSDALAFLQQFSN"
     gene            <496067..>497710
                     /locus_tag="HG536_0G02850"
                     /db_xref="GeneID:59327664"
     mRNA            <496067..>497710
                     /locus_tag="HG536_0G02850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285201.1"
                     /db_xref="GeneID:59327664"
     CDS             496067..497710
                     /locus_tag="HG536_0G02850"
                     /inference="similar to AA sequence:RefSeq:NP_012293.3"
                     /note="similar to Saccharomyces cerevisiae DAL1 (YIR027C)"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141097.1"
                     /db_xref="GeneID:59327664"
                     /translation="MTVIDFAENSIKAISSTRVVLEGAIKPATILYSSRSGKIIEIYV
                     DQVLDSVSHPLLRLYDVRVCENVSPKVILPGLVDSHVHLNEPGRTEWEGFATGTQAAC
                     SGGVTTVVDMPLNAIPPTTTIENFNIKLDAARDQLWCDVAFWGGMIPGNLDHLIPLVR
                     AGVRGFKGFLIDSGVDEFPAIDRAYIKKALSALKDCKTLLAFHAELQIDDNLHTIADS
                     EELKKIRSMDGKKGATKKQGDSLALSHVLSPAEPRAGIPSHLVHNDDVIESPLETAAV
                     LDKELSKVDPCLYSSFLLSRPDRFETDGISMILKCLKDIMKKNAGKVPPVHIVHLASM
                     DAIPIIRQAHKEGLPITAETCFHYLSLAAENIPKSATHFKCCPPIRTEVNRVALWNAV
                     RAGVITSVVSDHSPCTPELKSLAKGDFFSAWGGISSVGLGLSLLYTKSRSMKPVVSLT
                     EIVKWCCENTAEQVGLQHRKGFLRIGYDADIAVFDTDARQRIDNSSVYYKNKLTAYHG
                     LTLDGVVMKTIVRGKVAFSYGKGPSNAPHGQTLLEPRFA"
     gene            complement(<497733..>498407)
                     /locus_tag="HG536_0G02860"
                     /db_xref="GeneID:59327665"
     mRNA            complement(<497733..>498407)
                     /locus_tag="HG536_0G02860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285202.1"
                     /db_xref="GeneID:59327665"
     CDS             complement(497733..498407)
                     /locus_tag="HG536_0G02860"
                     /inference="similar to AA sequence:RefSeq:NP_010266.1"
                     /note="ancestral locus Anc_3.182"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141098.1"
                     /db_xref="GeneID:59327665"
                     /translation="MIYRSLIVPTLLYFCSLVFGSPITFELRKGQRECFYTLTPDVSC
                     TISYYFAVQEGDANDFQVNYEIFGPADKYTPLLKRTKERQGEWSFYAEHRGEYAFCFE
                     GGEEHNKIVDLDIEYKCVRQDNDRSERRKARKEQRKLKDASAIQLQESLEDSVDNIER
                     KLYLLERNMQYYKTRNNRNHYTVRSTSRRVALFSIYGILLVVGMSCAQVFMLQWFFRI
                     SRKQAV"
     gene            <499380..>500885
                     /locus_tag="HG536_0G02870"
                     /db_xref="GeneID:59327666"
     mRNA            <499380..>500885
                     /locus_tag="HG536_0G02870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285203.1"
                     /db_xref="GeneID:59327666"
     CDS             499380..500885
                     /locus_tag="HG536_0G02870"
                     /inference="similar to AA sequence:RefSeq:NP_010267.3"
                     /note="ancestral locus Anc_3.183"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141099.1"
                     /db_xref="GeneID:59327666"
                     /translation="MEGNANSAATEEVPGEIKDEMSRLYREIPNLSDDYEVIDKIGEG
                     TFSSVYKARDLKGKICHKFSSHFWSKDSHYVALKKIYVTSSPQRIYNELNLLYMLTGC
                     TRVGPLCDATRVRDQVIAVLPYYPHEEFRNFYRDLPIKGIKMYLWELLQALSFVHSKG
                     IIHRDVKPTNFLYNPELGRGVLVDFGLAELQMDYSGEMLEKDASLPLKDRRTYDQFCP
                     CIMRDTNISPHHRATTPMVTIQNGKVVYLNNVTGVDLTKGYPKNETRRIKRANRAGTR
                     GFRAPEVLMKCGSQTTKIDIWSVGVILSSLLTRRFPMFQSLDDTDSLLELCAIFGWKK
                     IKKCAAIHGLGFEVNGLKHIKESGVAGGLKGFVYELLDAECQTGTFPDYSIAFETYEY
                     LSQELHNKRCIEPRLPDSEGTSDGPEAYELKRYQEEIWSDHYWCFQLLEQCFELDPQK
                     RSSPNELLRSAFFNELNESGVYTEIESTEEDDSAGSDGFLAEENDVVLISG"
     gene            complement(<500986..>501921)
                     /locus_tag="HG536_0G02880"
                     /db_xref="GeneID:59327667"
     mRNA            complement(<500986..>501921)
                     /locus_tag="HG536_0G02880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285204.1"
                     /db_xref="GeneID:59327667"
     CDS             complement(500986..501921)
                     /locus_tag="HG536_0G02880"
                     /inference="similar to AA sequence:RefSeq:NP_010269.1"
                     /note="ancestral locus Anc_3.184"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141100.1"
                     /db_xref="GeneID:59327667"
                     /translation="MPIVIKSRSKSLKDTRLENVDGLALQPVLNDISKNNRSLNTNRL
                     RLTYVKEGKQVPITSDAFFKEGTNLEDTELYVKDLGPQVSWRLVFVVEYLGPILVHSL
                     VYLLSKNPTLVEKYHSRSKPYNPFMNKLAYSLIMAHYLKREFETLFVHQFSQSTMPLF
                     NIFKNSFHYWVLNGAIAFGYFGYGFIFDDSKLFQAYSALRLNNLGSLVALFTLAESWV
                     FYVHIKLRLWGEAQKKKGNTTKRVPINSGMFSLLVAPNYTFESWAWIFFSLIFKLNLF
                     SLIFTAVSMTQMYLWAQKKNKKYGTKRAFLIPYVF"
     gene            <502299..>503270
                     /locus_tag="HG536_0G02890"
                     /db_xref="GeneID:59327668"
     mRNA            <502299..>503270
                     /locus_tag="HG536_0G02890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285205.1"
                     /db_xref="GeneID:59327668"
     CDS             502299..503270
                     /locus_tag="HG536_0G02890"
                     /inference="similar to AA sequence:RefSeq:NP_010270.1"
                     /note="ancestral locus Anc_3.185"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141101.1"
                     /db_xref="GeneID:59327668"
                     /translation="MSFRPGSRGGARGGRGGFGGRGGARGGARGGFGGGFGGRGGARG
                     GARGGRGAPRGGPRGGARGGRGGPRGGARGGAKGGAKVVLEPHKHAGVYIARGKEDLL
                     VTKNMAPGESVYGEKRISIEEPSKEDGVPPTKVEYRVWNPFRSKLAAGIMGGLDELFI
                     APGKKVLYLGAASGTSVSHVSDVVGPEGVVYAVEFSHRPGRELISMAKKRPNVIPIIE
                     DARHPQKYRMLIGMVDCVFADVAQPDQARIIALNSHMFLKDQGGVVISIKANCIDSTV
                     DAETVFAREVQKLREERIKPLEQLTLEPYERDHCIVIGRYMRSGVKK"
     gene            <503616..>505406
                     /locus_tag="HG536_0G02900"
                     /db_xref="GeneID:59327669"
     mRNA            <503616..>505406
                     /locus_tag="HG536_0G02900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285206.1"
                     /db_xref="GeneID:59327669"
     CDS             503616..505406
                     /locus_tag="HG536_0G02900"
                     /inference="similar to AA sequence:RefSeq:NP_010271.3"
                     /note="ancestral locus Anc_3.186"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141102.1"
                     /db_xref="GeneID:59327669"
                     /translation="MTERGDVTPDEPAVGNRNIGRSVILIESDSDDDGLTNNERRSRN
                     LAVSGPGVLNEVDGHGALGGNEEDGDDDLSIFRETGRQADSDTHLDAGTEYIDLERES
                     VSGENDRNSQLRMMAYDEGHSTPAADSGEGGRDDGLMIVQERRAAPAIRLSVPGRGFM
                     EISASPYDRPVRRSFERQEHYRQLRHPGRRRLRRAAERTGQSRRQIPEDDAEDDDYRP
                     ASVGRLPTRLIRRRRQEFFRPQQGPYGGGDSILAELRARIDSFSPDIRSAFTHAQTVS
                     EFRCILQSVDPLMWQECNGELEQLYNAYRARMSIVAADQASRVPRGSSQSENRSFQYV
                     GRVGPLGLHVDISGGLGESLTNYLLENEPGRYAMMAYPGAVFDEMDEEARTQSIVNAI
                     QEREERERDIRVKNFSEKSRPQEEKFLQKCRGLPQGYSASFNTKIPPTMEVTEDGKER
                     TMMVDDRIRDEWEEVAVCCLCGVELGVGIPDDFEGMTKEDRGATFQSLTAKYEFHCPY
                     QSLTRPTKVDRDLSRKTFVAPCGHTYCGRCVVRIRNAGSRCSKKDSKKKYAGLKGSSH
                     PDNYGPKTCPATHCKQPIRSPKAKMREAFL"
     gene            complement(<505505..>505933)
                     /locus_tag="HG536_0G02910"
                     /db_xref="GeneID:59327670"
     mRNA            complement(join(<505505..505819,505889..>505933))
                     /locus_tag="HG536_0G02910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285207.1"
                     /db_xref="GeneID:59327670"
     CDS             complement(join(505505..505819,505889..505933))
                     /locus_tag="HG536_0G02910"
                     /inference="similar to AA sequence:RefSeq:NP_010272.1"
                     /note="ancestral locus Anc_3.187"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141103.1"
                     /db_xref="GeneID:59327670"
                     /translation="MSANEYYSQSEKKETFARPGAPPPGAPPPGQGSSNERGVFSHPQ
                     QHQPQQQQYYQQGQYQQYPQPPYQQQQHPQYYQQQPPHQQQPIYVQQQPPRSGNEDCL
                     TACLMAMCICCTLDLLF"
     gene            <506519..>508297
                     /locus_tag="HG536_0G02920"
                     /db_xref="GeneID:59327671"
     mRNA            <506519..>508297
                     /locus_tag="HG536_0G02920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285208.1"
                     /db_xref="GeneID:59327671"
     CDS             506519..508297
                     /locus_tag="HG536_0G02920"
                     /inference="similar to AA sequence:RefSeq:NP_009571.1"
                     /note="ancestral locus Anc_3.188"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141104.1"
                     /db_xref="GeneID:59327671"
                     /translation="MVLVPRRYAKALKLTAILILFCVLLVVSNKFMDRSLSVSEYREY
                     LKTYLEIAQNGKPMEAPSLDQTGRTTHDGNGRLKKFYGQVFELLKEYSPSGKSAREYS
                     KRCKLEGDIGFRPENYKDWYKLTGEELSSCLLMSGSEVEKLKKSHAGYVEALDGFVLP
                     KASYKGRGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGEAELCNVVLPR
                     YNAKCIFLSDILPESSLENFEFTGYQFKSLALIASSFEDVLFLDADNFPVKPLDHIFD
                     EEPYASTGFVLWPDFWRRTTQPVYYDIAGIEVDKRKRSRNCFDDLTPPEVYTPNMNDL
                     SQVPFHDLEGAIPDVSTESGQLMISKSRHLGTILLALYYNVNGPSWYYPMFSQRAAGE
                     GDKETFLTAASFYGLSFYQVKSATGVEGYHRPDGEGFRGVAMLQHDLNQDYARYKAAA
                     KAIAAKYQSNTAIEFDKSYSLQEFYNTYFGASEPKYPNEVDVMFAHSNTPKFDPYMLW
                     KNQDLIYQKKHIRSYTALSKINYYDLELENFRAMNQYLCVKRTSFKYLDEKVNGPEEW
                     ASMCEYIKDRLTFLEATHTQAVSPSN"
     gene            <508531..>509253
                     /locus_tag="HG536_0G02930"
                     /db_xref="GeneID:59327672"
     mRNA            <508531..>509253
                     /locus_tag="HG536_0G02930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285209.1"
                     /db_xref="GeneID:59327672"
     CDS             508531..509253
                     /locus_tag="HG536_0G02930"
                     /inference="similar to AA sequence:RefSeq:NP_009570.1"
                     /note="ancestral locus Anc_3.189"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141105.1"
                     /db_xref="GeneID:59327672"
                     /translation="MAVSLGKRNLRVLSVTALLLLLVFFVVQNANSITFGEEQANIPT
                     SGDKAGLTSAGTAVHNSGELEVNAETKNKGEESTKVNAEIAKIKQEVKNGASSPEDDS
                     ISRKGAKGSDASGNGANAEFDPAKEYTMILGHSPVIIFSKSYCPYSTRLKELLKQGYR
                     FTPNYVVIELDMHNKGAALQKYIEKQTGRGTVPNLIINGKSRGGSDDIRALHNSGELL
                     ANLVEWSEGSYTVEKIEKPSNN"
     gene            complement(509453..509525)
                     /locus_tag="HG536_0Gtrna9T"
                     /db_xref="GeneID:59327901"
     tRNA            complement(509453..509525)
                     /locus_tag="HG536_0Gtrna9T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACU"
                     /db_xref="GeneID:59327901"
     gene            <510139..>511002
                     /locus_tag="HG536_0G02940"
                     /db_xref="GeneID:59327673"
     mRNA            <510139..>511002
                     /locus_tag="HG536_0G02940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285210.1"
                     /db_xref="GeneID:59327673"
     CDS             510139..511002
                     /locus_tag="HG536_0G02940"
                     /inference="similar to AA sequence:RefSeq:NP_009565.1"
                     /note="ancestral locus Anc_3.191"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141106.1"
                     /db_xref="GeneID:59327673"
                     /translation="MAYTTRQIGAKNTLDYKVYIENDGKPVSPFHDIPLYADEEKQIF
                     NMVVEIPRWTNAKLEITPEADLNPIVQDTKKGKLRYVRNCFPHHGYIHNYGAFPQTWE
                     DPNHVHPETKAAGDNDPVDVLEIGETIGYTGQVKQVKVLGIMALLDEGETDWKVITID
                     VNDPLAPKLNDIEDVEKYFPGLLRATNEWFRIYKIPDGKPENQFAFSGEAKNKKYALD
                     IIRETHESWKQLISGKAANNKGIALSNSTVTDSPGYSASAASAVPPASPQPDAPIDKS
                     VDKWFFISGSA"
     gene            complement(<511072..>511719)
                     /locus_tag="HG536_0G02950"
                     /db_xref="GeneID:59327674"
     mRNA            complement(<511072..>511719)
                     /locus_tag="HG536_0G02950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285211.1"
                     /db_xref="GeneID:59327674"
     CDS             complement(511072..511719)
                     /locus_tag="HG536_0G02950"
                     /inference="similar to AA sequence:RefSeq:NP_010290.3"
                     /note="ancestral locus Anc_3.192"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141107.1"
                     /db_xref="GeneID:59327674"
                     /translation="MWSDRPIVKVCGLQSVEAAQKAIQCGASLIGIICVPNRKRTIEP
                     GVARQISALVHDKSFNKSGTKLVGVFRNQLVEEVTKIANDYNLDVLQLHGDESWAEFQ
                     SSVEKPIIKRMLFPQDCGEVAEITRSGNTNVLPLFDSEAGGTGELLDWQAITKWSESD
                     GAGSRFLLAGGVTPSNVHEAMSLTGVIGVDVSGGVETNGSKDLQKIEQFIANARR"
     gene            complement(<511985..>512395)
                     /locus_tag="HG536_0G02960"
                     /db_xref="GeneID:59327675"
     mRNA            complement(<511985..>512395)
                     /locus_tag="HG536_0G02960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285212.1"
                     /db_xref="GeneID:59327675"
     CDS             complement(511985..512395)
                     /locus_tag="HG536_0G02960"
                     /inference="similar to AA sequence:RefSeq:NP_009564.1"
                     /note="ancestral locus Anc_3.193"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141108.1"
                     /db_xref="GeneID:59327675"
                     /translation="MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKP
                     GTVALREIRRFQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAIGALQESVEAYLV
                     SLFEDTNLAAIHAKRVTIQKKDIKLARRLRGERS"
     gene            <512896..>513207
                     /locus_tag="HG536_0G02970"
                     /db_xref="GeneID:59327676"
     mRNA            <512896..>513207
                     /locus_tag="HG536_0G02970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285213.1"
                     /db_xref="GeneID:59327676"
     CDS             512896..513207
                     /locus_tag="HG536_0G02970"
                     /inference="similar to AA sequence:RefSeq:NP_009563.1"
                     /note="ancestral locus Anc_3.194"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141109.1"
                     /db_xref="GeneID:59327676"
                     /translation="MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGV
                     KRISGLIYEEVRAVLKTFLESVIRDAVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFG
                     G"
     gene            <514237..>517071
                     /locus_tag="HG536_0G02980"
                     /db_xref="GeneID:59327677"
     mRNA            <514237..>517071
                     /locus_tag="HG536_0G02980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285214.1"
                     /db_xref="GeneID:59327677"
     CDS             514237..517071
                     /locus_tag="HG536_0G02980"
                     /inference="similar to AA sequence:RefSeq:NP_010289.3"
                     /note="ancestral locus Anc_3.195"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141110.1"
                     /db_xref="GeneID:59327677"
                     /translation="MEQPRTHTSAATAASTSPTAAKATTVNSDSPPGSSSSSSSGTGA
                     TQTVTTSSSSRKSVPLPSSASMTKFHAEDEDIGLEGKGTNSVSEMRRPSRATRLRHHE
                     EEEEEEEEETMMDINDNDENNANIAMEGMLRKDYIEAPSAISVAGGTVTPHDSQYMNA
                     DNDNDNEPTLFKQFDAKTGQFLRGEGGSRVLRSLKSTEQAFTNALRQQPFRINPSQTF
                     DAASLKILVKGKFRSHSVPTISHSSLKRLANCNNHAHYHYHHQHPSMANEAGVKKKKI
                     SKNANVFHSGAVGQANLLTNKTGANDTRKENVVISAAEPERTPLFASLAPEVRDEASA
                     ATATTRSNPSLRKAILLCHQAPSSMPKYQDLTLDERAEYIKTATSPAPLPPINLQCLK
                     EIDLQEIVKNPQLRHDIVFDPLLQFRPNLDGERGIKKRQLADKYWNDVENEIYVYSQK
                     PKLFNYNTTRLVPLFNTLREVLLTVVPQREAHMINNVLDTELNVQELLKGSLIMTSLS
                     EWLAQLFKHHCAPMRDSWVDKMSAKFREAENESALPKLIDGLRLVFQILEAMKLDIAN
                     HQIRILRTALLSNSVEFEKQYFQSLMTSNKINLKSSLAWFNKKFDESDSHDLFPKGKL
                     SPQDIYKLCVRSIISLLSCRKMVREYPTSLSFDHARLILLRADIRQIVCLLICRLLFK
                     QLVTNDTSIDKETRNYITSSYTTKRLKKEIVSIITDDHGNCRWTKNTMSIAIHLCKVI
                     SDLKGEYLKSRDLQDESVAGLTTTPTLDTAKIDFAKSWLSRQTQPLSEVYGVLENRVF
                     KSLEESIIKRSGCTVDGRVKQDFIYLCSNVSGEGAADSVNCITGTSTAGADVMTPPGE
                     GIKSLVGLQAKSMKNAQGPPPAIIRSQTPNSSLMSSDDDNRVFHGVEMDEFDNVYRHL
                     YTVINFHWSVFGCHYLECVSDKMVNRASLV"
     gene            <517607..>519700
                     /locus_tag="HG536_0G02990"
                     /db_xref="GeneID:59327678"
     mRNA            <517607..>519700
                     /locus_tag="HG536_0G02990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285215.1"
                     /db_xref="GeneID:59327678"
     CDS             517607..519700
                     /locus_tag="HG536_0G02990"
                     /inference="similar to AA sequence:RefSeq:NP_009561.2"
                     /note="ancestral locus Anc_3.196"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141111.1"
                     /db_xref="GeneID:59327678"
                     /translation="MNMNADWGRPSPLDVLRDQSGYFPDLSRYDDAQSLCTYQEEYEH
                     KSNVTRNQSMLSFETVQTNQRLLDKLDLSVEDEALLHQALREEEENSRIQELREQQNG
                     PIICMPASKFPSLRMKGVISSKDPASNMKKRVIPGLSLKGHISSSAVEQHYVAQSRFS
                     YLAEEDSDTELGTEAFAALSLSGNERGREWHPKIVNFESYRIENSNLLNRYPQFFSDE
                     RLEGQYDSQPLVSSSEPFAQSNYIVSPSADRLYQSGSGNSTKTSFVEPGQLSKPKTQS
                     SMESNSSFISHARTKEKSQDIRNDTPTKSISSPSIDLVFFKEVSKEPPPSYKAHKKKS
                     SFSLRNLFKSPISSKSRGSLDTREGADEINSPQSSDEGSPKKRSQQLRKFILPANPVL
                     QFEPQTPKTPQTPPSSSKQIKRKAHHFRSLSDFHKVPSPVSRLEIHSTDKFDSCRNSP
                     LVKSRPRRKLSLDSRTPAVPVSSFNTRPHSSQQSRNHLQFYGHRVDGCSHDIKFQHDF
                     KQSSDSQIRAAIEMRNGGQLEESASRLRKACQAHDKTAFLLYGLALRYGSGVPRDYKE
                     SFRHIKAAAGVSSEAEDIFKCDINPFQLESSGNIPKVAPEPIAPALYECGIAYLKGYG
                     PDHPNELHGLKYLEKAASLGHIDSMCLSATIWSKKSATRKKDIARAACWFRLAEKRGA
                     NLIGSQWIHKEKYKS"
     gene            <520004..>521194
                     /locus_tag="HG536_0G03000"
                     /db_xref="GeneID:59327679"
     mRNA            join(<520004..520009,520094..>521194)
                     /locus_tag="HG536_0G03000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285216.1"
                     /db_xref="GeneID:59327679"
     CDS             join(520004..520009,520094..521194)
                     /locus_tag="HG536_0G03000"
                     /inference="similar to AA sequence:RefSeq:NP_010288.1"
                     /note="ancestral locus Anc_3.197"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141112.1"
                     /db_xref="GeneID:59327679"
                     /translation="MKFIDELDVERVNQTLNFETNDCKILGACDIFTTKPVASDKKLY
                     KTIDHHLESLLQENEGYNAALQQQAILDSNGSLSGTLSDNHSNDFNSFWEQKRRMSVS
                     ENQGNSGPNNSLNGVAFKSNKLNDQNLKELVHHGDSGYLSSSSTESSSRVKGKIRRTS
                     SANSFQGSRSSLGRRRSSAYESNINIGPFGPINETASRRTFAYLIAILNASYPDHDFS
                     SLEPTDFIKVSLKSMISKFENSLYSLGKQPEAWMWEVINSHMDMSDCVIYQYSPAKSF
                     MDDEPGHLWSLKWFLFNKKRKRVAYLYLTCLRLKRSSSDSINDDEDKDAPQAKNKRRF
                     TIEDDISRFEGEYDLTYDENAIEDDEDHVIESEK"
     gene            complement(<521458..>522840)
                     /locus_tag="HG536_0G03010"
                     /db_xref="GeneID:59327680"
     mRNA            complement(<521458..>522840)
                     /locus_tag="HG536_0G03010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285217.1"
                     /db_xref="GeneID:59327680"
     CDS             complement(521458..522840)
                     /locus_tag="HG536_0G03010"
                     /inference="similar to AA sequence:RefSeq:NP_010287.1"
                     /note="ancestral locus Anc_3.198"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141113.1"
                     /db_xref="GeneID:59327680"
                     /translation="MDLYDELPQSELLHFEEFTALLEASRQHQVSVLEFLTVGARELA
                     RLLQRSINEVIKFQGLLSADFEKQLLASRPKLVKQCREPKPFSSADVGIDRVLGGGIY
                     THGITEIYGESSTGKSQLLLQLSLAVQLPCAMGGLEGKCVYITTEGDLPTQRLQDMIA
                     SRQEFKENGVTQDNIFTVSCNDLISQEHILDVQLPILLEQNKDTIKLIIIDSISHHIR
                     VELRSNSFRESQDNKFYIDRLAERLLEMANKHSLAIVVANQVGDKPLPDRASLAPQQV
                     EDYEYQVGWMVGWKDSTILFRQKFNDPRTGFSTSAVANNHFDNILSDDEDAHLIEHEW
                     NKVLSSIKNGNDAQDQAHKRKLPDNAINKEPPKETNRFKRRKRKIDQHVPNLGLTWAN
                     HISTRILLRKVYKASQLIKRGELHLYKGSDPSAFWQVRRTIKVVFSAYAEQDQTSFAI
                     SRRGVETLTA"
     gene            complement(<523001..>524494)
                     /locus_tag="HG536_0G03020"
                     /db_xref="GeneID:59327681"
     mRNA            complement(<523001..>524494)
                     /locus_tag="HG536_0G03020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285218.1"
                     /db_xref="GeneID:59327681"
     CDS             complement(523001..524494)
                     /locus_tag="HG536_0G03020"
                     /inference="similar to AA sequence:RefSeq:NP_009560.1"
                     /note="ancestral locus Anc_3.199"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141114.1"
                     /db_xref="GeneID:59327681"
                     /translation="MAAKETPSPVLKNKDLLRDAAFINGRWIKEASEYFEVTDPASGK
                     VIAKLPDQPISAVEEAIDVANNAFKTFKNTTPRQRSAWLRNLFNLMNENQEDLAKILT
                     WENGKALSEARGEIKYAASYFEWFAEEAVRSYGVTIQPGNCSNRAYTIRQPVGVCGMI
                     CPWNFPSAMITRKVAPAFAAGCTIVLKPDSQTPLSALALAYLVEKAGFPRGCFNLVLS
                     HTRTPEFGLKLCESPKVKKITFTGSTNVGKILMEQSASTMKKLSLELGGNAPFIVFED
                     ADIDEAVEQALACKFRGLGQTCVCANRFYVQSSIIEEFSEKLAGKVKKFIIGPGLQEE
                     TTHGCLINQKAIKKVDEHAQDAIEKGAEVVLKGGPLPEIGETFYSPVILTKVPHSAKV
                     SKEETFGPLCAIFSFDTLEEVIGYANDTNVGLASYVFSKNVDKIYTVAEALETGMVSC
                     NTGIFSDVAIPFGGVKESGFGREGSLYGLEDYTIIKTVTIGNLPNRI"
     gene            complement(<525010..>525678)
                     /locus_tag="HG536_0G03030"
                     /db_xref="GeneID:59327682"
     mRNA            complement(<525010..>525678)
                     /locus_tag="HG536_0G03030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285219.1"
                     /db_xref="GeneID:59327682"
     CDS             complement(525010..525678)
                     /locus_tag="HG536_0G03030"
                     /inference="similar to AA sequence:RefSeq:NP_009559.1"
                     /note="ancestral locus Anc_3.200"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141115.1"
                     /db_xref="GeneID:59327682"
                     /translation="MSPIIRTNRYRQLYERTVVVTDNFDSSSGWIWGRWILFVIFVIC
                     IIAVGLGTARINRRRRTMGQAPILGTAWMTPPSYRQSQRHYNGPVEGSEDYVPQYTAT
                     ANDQDLGYYDEHGEFHLNSKAEAQAPPAMTGETVSDSSESLERPRAAVTRDSYSSDLD
                     QDFRRYVPPPPSDPPMAQPNMPGGFEDNAADTERSGIQVGNSDSVALQEISPPEKVKS
                     SRGL"
     gene            <525951..>527231
                     /locus_tag="HG536_0G03040"
                     /db_xref="GeneID:59327683"
     mRNA            <525951..>527231
                     /locus_tag="HG536_0G03040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285220.1"
                     /db_xref="GeneID:59327683"
     CDS             525951..527231
                     /locus_tag="HG536_0G03040"
                     /inference="similar to AA sequence:RefSeq:NP_009558.2"
                     /note="ancestral locus Anc_3.201"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141116.1"
                     /db_xref="GeneID:59327683"
                     /translation="MILGITLTFIVSRLILYGLIFVAPTGQFDTSTELTLKKLQALGT
                     DDYWNVHLWNKLLSWDAVFFLKGMTSKGKIPRFEHELAFSTLWSSMVKYFAKTDDVYQ
                     TLKVAVLLENILFYSSSVVLYYLTRAIFSENNKKQYYGKRLAKISTNLFIFTSASGFL
                     TGIYSEPLSFALTFVGILLHEKSTSTTIPNGIDCNWSRWPFYFLSAIFFAVATINRAN
                     CVLLGIYYIVDLLQLVSHRRMLKALFFPLLAGTTMLIVCLYQHYSLPYQAFCPQRGEW
                     CTTQMFDGLPFTKTNFYGFIQSRYWNCGFLRYWTLNNIPNFLIAMPNFVVMFYSTIYF
                     TRIYPSFRVRPLVFVTQAFLIMIALFAHVQIINRVSSFIPLHLWYLADRLLRNSFREQ
                     HPVGDDKIVKGYIYWLAFWIPIQTVLFACFLPPA"
     gene            complement(<527412..>528821)
                     /locus_tag="HG536_0G03050"
                     /db_xref="GeneID:59327684"
     mRNA            complement(<527412..>528821)
                     /locus_tag="HG536_0G03050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285221.1"
                     /db_xref="GeneID:59327684"
     CDS             complement(527412..528821)
                     /locus_tag="HG536_0G03050"
                     /inference="similar to AA sequence:RefSeq:NP_009557.1"
                     /note="ancestral locus Anc_3.202"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141117.1"
                     /db_xref="GeneID:59327684"
                     /translation="MFKGGLYCKRNAYRLCRHKSSFATALAAASRLVTPKIMLSNPVS
                     LVSNEMNTLAKNIMALIGSGHPTLNRVTSYYFEAEGKKVRPLLVLLLSRALAAIPLNQ
                     RDHVKVDSEDVPEDPVYSKPPHMLLFEQPVRNFSPLHVLHGIKPLNPLTKGPEPLPQA
                     TFDQERGILPKQRRLAEIVEMIHTASLLHDDVIDHSDTRRGRPSGNIAFTNKMAVLGG
                     DFLLGRATVSISRLRNPEVVELMSNSIANLVEGEFMQLKNTAVDGDPTTIQFGKKELP
                     PLSGKLDNKVHEYHVPVKYEANITHDQMIETAFEYYLHKSYLKTAALISKSSRAAAIL
                     SGARENVIDQCYEFGKNLGICFQLVDDMLDFTVAGKDLGKPAGADLKLGIATAPVLYA
                     WKEDPSLGPLIRRNFSQPGDVERAAGAVAKYDSVSKTRSLAQDYRDKALSNLRAALPE
                     SDARSALEFLTNSILTRRK"
     gene            <529110..>529961
                     /locus_tag="HG536_0G03060"
                     /db_xref="GeneID:59327685"
     mRNA            <529110..>529961
                     /locus_tag="HG536_0G03060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285222.1"
                     /db_xref="GeneID:59327685"
     CDS             529110..529961
                     /locus_tag="HG536_0G03060"
                     /inference="similar to AA sequence:RefSeq:NP_009556.1"
                     /note="ancestral locus Anc_3.203"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141118.1"
                     /db_xref="GeneID:59327685"
                     /translation="MEANTMIPGFSIASEWIKNIFSRTIRSSNCVPKHVGFVMDGNRR
                     YARKNDIEIKEGHEAGFLSMSQVLELCYEAGVNTATVFAFSIENFKRSPSEVDHLMRL
                     AREKIRQIAEHGELAERYGVRVKVIGDLTRLPKSVYEDVIETTEMTKNNTRATLNICF
                     PYTSREEMLHSIRTLVEGDIKSDDINEASLEKNLYTGGDPPLELLVRTSGVTRLSDFL
                     LWQVSQKGVVIELFDCLWPEFGPLRMAWVLLKFAFRKSFSDKEHQLEDDDGPLESQDD
                     ALNKKTL"
     gene            complement(<530089..>530718)
                     /locus_tag="HG536_0G03070"
                     /db_xref="GeneID:59327686"
     mRNA            complement(<530089..>530718)
                     /locus_tag="HG536_0G03070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285223.1"
                     /db_xref="GeneID:59327686"
     CDS             complement(530089..530718)
                     /locus_tag="HG536_0G03070"
                     /inference="similar to AA sequence:RefSeq:NP_010285.1"
                     /note="ancestral locus Anc_3.204"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141119.1"
                     /db_xref="GeneID:59327686"
                     /translation="MSETGDSKPLEAPKAAEATSKPPTASVFSMFGGKKSDAPKKEPE
                     EKEGAESKSEKKADANDEDESPESPDVHFEPIVHLEKVDVKTMEEDEEVLYKVRAKLF
                     RFDAEAKEWKERGTGDVKFLKSKTSGKVRLLMRRDKTLKVCANHIVAPEYVLKPNVGS
                     DRSWVYACTVDVSDGEPEAFTFAIRFGSKENADKFKEEFEKAQEMNKKA"
     gene            <532168..>534684
                     /locus_tag="HG536_0G03080"
                     /db_xref="GeneID:59327687"
     mRNA            <532168..>534684
                     /locus_tag="HG536_0G03080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285224.1"
                     /db_xref="GeneID:59327687"
     CDS             532168..534684
                     /locus_tag="HG536_0G03080"
                     /inference="similar to AA sequence:RefSeq:NP_009555.1"
                     /note="ancestral locus Anc_3.205"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141120.1"
                     /db_xref="GeneID:59327687"
                     /translation="MVDLTTRPPTSPPDSKPVSARPRRSSSQTSPVDPPFLVLRPPKG
                     SQGSAFDYASSPNGGHRRTSSQTSPHDTSEPLSFRNYRRRTSSQSSHSSLDGKEQNSS
                     QRPRRMSSLKDFFDPFSTAEIYYGPSTDPRKQKTSHKLNRTRTMSVFGNTSDSKRFNQ
                     SQYHLQRRGSEDDSYLSSKGNRRFFIEDVDRTLDELLKSEDTDSNFQITIEDTGPKVI
                     KVGTANSNGYKYVNVRGTYMLSNLLQELTIAKSFGRHQIILDEARINENPVNRLARLI
                     ATQFWNNLTRRIDLNNIGEIARDSKVDTPGAQNPRVYVPYNCPDQYEFYIQASQMHPS
                     LKLEVEYLPKNITPEYVKSINETPGLLALAMEEHVNPSTGEKTLIGYPYAVPGGRFNE
                     LYGWDSYMMALGLLENNNIDVARGMVEHFIFEIEHYGKILNANRSYYLCRSQPPFLTD
                     MALQIYRKTGGDNNPNAVDLVKRAFVAAIKEYKTVWMASPRLDPETGLSCYHPNGLGV
                     PPETEADHFDSILVFYMKKYNLSREGFIEKYNNGEIQEPALDEFFLHDRGVRESGHDT
                     TYRFEGVCAYLATIDLNSLLYKYERDIADVIEKFFDNEYHDPLDDSVTDAQHWRDLAE
                     KRKNNITKYMWDEETGFFFDYNVAAKQRTSYESATTFWALWAGLATEEQAKIMVEKAL
                     PPLEMLGGVVACTERSRGPLSIQRPSRQWDYPYGWAPHQILAWQGLCEYGYVAVATRL
                     AYRWLYIMTKAFVDYNGIVVEKYDVTRGTDPHRVDAEYGNQGADFKGVATEGFGWVNA
                     SYVLGLKYMNSHARRALGACIPPVPFFQSLKASERKLYSV"
     gene            <535616..>535936
                     /locus_tag="HG536_0G03090"
                     /db_xref="GeneID:59327688"
     mRNA            <535616..>535936
                     /locus_tag="HG536_0G03090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285225.1"
                     /db_xref="GeneID:59327688"
     CDS             535616..535936
                     /locus_tag="HG536_0G03090"
                     /inference="similar to AA sequence:RefSeq:NP_009554.1"
                     /note="ancestral locus Anc_3.206"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141121.1"
                     /db_xref="GeneID:59327688"
                     /translation="MPKIYCLVDVCMVPIGTASASVSDFVTLIERKIRESPLKSTLHS
                     AGTTIEGPWDDVFTLLGEIHEFAHESGYVRIQTSMRVGTRTDKHQTAADKVETVLKKL
                     GESQ"
     gene            complement(<536216..>536614)
                     /locus_tag="HG536_0G03100"
                     /db_xref="GeneID:59327689"
     mRNA            complement(<536216..>536614)
                     /locus_tag="HG536_0G03100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285226.1"
                     /db_xref="GeneID:59327689"
     CDS             complement(536216..536614)
                     /locus_tag="HG536_0G03100"
                     /inference="similar to AA sequence:RefSeq:NP_009553.1"
                     /note="ancestral locus Anc_3.207"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141122.1"
                     /db_xref="GeneID:59327689"
                     /translation="MSAKAEKKPASKAPAEKKPAAKKTAPSTEAKKKVRVRKETYSSY
                     IYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAV
                     RLILPGELAKHAVSEGTRAVTKYSSASSQA"
     gene            <537130..>537528
                     /locus_tag="HG536_0G03110"
                     /db_xref="GeneID:59327690"
     mRNA            <537130..>537528
                     /locus_tag="HG536_0G03110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285227.1"
                     /db_xref="GeneID:59327690"
     CDS             537130..537528
                     /locus_tag="HG536_0G03110"
                     /inference="similar to AA sequence:RefSeq:NP_009552.1"
                     /note="ancestral locus Anc_3.208"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141123.1"
                     /db_xref="GeneID:59327690"
                     /translation="MSGGKGGKAGSAAKASQSRSAKAGLTFPVGRVHRLLRRGNYAQR
                     IGSGAPVYLTAVLEYLAAEILELAGNAARDNKKTRIIPRHLQLAIRNDDELNKLLGNV
                     TIAQGGVLPNIHQNLLPKKSAKPGQASQEL"
     gene            complement(<537689..>538999)
                     /locus_tag="HG536_0G03120"
                     /db_xref="GeneID:59327691"
     mRNA            complement(<537689..>538999)
                     /locus_tag="HG536_0G03120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285228.1"
                     /db_xref="GeneID:59327691"
     CDS             complement(537689..538999)
                     /locus_tag="HG536_0G03120"
                     /inference="similar to AA sequence:RefSeq:NP_010283.3"
                     /note="ancestral locus Anc_3.209"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141124.1"
                     /db_xref="GeneID:59327691"
                     /translation="MNAASGKEEQRPLLDQHSSVKQSTKGPQKYSPRQESEQAPSKSM
                     ERHTENAEQSRGKLGHMVAPAPGKQMRTGAQRTSRTAQKLKLLPEEPFQRDDERQELR
                     DRDVYSQVNRITDKPARRDAEKLGKGHRHLLPRATAYCTASSYHMRELIKWLKDCRKI
                     HHTHPKLFDECLYTPFMYTDWRGDKRFEHEDLIRLDDEGGEINVSDKQPEIYIFEYGV
                     VVLWGFTEREEKAFLNDIERFEKEKLAEEDVQVEEFNYYVTQSYQPRIYNDFITLRDG
                     SNYMIKLSISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSGKVSMSKEDIMKSIG
                     ELFILRININLHGSVLDSPEIMWSEPQLEPIYHATRGYLEINQRVALLNQRLEVISDM
                     LQMLKEQLGHSHEEYLEFIVILLVGVEVLISAVNIAVDMLAKKD"
     gene            <539357..>540073
                     /locus_tag="HG536_0G03130"
                     /db_xref="GeneID:59327692"
     mRNA            <539357..>540073
                     /locus_tag="HG536_0G03130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285229.1"
                     /db_xref="GeneID:59327692"
     CDS             539357..540073
                     /locus_tag="HG536_0G03130"
                     /inference="similar to AA sequence:RefSeq:NP_010282.3"
                     /note="ancestral locus Anc_3.210"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141125.1"
                     /db_xref="GeneID:59327692"
                     /translation="MPDNDLKQKVDDLKSSNDILALAIQRTRLSVKRLKLEYSVLLER
                     LESRVELDPELRSENPLPTLESFKNELMTKPPKKSKTKRRKTKDRDPNLPKRPTNAYL
                     LFCEMNKEKMRKNGSQDVSKDLTEAWKTLNEHDRKPYYKLYNEDRARYQKEMELYSIK
                     MGHGRNNEEEEEPEDTEVVREAKRGRTEDEEEDDEDDEDEEEEMDREPDSEMTQPGDD
                     DEEDEDEEEEEMTDLPPSET"
     gene            complement(<540191..>547663)
                     /locus_tag="HG536_0G03140"
                     /db_xref="GeneID:59327693"
     mRNA            complement(<540191..>547663)
                     /locus_tag="HG536_0G03140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285230.1"
                     /db_xref="GeneID:59327693"
     CDS             complement(540191..547663)
                     /locus_tag="HG536_0G03140"
                     /inference="similar to AA sequence:RefSeq:NP_009551.2"
                     /note="ancestral locus Anc_3.211"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141126.1"
                     /db_xref="GeneID:59327693"
                     /translation="MAKQKVTTKSSKRYTYSSFKSKVDNLRIEPARNLQKRVHDYVES
                     SHFLASFEHWKEINLSAEFGRFADKVENLVQTLPQIIYHDETIFDSVISSIEKHDEYS
                     LEPLLDLLAQFCHDLGPDFLKFYERALTSLIRLLDSAVKFESSKVFEWGFNCLAYIFK
                     YLSRLLSDDLMPTFNLLFPLLSHSKQYISRFSAEALSFLIRRSKQVSLSTFLSFSFEK
                     LDNLEDSNLYDGMLLLFSEALTSTANALHSRSKMLIEVLLDQVLSRGGDIEVNLFCDV
                     WLNIARHASSEHLAPLYGIINESLRAKLKSANPNGIAKVLTTLAFAESGKKVTDWSDL
                     VLLGEQLLSLPNEETINSMNLTFMIAVLFRNCDLKTLTQHHRTLFERYLQCCKENFIP
                     FFAFLLSICSERALTFNGGWYLQQYLNLQSTDCISKLALFSSRMEEMPHAAAKLQVSI
                     PKELESSLLAFMQSNSTNLSDEILFKVYQNALVLRYGTSNSQNGAAVPLSLAKRLMES
                     VDGINEFSKDVIGYLLLISDGCGDSQVSFAISVLERLADLRTSVYFIKGFNRFLCSMM
                     TNKHLKAAIEDHKDALLSLSDNLLFPDREIRYETIKLVETLLKAGGVELPQLLHDCRN
                     LEDVPLTIENARDITTRIRGMGAHFINMDRDILLDTFFIKHLFGLLTVRFSPIWEGIY
                     ELIPKIYNQNEAMIWELLKTFLRLSEVDEVIEYYDISPSEVFNANFWESRVPRLREML
                     GAFDGLWKDYNDSDSTLLQVLKQRRGSGKLSPQIRTQMLRIMAMIPQVVERHSRDIVP
                     YIFNQGEFEQIFDVKQGEDETLSNGSNWTEADRNSLLKIIGKFKNIKSIYKSSEVRDR
                     LMVLLGSRSNEVQKIALECLLAYRDPVLIKFKDSMSNLLDDSLFKDEITRLLTSSQII
                     NEQEEAALMPYALRILFGRAQTPNTSGVRKGRKHAVMSVLPGLKDKFIEKFFELGSSK
                     FEYQYFFENGHRVNPDEFTLPTLRRMIGYVNILNLSFEVLGSKFSQVKSITLQPLLYT
                     VAMSYYGSQQLATEVHIDKMVSNLRQQSLKCLNSLFQSSGDCSALTKSMHDIQEIVIR
                     PRMEKFEDENLQQVSSLMKMILYWTSDSSLYRYLYYDEYSSCMALMNVLSNPNAKESV
                     VGPILKAANDIVCKPIVDHEYTGLVALVAATSLKVLPRLYNNLSEASNLSLVIDLVLN
                     LVNCGYVQDNETTRHLLDSLTLVSKGKFRGVSRKDMAKVLQIVAALIESFECSWSDVF
                     ELYRAVSSLYEVFAEKEIREGINRVLFSFAKRFSNLEKVAQLVSNLNSYSSKRLQEYD
                     FPRILSSFQEFNEKTYHDYTELEWLPVIYSCLFFIHDKEELAIRSNASHTLFTFVDYI
                     NEKSSQESAGDGIEILEKVVLSSVRSGLQKTSEDVQREYISVLAYVAQHSIYFKGLED
                     MKILLFDGDEEANFFVNVVHVQLHRRLRAVKRLRDHASDLSDSSIAHYLMPIIEQYVF
                     SEEEKFRNIGNEALLTIGVLSNHLSWNQYKALFRRYISLLKSKPEQSKDVVNLICQIS
                     VALRETLCVSRGKIKGGIALQKLPARLEDLDTFIFTEVYPKLCKVIEIRDSETILKRI
                     PLAEALVNLILGLEYERTVELLPGILTSVCQVLRSKSAEVRDAVRKTLGNICCILGAS
                     YLTFVIKELTSALKRGSHIHVLSFTLHSILKSMEEVLSHSDLDPCSDMIARILMDDLF
                     GSTGEEKDSENYHTTMKEVKVNKSYDTAEMLSANISLSMFSSILSPIKALLMERINLR
                     NQNKLDELLRRYALGLKHNSESSSPDVLALCYEIFQQGQEKTTSKSSLHNSASDERMD
                     FFLVDLNAKREKVQNDLSHLNITLQKFALELLNAVLFRNRHLLDPLYLDGFIPLLRIG
                     IVSEKESVVVNSLKVLILLVKLNFPEESETIFKSAARIVLSIIKDCPSTSSELCQMGL
                     KYLSSFIRHKNVEMKDSALSYVLSRILPDLNEPHKQGLAFNFLKALVAKQIKLPELYD
                     VMNSVREIMVTNHTKEIRDISRSVYYQFLMEYDQSKGRLEKQFKFMVDNLQYPSQEGR
                     QSVMELINLFVSKANAALLSKLSSSFFVALANVFVNDDSPRCREMAGILITNLLKKLD
                     SDSLQVVTTYIIAWLRQVHEPSYISLGLRIYKLYQAAVGESVSAALEDLALSRTKDCI
                     ENADTELEDQWVMTYTALTAFDSYVHRQPKIVYSKSLRNTWNSVISLLLYPHLWVRHA
                     SARLVGFLIENVDSFEHPFSDSEIQTIVSRIARQLSAPSVSNDLAAVSIKTLLRIATR
                     WKEQKTDYVESEDDALQGKRHTSAIAYMISRIGAIIRSEENQAESFASKKACIQLLGF
                     LIQLLGDELRNVAEALIMPLFVYLEYDVSASLSGDQKELGALAQECLQMLEAKLSVSD
                     FTKAYANVKLEVINRRKERKAKRSILAVTEPERAARRKLKKHARSREKRRHEKDDSGY
                     YQRKNKRTRT"
     gene            complement(<547904..>549652)
                     /locus_tag="HG536_0G03150"
                     /db_xref="GeneID:59327694"
     mRNA            complement(<547904..>549652)
                     /locus_tag="HG536_0G03150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285231.1"
                     /db_xref="GeneID:59327694"
     CDS             complement(547904..549652)
                     /locus_tag="HG536_0G03150"
                     /inference="similar to AA sequence:RefSeq:NP_010281.1"
                     /note="ancestral locus Anc_3.212"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141127.1"
                     /db_xref="GeneID:59327694"
                     /translation="MQSTVQAYSSVRIGTKSGPLAQIWLAANMSNLPKTSVLQTSIQE
                     SADEIAKASGCSTDVSGEASSFEYITLHTSGDLLQGIVRVYSKQAAFLLTDIKDTLMK
                     ISTIFKANQRINVTVGKSNTIASIEQLILQDSVTEREVLSVPSLDFLENDQTPPNLLD
                     GDNSMRRRVQGAAPWDTSLEIGRGFGGDDDLDLHETSALNLDFDFEDGQSSKTWEEGT
                     RQTTLDEGSMAQSRAEMVPLIEDDDFPLDDPNNGQWDLGISKSEQEGHDEDSSTMSVE
                     LGRRAGNASMVDDNEDLGIDLGLEKEPLIEEPVADEEPMVEKEILVRLKKNSGLANAK
                     AIDLDNETELKEPQIRQTFDNLTDEGSEQNDSSLTKRRLLDELRLSINYLPSAMLTDV
                     LSFQKCKRQKLNSPEVEVRSEEAQIDISLSLDEHLISNDDTNDGSACDTEDSDHIMPI
                     AADIGQPPADENLLSSPERESSQTQQDSSEQPQEVRLPSSDTASKTTVRMAELLRAQF
                     LDIDAPTFDDLLSAGHKSDVSKAREDISKKEASRAFFDLLSLANEDCIDLDQESSFDS
                     IAIRAKPNLFTKFITA"
     gene            complement(<550078..>550557)
                     /locus_tag="HG536_0G03160"
                     /db_xref="GeneID:59327695"
     mRNA            complement(<550078..>550557)
                     /locus_tag="HG536_0G03160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285232.1"
                     /db_xref="GeneID:59327695"
     CDS             complement(550078..550557)
                     /locus_tag="HG536_0G03160"
                     /inference="similar to AA sequence:RefSeq:NP_010280.1"
                     /note="ancestral locus Anc_3.213"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141128.1"
                     /db_xref="GeneID:59327695"
                     /translation="MLRLNTTRNLSRSLNLVSKRFYAEAAPSSFLKLQFALPHETVSA
                     GSEVTQVNLPAQSGRIGILANHVPTVEQLTPGVVEVFEGSQSKKYFVSGGFATVQPDS
                     TLCITSVEAFPLESFSQENIKSLLSEAKNKVNSSDERTAAEAAIQIEVLESLQSALK"
     gene            <551423..>552370
                     /locus_tag="HG536_0G03170"
                     /db_xref="GeneID:59327696"
     mRNA            <551423..>552370
                     /locus_tag="HG536_0G03170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285233.1"
                     /db_xref="GeneID:59327696"
     CDS             551423..552370
                     /locus_tag="HG536_0G03170"
                     /inference="similar to AA sequence:RefSeq:NP_010279.3"
                     /note="ancestral locus Anc_3.214"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141129.1"
                     /db_xref="GeneID:59327696"
                     /translation="MVTLQGTASASETPSFSATLPAHNNKLTQCFDDIMKVAAEMMVQ
                     QQLKTVQLDTSVINGFSEAQQRVLSEKVHLFHSILDDLETTLSKSKSYIGAIYEIAVE
                     KEKERERKRIDQRRKQEEEEQRKNRELEELKSRQLSGQSIEDNRIESENRTEFSRDRT
                     NGMLVANLGDDRRNINGSPNMVMSAQSQIAMTPGDSQQQSPRNSQGQPTQGDDMGEIG
                     NMDISMFPGLDNTGFDIGSFGTGINGSEKNGDKSTEPINTFEKPSGTTDNNLSENPEA
                     GYMADNGENYLTLNDFNDLNIDWAANGDNGDLDLNGFNI"
     gene            complement(<552518..>553351)
                     /locus_tag="HG536_0G03180"
                     /db_xref="GeneID:59327697"
     mRNA            complement(<552518..>553351)
                     /locus_tag="HG536_0G03180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285234.1"
                     /db_xref="GeneID:59327697"
     CDS             complement(552518..553351)
                     /locus_tag="HG536_0G03180"
                     /inference="similar to AA sequence:RefSeq:NP_010278.3"
                     /note="ancestral locus Anc_3.215"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141130.1"
                     /db_xref="GeneID:59327697"
                     /translation="MSTKASDEQHYKLSYRVGVAENKNAKFRKTMEDVHTYVKNFASR
                     LDWGYFAVFDGHAGSQASKWCGSHLHTVVEQLLVENEALDVRDILNKSFLVLDEQINT
                     NLPGNSGCTAAVCILRWELPDNEPGQLTDLAKHKRKLYTANVGDSRIVLFRKGQSVRL
                     TYDHKASDILEMQRVEKAGGLIMKSRVNGMLAVTRSLGDKFFDGLVVGNPFTTSVEIT
                     ADDEFLILACDGLWDVIDDQEACDLIKDIKDPDEAAKILVRCALENGTTDNVTAMVVY
                     L"
     gene            complement(<553847..>555160)
                     /locus_tag="HG536_0G03190"
                     /db_xref="GeneID:59327698"
     mRNA            complement(<553847..>555160)
                     /locus_tag="HG536_0G03190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285235.1"
                     /db_xref="GeneID:59327698"
     CDS             complement(553847..555160)
                     /locus_tag="HG536_0G03190"
                     /inference="similar to AA sequence:RefSeq:NP_010277.1"
                     /note="ancestral locus Anc_3.216"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141131.1"
                     /db_xref="GeneID:59327698"
                     /translation="MGQGVSSGQDKKKKRGSKEKSKYEPPVQSRFGRKKRRGGPATAE
                     KLPTVNPSTRCKLKLLRMERIKDHLLLEEEFVTNSEILKPIEKKQEEEKKQLEEIRGN
                     PLSIGTLEEIIDDDHAIVTSPTMPDYYVSILSFADKELLEPGCSVLLHHKTMSIVGVL
                     QEDTDPMISVMKIDKSPTESYSDIGGLENQIQEIKEAVELPLTHPELYEEMGIKPPKG
                     VILYGAPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPRLCRQIFKVAAENAP
                     SIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGFDDRGDVKVIMATNKIESL
                     DPALIRPGRIDRKILFENPDLGTKRKILGIHTSKMSLSSDVHLEELVTSKDDLSGADI
                     QAMCTEAGLLALRERRMQVTAEDFKQAKERVLKNKVEENLEGLYL"
     gene            complement(555298..555379)
                     /locus_tag="HG536_0Gtrna13S"
                     /db_xref="GeneID:59327884"
     tRNA            complement(555298..555379)
                     /locus_tag="HG536_0Gtrna13S"
                     /product="tRNA-Ser"
                     /note="codon recognized: UCU"
                     /db_xref="GeneID:59327884"
     gene            <556266..>560789
                     /locus_tag="HG536_0G03200"
                     /db_xref="GeneID:59327699"
     mRNA            <556266..>560789
                     /locus_tag="HG536_0G03200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285236.1"
                     /db_xref="GeneID:59327699"
     CDS             556266..560789
                     /locus_tag="HG536_0G03200"
                     /inference="similar to AA sequence:RefSeq:NP_010294.1"
                     /note="ancestral locus Anc_3.220"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141132.1"
                     /db_xref="GeneID:59327699"
                     /translation="MSSSEVKEANSPSSDESREAGDRRSLACSELSYRAYNDEDSDKP
                     MFEIGRDVAHLKSGTSFNAETTSQICSLARTLSRRISKEDAGKRDPNAFNAENILSRF
                     VNDASDQGIHFRKTGVILEDVGAEGDDESALEGVTFGNILCLPLTIYRGIKARKNRKM
                     RKILRGVHVLAKPGEMVLVLGRPGAGCSSLLKTTAGVIDQFSGGVSGSISYDGIPQAE
                     MMKHFKSDVIYNGELDVHFPYLTVKQTLDFAIACKTPARRVNNVSRQEYIEHTRDFYA
                     TIFGLTHTYDTRVGNDFVRGVSGGERKRVSIAEAVVARGSVYCWDNATRGLDASTALE
                     YARAIRIMTNLQQSTAFVTIYQASENIYNTFDKVTVLYAGRQVYFGAIEDAKDYFWRM
                     GYECPARQDTAEYLTVLTDPNGLHQIRPGFEKRVPRTAEEFEKYWQNSPEYAQLLKDI
                     EEYKANVDTEKTRQIYHDSMVQEKSKHARKSSYYTVSYWKQLQLCTQRGFQRIYGNKS
                     YTVINIVAAVIQAFIVGSLCYNTPSSTSGAFTRGGVLYFALLYYSLMALANITLDYRP
                     ILQKHKNYSLYHPSAEALGANIAGFPFRMIGLTLFIIILYFLAGLHTSAGSFFIVYLF
                     LTMCSEAINGLFEMITAGCDTISQANAIAGILMMSISMYSTYMIQLPSMHPWFIWIAY
                     ILPIRYAFESMLNAEFHGRHMDCGGGVIPSGPGYENVTANEKVCAFVGSQPGQSWVLG
                     DDYLKIQFEYEYKHTWRNFGILWCFLIGYIAIKAIITEIKRPVKGGGDALIFKKGHKA
                     LARKARLDDEEAADNMNIADVKEKLSNGESIISSQANADAFEELQSSGVFIWKNVNYT
                     IPYRGGMRQLLDNVSGYCAPGTMTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGC
                     PIDASFERRTGYVQQQDLHIAEMTVRESLIFSARMRRNQSVPDKEKLEFVEKIIDILD
                     MNEYAEALVGELGAGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSAWAIVQI
                     LRKLTAAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDVGPNSSTLLDYFERS
                     GARKCHKSENPAEYILEAIGAGATASVDEDWHEIWKNSPEFKANEEKIESMMRELSSK
                     EKDSAKSKEDVRKYATGYFYQFKHVYWRTATIFWRDVNYLMSKLMLMLVGGLYVGFTF
                     FDVGNSYTGLQNTLFATFISIVLSAPAMNQIQARALASRELFEVRESKSNMFHWSLLL
                     ISQYLCEIPYHFVFSTIYFVSFYFPLKNFFEASRSAVFFLNYSIVFQLYYVALGLMVL
                     YMAPNLPSAAVMMGLVLSFLLSFCGVVQPPSLMPGFWTFMWKVSPYTYFVQNLLGIVL
                     HGKKVVCKQKELSFFDAPSGMTCGEYMEPFLSRATGYIQNPNATENCAYCQFSVGDDY
                     LTRISASYSYLWRNFGFYWAYIGFNLCAMIGIYYMFHVRKVGLIDFGAIKNILSTVKS
                     KMPFSRRKISSAQ"
     gene            <561353..>563233
                     /locus_tag="HG536_0G03210"
                     /db_xref="GeneID:59327700"
     mRNA            <561353..>563233
                     /locus_tag="HG536_0G03210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285237.1"
                     /db_xref="GeneID:59327700"
     CDS             561353..563233
                     /locus_tag="HG536_0G03210"
                     /inference="similar to AA sequence:RefSeq:NP_009577.1"
                     /note="ancestral locus Anc_3.221"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141133.1"
                     /db_xref="GeneID:59327700"
                     /translation="MTTETDELAAVFSNPSRKSLHKRNSEDEILGKQKIRATGKSFYE
                     EDVSSTVEASVDEYVEEQSRWKKFYSKWIIVDPSVADVSLTESFLYNHDLKPVEEKRR
                     VWSWFNFAYFWLADCFNINTWQIAATGMQMGLNWWQCWITVWIGYGLVGVFVVAASRC
                     GAAYHVSFPISVRASFGIFFSMWPIINRVVMAIVWYAVQAYLGGSTVSLMLKSIFGND
                     LNERIPNHFGSPNATTFEFMCFFLFWVGSIPFLLVAPHKIRHLFTVKAALVPIAAFGF
                     LIWAVKKSHGKIALGSLNGTAPHGSEFSWIFVRSIIGCIANFATLIVNAPDFARFSKT
                     PASSLWTQLIGIPFLFSITCLVGIIVTAAGYELYGVNYWSPIDVLARFLDSSFTPGTR
                     AGVFLIAFVFTLAQLGTNISANSLSCGTDMTALFPRFVNIRRGSLFCAMIALCICPWN
                     LLATSNKFTMALSAYAIFLSSIAGIIAADYFVVRRGYIKLSHLYSNKKGSFYMFNNRF
                     GINWRAAVAYICGVAPNLPGFIGTVGAPQITVSQGALNLYYLSYWVGYFISFLVYIVL
                     CYISPIPGTPVENIIRDKGWFQRFVDVEDFETEWRSDMKKPDLEDDFVDVYEYGNGKT
                     CL"
     gene            complement(<563475..>566942)
                     /locus_tag="HG536_0G03220"
                     /db_xref="GeneID:59327701"
     mRNA            complement(<563475..>566942)
                     /locus_tag="HG536_0G03220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285238.1"
                     /db_xref="GeneID:59327701"
     CDS             complement(563475..566942)
                     /locus_tag="HG536_0G03220"
                     /inference="similar to AA sequence:RefSeq:NP_009579.1"
                     /note="ancestral locus Anc_3.223"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141134.1"
                     /db_xref="GeneID:59327701"
                     /translation="MSNDRSGDDNYLSFNGGDQESLLRSRHSTISHGPQRQGSLVRPE
                     RNQLNNPENPHYYYVQKAQEQQDHLDVQPSTTGVTPNYVGRSRVSGSLRSVVDVGDER
                     GLESYPLQDFSNDQKPAVEEHVDDLTDENQANLLSTARGQKPVRSDVTRAKTITPWQL
                     YCYIVSFWAPAPLLSLCGMPKKERQLAWREKIGLISVIFYLGAFVAYWTFGFTSTVCG
                     HSVLRLKNNEVSTGYLIINGKAFALDSSSHPAAAGIDAGTNVLYPPVNAGGMDASFLF
                     QNVNGNCLDLIKPKDNCSIPHDDQGKLAWYFPCKLFSQDGSTQPNFTKSEYYDGWACH
                     TSEAAREAYYSLEPAAEVYFTWDDIKNSSRNLIVYNGHVLDLGLLNWLQTDDLDYPPM
                     FSDLKRLDFQGYDLSIALANSYDKKVARCLSEIIKVGEVDSKTVGCIASDVVLYVSLI
                     FILSVVIAKFLIACYFRWAVAMRQGAFPVDNKTMGQQLNKIEDWSNDIRTQGPIKQVA
                     PELRPKHHTRTESRMDLLKKKGSKMFQPRNNSDFNDNMTTDGTIAGMTTMATQSAARA
                     ARERNSIHLSNTFPSRDLTTLAPSDSLLWNGDQRITAPGGSSIQSFDSAIIHPDAVQQ
                     PPLDYLPYGFPLIHTICFVTCYSEDEEGLKTTLDSLSTTDYPNSHKLLMVVCDGLIKG
                     SGNDKTTPEIALGMMEDFIVPPDEVQPYSYVAVASGSKRHNMAKIYAGFYKYDSETVP
                     PEKQQRVPMVTIVKCGTPDEQGSAKPGNRGKRDSQVILMSFLQKMTFDERMTELEFQL
                     LKSIWQVTGLMADFYETVLMVDADTKVFPDSLTHMVAEMVKDPLIMGLCGETKIANKG
                     QSWVTAIQVFEYYISHHQAKAFESVFGSVTCLPGCFSIYRIKSPKGSDGFWVPILANP
                     DIVERYSDNVTDTLHKKNLLLLGEDRYLSSLMLRTFPKRKQVFVPKAACKTIVPDKFK
                     VLLSQRRRWINSTVHNLFELVLIRDLCGTFCFSMQFVIGIELVGTLVLPLAICFTIYV
                     IIVAIVSKPTPTMTLILLAIILGLPGLIVVITATRWSYLMWMGIYILALPIWNGVLPT
                     YAYWKFDDFSWGETRTIAGGNKGGHDDAEGEFDHSKIKMRTWREFEREDRMHRSSSGR
                     NDQDGMYLF"
     gene            <567421..>568779
                     /locus_tag="HG536_0G03230"
                     /db_xref="GeneID:59327702"
     mRNA            <567421..>568779
                     /locus_tag="HG536_0G03230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285239.1"
                     /db_xref="GeneID:59327702"
     CDS             567421..568779
                     /locus_tag="HG536_0G03230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141135.1"
                     /db_xref="GeneID:59327702"
                     /translation="MRSVTASETSLSATLNIPAAASLKIASGRLNRTILETGSQFGAA
                     YRWGDLPHEFGMRRLAGTDEDREMRNWFVEECRSLGCEIKIDKIGNIFAIYPGKDKSG
                     KPPTATGSHLDTQPEAGKYDGILGVLAGLEVLRTFKDNNFVPNYDVCVVVWFNEEGAR
                     FARSCTGSSVWSHDLDLAEAYALKSVGEEHPESVLESLTKIGYVGETPASYKENEIDA
                     HFELHIEQGPILEDEGKRIGVVTGVQSYHWAKITVKGEGAHAGTTPWRLRKDALLMSS
                     KMIVAAAEMAKSHQGLFTCGIIDAMPYSVNIIPGEVSFTLDVRHPDDSIEAIILQEIK
                     DTFAKLVVENTGGALTYQWDVLQISPAVKFNEICIECVSRSAFAQFDKSQIRQIWSGA
                     GHDSCQTAPHVPTSMIFIPSKDGLSHNYYEYSSAEEVEDGFKVLLQAIINYDNYRALR
                     GH"
     gene            complement(<568846..>571710)
                     /locus_tag="HG536_0G03240"
                     /db_xref="GeneID:59327703"
     mRNA            complement(<568846..>571710)
                     /locus_tag="HG536_0G03240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285240.1"
                     /db_xref="GeneID:59327703"
     CDS             complement(568846..571710)
                     /locus_tag="HG536_0G03240"
                     /inference="similar to AA sequence:RefSeq:NP_009594.1"
                     /note="ancestral locus Anc_3.224"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141136.1"
                     /db_xref="GeneID:59327703"
                     /translation="MTRNPFMVEPSSGSPQRGSIPQLSRFHTNTSGRSEGTTYDREDL
                     GDDYDQSRRFQGLPQSPSRAAQRYSPDRRHRAQFYRDSAHSSPVVDRYRANGYGSPQR
                     PINPIFQVDDNDAETEDIISGYQAHPQQVPRSAPRSGNLFGERLYSQSSKATVSTGST
                     MSRGSYENDGKARKSFESYDDQSTAYTDDFAETKFEVNHPVRKDYVRRANSESRRRPM
                     LENPNLAKAILKLDNPIPRGLLDTLPRRDSPEFTEMRYTACTVEADHFLEEGYSLRFA
                     EMNRECQIVICITMYNEDKFALARTIDSIMKNVAHLCSRRRSQVWGPDGWKKVSVILI
                     SDGRTKVNQGALDYLAAIGVYQEDMAKASVNGDPVKAHIFELTTQVSINSDLDYVSKD
                     IVPVQFVFCLKEENKKKINSHRWLFNAFCPVLQPNVVTLIDVGTRLNHTAIYHLWKVF
                     DMDSNVAGAAGQIKTMKGKWGLKLFNPLVASQNFEYKISNILDKPLESVFGYISVLPG
                     ALSAYRYRALQNHEDGTGPLNSYFLGETQEGRDHDVFTANMYLAEDRILCWELVAKRD
                     AKWVLKYVKEATGETDVPEDVPEFISQRRRWLNGAMFAALYAQLHFYQIWKTKHSITR
                     KIFLHIEFFYQFVQMLFSWFAISNFVLTFYYLAGSMNRVIKNGNAVFIFFKYLIFCDL
                     ASLFIISMGNRPQGAKHLFIASMIILTICAAYALICGFVFAIKALASKEESHSIFTNI
                     IISLLSTYGVYTITSIMYLDPWHMLTSSVQYFLTLPAFTCTLQVFAFCNTHDVSWGTK
                     GSTSSLKPLSKAIVVQGPDGKQIVETDWPQEVDKKFTEIKSRLKEVEFEETVVDESQK
                     RNDYYRDIRTRIVMIWMLSNLIFIMSITQVYKPEKVNNGYLIFILWSVAALAAFRGLG
                     SMAFLFMKYLRMIVSYKNKAEGNGSYSLPKMNVFNRSDEA"
     gene            <572106..>573017
                     /locus_tag="HG536_0G03250"
                     /db_xref="GeneID:59327704"
     mRNA            <572106..>573017
                     /locus_tag="HG536_0G03250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285241.1"
                     /db_xref="GeneID:59327704"
     CDS             572106..573017
                     /locus_tag="HG536_0G03250"
                     /inference="similar to AA sequence:RefSeq:NP_009580.1"
                     /note="ancestral locus Anc_3.225"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141137.1"
                     /db_xref="GeneID:59327704"
                     /translation="MFRTQVSKAIPSCLRASGLIRRPLSAKATQWQRYVTCGRRLYNQ
                     ADETEKLKRKPLSRIPIGGTEQSASQRVTSDSIEFSTWKAAVLFIVVGGGLYYFFSKE
                     KKRLETEKEAEANRGYGKPVVGGPFNLVDENGEQFTDKDLLGKWSILYFGFTHCPDIC
                     PDELDKLGVWLDALTKKHGIELQPIFVTCDPARDSPKVMKEYLRDFHPSLKGVTGSYD
                     EVKSACKQYRVYFSTPPHVKPGQDYLVDHSIFFYLMDPEGQFVEAMGRNYDEKSGVEK
                     IVEHVKSYVPTEEREKRKSKWYSFLFD"
     gene            complement(<573089..>574270)
                     /locus_tag="HG536_0G03260"
                     /db_xref="GeneID:59327705"
     mRNA            complement(<573089..>574270)
                     /locus_tag="HG536_0G03260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285242.1"
                     /db_xref="GeneID:59327705"
     CDS             complement(573089..574270)
                     /locus_tag="HG536_0G03260"
                     /inference="similar to AA sequence:RefSeq:NP_009581.1"
                     /note="ancestral locus Anc_3.226"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141138.1"
                     /db_xref="GeneID:59327705"
                     /translation="MPPKKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRSP
                     LGNPANYPFATIDPEEARVIVPSPRFEELCKIYKPASEVPAHLTVYDIAGLTKGASAG
                     EGLGNAFLSHIRAVDSIYQVVRCFDDAEIIHIEGDVDPVRDLEIINEELRLKDIEFSE
                     KALENALKIAKRGGQSLEVKQKKEEAALIERIIKLLQDGQRVANQNWSPKEVEVINSM
                     FLLTAKPCIYLINLSQKDYIRKKNKHLLRIKEWVDKYSPGDLIIPFSVSLEERLSTMS
                     EEEQEEELKTLQTQSALPKIITTMRQKLELISFFTCGPDEVREWTIRKGTKAPQAAGV
                     IHNDLMNTFILAQVMKYEDVIEYKDDAAIKAAGKLLQKGKEYVVEDGDIIYFRAGAGK
                     N"
     gene            complement(574653..574724)
                     /locus_tag="HG536_0Gtrna13E"
                     /db_xref="GeneID:59327881"
     tRNA            complement(574653..574724)
                     /locus_tag="HG536_0Gtrna13E"
                     /product="tRNA-Glu"
                     /note="codon recognized: GAA"
                     /db_xref="GeneID:59327881"
     gene            <575354..>576529
                     /locus_tag="HG536_0G03270"
                     /db_xref="GeneID:59327706"
     mRNA            <575354..>576529
                     /locus_tag="HG536_0G03270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285243.1"
                     /db_xref="GeneID:59327706"
     CDS             575354..576529
                     /locus_tag="HG536_0G03270"
                     /inference="similar to AA sequence:RefSeq:NP_009592.1"
                     /note="ancestral locus Anc_3.227"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141139.1"
                     /db_xref="GeneID:59327706"
                     /translation="MAARIYWFTAVAGYIVQTKCFSYLQTRENYEDAKDEKVHQGLTV
                     VLSFMYFASWLLVPAVSRLFDARETSKKLDLPAPLGFASSSSDLELQTFDEEPELASD
                     TAELMRNNDNKPEADSKICFKYVAQLVTLSMLVLVPVLTYMMALSMSPAFDIALIQNT
                     SIFEITSLLYGVCGLTKRRNVVTKFLIMMVALLGILIVSYTKATCDLLAGKLSINEKT
                     GELNDPFLFDRLKSSLLCGLGALTIGPFAVLWHRWFNKRSKQVTMREQAGHLSIMGVI
                     CMVLLLPFFPALAGTISSICKDRSFWLVSVVTLIFGALPHVVSLLQVTRKTTPEYSTT
                     INLGAIIFMGITDWICEPTQTTIVRWEVIGYIMLSVCCIMLSITYYHKGQDRYTSLI"
     gene            complement(<576572..>577702)
                     /locus_tag="HG536_0G03280"
                     /db_xref="GeneID:59327707"
     mRNA            complement(<576572..>577702)
                     /locus_tag="HG536_0G03280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285244.1"
                     /db_xref="GeneID:59327707"
     CDS             complement(576572..577702)
                     /locus_tag="HG536_0G03280"
                     /inference="similar to AA sequence:RefSeq:NP_009582.1"
                     /note="ancestral locus Anc_3.228"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141140.1"
                     /db_xref="GeneID:59327707"
                     /translation="MISRPFMRLMSTKVPKQFKSIVYSTHSVEDVGSVLSVQNYTPKE
                     DLSKAIVLRTLAFPINPSDINQLQGVYPSKPEKTLDYSTEQPSAIAGNEGVFEVVSVP
                     KSESSLSEGDWVIPVHANQGTWSNYRVFSKASDLIKVNGLDLHSAATVSVNGCTAYQL
                     VNNYIDWDPSKNEWLIQNAGTSGVSKIVTQIAKAKGVKTLSVIRDREGFESVARTLEE
                     KYGATRVISESDNSDKAFGKEQMPKILGPNARVRLALNSVGGKSSACIARKLDQDALM
                     LTYGGMSKQPVTLPTSLHIFKGLTSKGFWITENVKKNPSEKVANVRDFIKLYEEGKII
                     SPKDEITTVEWDVNNTSDDELLQLIREAVSATGQKRMVRLKW"
     gene            complement(<577949..>579457)
                     /locus_tag="HG536_0G03290"
                     /db_xref="GeneID:59327708"
     mRNA            complement(<577949..>579457)
                     /locus_tag="HG536_0G03290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285245.1"
                     /db_xref="GeneID:59327708"
     CDS             complement(577949..579457)
                     /locus_tag="HG536_0G03290"
                     /inference="similar to AA sequence:RefSeq:NP_009584.1"
                     /note="ancestral locus Anc_3.229"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141141.1"
                     /db_xref="GeneID:59327708"
                     /translation="MIFTLDDDLEGLKLSDSESSLQQQQQPTALYDETDEAENVMNLD
                     HLNLATEPIPFLGDRPRRRSSVLEKFPVSTPPRTRRISVTSASNPLGGGCLDGGQLLT
                     HRDAGIFRCLADFKPVRVLGKGAYGKVILVRDQQTSKLYAMKQLLKAEILFTEENDQS
                     QKDDKDVSKLVERTFAERTILSELEHPNIVKLFYTFHDNAKLYLLLQYIPGGELFFHL
                     KEQGTLDEDTVAFYAAEISCALKFLHSKGIVYRDLKPENCLLDQNGHLVLTDFGLSKK
                     SVAQQEVPFSSSAESAFESEEVTNLYSIIGTPEYCAPEVLQGVPYTKKCDWYSLGCLM
                     YDMLIGKPPHTGANHKVILNKIQRDKQGPKIPHYLSDGMKDMLSALLKKEHTKRWDVD
                     KYWRTPTDPKQKRKKKKAGQEKTSGYTSHFIFRKIDWPKLEKGEIQKSEPGPILPLIT
                     DWALAENFDSEFTSMSYEDTLKGIDINIPKSSSDYFKGFSYKASCSYLERHF"
     gene            complement(<579637..>580917)
                     /locus_tag="HG536_0G03300"
                     /db_xref="GeneID:59327709"
     mRNA            complement(<579637..>580917)
                     /locus_tag="HG536_0G03300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285246.1"
                     /db_xref="GeneID:59327709"
     CDS             complement(579637..580917)
                     /locus_tag="HG536_0G03300"
                     /inference="similar to AA sequence:RefSeq:NP_009585.1"
                     /note="ancestral locus Anc_3.230"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141142.1"
                     /db_xref="GeneID:59327709"
                     /translation="MKEQDKSSTSDAGGVRKAGKEANEKQSDSKKYNFLVRTLWTFVM
                     IAGFFITLASGHFWCIMLILACQIATFRECIAVTSASGRAKNLPLTKTLNWYFLFTTI
                     YYLDGKSLFQFFQDYFIEYRVLTLLAANHRFICYCLYLLGFVMFVCSLRKGFLKFQFA
                     SLCITHMVLMLVVGQAHLIIKNVINGLIWFLLPCGLVIVNDIFAYLCGITFGRTKLIE
                     ISPKKTLEGFLGAWFFTALASIILTKLFSSFMYMTCPVKDIHTNFFSNLRCELNPVFI
                     PQDYRLPPIIFDKLGISVITIKPIYFHALNLATFASLFAPFGGFFASGLKRTFQVKDF
                     GHSIPGHGGITDRVDCQFLMGSFANLYYETFISENRITVETILSTILMNLDERQMVSL
                     ISTLTAILFKKGVFNEQMYKRLASIYNAATEKLV"
     gene            <581266..>582756
                     /locus_tag="HG536_0G03310"
                     /db_xref="GeneID:59327710"
     mRNA            <581266..>582756
                     /locus_tag="HG536_0G03310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285247.1"
                     /db_xref="GeneID:59327710"
     CDS             581266..582756
                     /locus_tag="HG536_0G03310"
                     /inference="similar to AA sequence:RefSeq:NP_009586.1"
                     /note="ancestral locus Anc_3.231"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141143.1"
                     /db_xref="GeneID:59327710"
                     /translation="MNLVELPPIVLSLMSNTLCDDLSGVLQFVRDCRDSFWSPECEIR
                     ESPVGGVGVFAGTDIRKGSTLLKLPKSSLFSASNSTIANLLLDDEIDGILALNIAFIY
                     ETTVFREKSHWVPYLKSIRICDEQQQLVLPPGYWSDEAKRCLRGSTLDTLHDGLRSET
                     EVQEGFELAVDLARKWNQEFGLPIPQGYLDVRPDDRDDTILKFHRFVATAYAMSSRVF
                     EIDAYHGSALVPIADLFNHSTTAPDVRFTSLYEVCPLCGEPGMCKHLVAEAALEAQEN
                     GGSSPPGSDAESSDEEHDPSNEDELVDITLERDVKKGQEIFNSYGELSNALLLARYGF
                     TVRNNPHDMVHLGNEVRALVRTHGRYAARTQWWSRTGWKAYSRWSAAEVQTPWLSEIF
                     VDSRGQPSDPLAAFLNLLEMPETQWLQLRSAPTPSNAPVHQLQDMGDVGTRAHLLRLL
                     AYKKLSWRPSPGGVPPAARVILHSERTILRRARSRMYRRNSSRYTD"
     gene            <582959..>584047
                     /locus_tag="HG536_0G03320"
                     /db_xref="GeneID:59327711"
     mRNA            <582959..>584047
                     /locus_tag="HG536_0G03320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285248.1"
                     /db_xref="GeneID:59327711"
     CDS             582959..584047
                     /locus_tag="HG536_0G03320"
                     /inference="similar to AA sequence:RefSeq:NP_009587.1"
                     /note="ancestral locus Anc_3.232"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141144.1"
                     /db_xref="GeneID:59327711"
                     /translation="MSRPQVTVQSLTGEATSSSLPLPAVFNAPIRADIVHSVFVSVNK
                     NKRQAYAVSEKAGHQTSAESWGTGRAVARIPRVGGGGTHRSGQAAFGNMCRGGRMFAP
                     TKTWRKWNVKVNHNEKRYATASAIAASAVASLVLARGHRVENIPEIPLVVSNELESVK
                     KTKDAVAALKAVGAQADLVKVLKSKKLRAGKGKYRNRRWTQRRGPLVVYSEDNGIVKA
                     FRNVPGVETANVASLNLLQLAPGAHLGRFVIWTESAFASLDKIWGSETVASAKSNYAL
                     PANIITNADVTRIINSSDIQSVVRPAGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVF
                     AAEKLGSKKVEQSAQKPADVFTQTLKHD"
     gene            complement(<584204..>585253)
                     /locus_tag="HG536_0G03330"
                     /db_xref="GeneID:59327712"
     mRNA            complement(<584204..>585253)
                     /locus_tag="HG536_0G03330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285249.1"
                     /db_xref="GeneID:59327712"
     CDS             complement(584204..585253)
                     /locus_tag="HG536_0G03330"
                     /inference="similar to AA sequence:RefSeq:NP_009590.1"
                     /note="ancestral locus Anc_3.233"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141145.1"
                     /db_xref="GeneID:59327712"
                     /translation="MMSKTAAGESATQKGALSHSEQHYFDSYDHYGIHEEMLQDSVRT
                     LSYRNAIVQNKHLFKDKIVLDVGCGTGILSMFAAKNGAKHVIGVDMSSIIEMAREIVE
                     LNGFSDKITLLRGKLEDVELPFPKVDIIISEWMGYFLLYESMLDTVLYARDHYLVEGG
                     LIFPDKCSLHIAGLEDAQYKDEKINYWHDVYGFDYSPFIPLVMQEPIVDTVQGNVVNT
                     TRCQLIEFDLNTVQLSDLSFKAKFEVEAKRQDWINGLIAWFDIVFPAPEGKIPVGFST
                     GAHSPYTHWKQTVFYLKENLEAETGDVLRGELTCAPNKRHNRDLDIKITYDFEAKGID
                     AARRSKSGEDTFIMR"
     gene            complement(<585632..>586258)
                     /locus_tag="HG536_0G03340"
                     /db_xref="GeneID:59327713"
     mRNA            complement(<585632..>586258)
                     /locus_tag="HG536_0G03340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285250.1"
                     /db_xref="GeneID:59327713"
     CDS             complement(585632..586258)
                     /locus_tag="HG536_0G03340"
                     /inference="similar to AA sequence:RefSeq:NP_010296.3"
                     /note="ancestral locus Anc_3.234"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141146.1"
                     /db_xref="GeneID:59327713"
                     /translation="MYGDLANKLVLEAKRTKQLQSRSGDGYKLPMYHEELVQGILKEV
                     GQLKKNSEYLKEQQLLGNLEDKVSKCQFFVTLLCLERNKRCLLAYQKMRADILDKIAW
                     DNNGLDLLSDLKGTEQVSTNISPDEQEYLKEYLDLLTDLKSGELADIDLSGSLTPPSD
                     VFIDVRVLKEAGEIQTEYGVFNLIKDSQFFVRQADVERLIQQGYLQKI"
     gene            <586401..>588182
                     /locus_tag="HG536_0G03350"
                     /db_xref="GeneID:59327714"
     mRNA            <586401..>588182
                     /locus_tag="HG536_0G03350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285251.1"
                     /db_xref="GeneID:59327714"
     CDS             586401..588182
                     /locus_tag="HG536_0G03350"
                     /inference="similar to AA sequence:RefSeq:NP_010297.1"
                     /note="ancestral locus Anc_3.235"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141147.1"
                     /db_xref="GeneID:59327714"
                     /translation="MVRVYGKRSRSWTYDSSQYGDESMVELSDDGEIEEIKQPVTANE
                     PDNITLSRQDESNDADEESLRISSSTVSFIRDTCNATSTSVAMDDDISPLKAFDFLQG
                     RSAVKKRKTNYKKVSVGECEDPEAPNGSESSIDKTVDRLNQFLASLQPANAEDQIKDQ
                     FERELKKSVEEDYSCSFDKVMYDRSRTILFNEDEDGIEVQEPDQQTEVAAEIPKTGRK
                     AGKHLTHHYKELKNIGEVVKYQDELQFLTDESPSKINIETFISRFLGLAMAIEQDEEF
                     LEYINRHAANEICRWCFSKELNRHPVVTLLQSFLLTKVRLPPEYPPSDFEHLVVLSLG
                     CDEPPSIHSLTGKLRRMNLTDFLNKTGKKSAQDYSLQLCLNYPDQLLSQEVTRRILDI
                     AIQRDLDQESSSVLFPLVEHILSSGSPVVGDTSSILLGSLICALPKQCCNEDLVKSLI
                     MLSNENKVLTEAPVEQKQKLMHCSLGFILRHIHPIADSTADLVILYLGLLLNMLDVCD
                     ARLFEKQQLDHARKLLPSISTSDTDPFIVCMYSLNLAHILFGAGERLHEEEKDLLMRI
                     LNSYDKEGININQAIRDQVKAALNNFL"
     gene            complement(<588225..>588911)
                     /locus_tag="HG536_0G03360"
                     /db_xref="GeneID:59327715"
     mRNA            complement(<588225..>588911)
                     /locus_tag="HG536_0G03360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285252.1"
                     /db_xref="GeneID:59327715"
     CDS             complement(588225..588911)
                     /locus_tag="HG536_0G03360"
                     /inference="similar to AA sequence:RefSeq:NP_009591.1"
                     /note="ancestral locus Anc_3.236"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141148.1"
                     /db_xref="GeneID:59327715"
                     /translation="MAEDSERTQTPIIFAPDTYQYDKFSLEESQLAEDPIDQFAKWFA
                     EARADKSETLPEAINFASAELPSGRVSSRVLLFKELDHRGFTIYSNWGTSKKAHDIKT
                     NPHAAITFFWKDLQRQVRIEGFTEHVNRETSERYFKTRPRGSKVGAWSSPQSHVIKDR
                     QELNALAKKNEERFEGVADIPCPDYWGGLRVVPLEIEFWQGRPNRLHDRFSYTRKSEH
                     DPWIRVRLAP"
     gene            <590676..>591227
                     /locus_tag="HG536_0G03370"
                     /db_xref="GeneID:59327716"
     mRNA            <590676..>591227
                     /locus_tag="HG536_0G03370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285253.1"
                     /db_xref="GeneID:59327716"
     CDS             590676..591227
                     /locus_tag="HG536_0G03370"
                     /inference="similar to AA sequence:RefSeq:NP_001035220.1"
                     /note="ancestral locus Anc_3.238"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141149.1"
                     /db_xref="GeneID:59327716"
                     /translation="MAKVHMRRSLTTAEAVEEAQLRRVADRAATMSPRIPSVQLVQKS
                     LDRMGLYEREDSMMEQDEASVDDSVERVVIDLERPASKNAEQDENYNERSDGSTYTEK
                     DSEKSSPSDDEANCTEQTWETGTAETSVDDSQLSEWVHKPLKDLIFKTNKRFYDIDSN
                     KVRYKVGLSRRAAMIPSLHRKKE"
     gene            complement(<591261..>591566)
                     /locus_tag="HG536_0G03380"
                     /db_xref="GeneID:59327717"
     mRNA            complement(<591261..>591566)
                     /locus_tag="HG536_0G03380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285254.1"
                     /db_xref="GeneID:59327717"
     CDS             complement(591261..591566)
                     /locus_tag="HG536_0G03380"
                     /inference="similar to AA sequence:RefSeq:NP_010299.3"
                     /note="ancestral locus Anc_3.239"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141150.1"
                     /db_xref="GeneID:59327717"
                     /translation="MSSTNDENDEVIEKKSSTVSPADKYFIEQRDLIIQDINNTMDSI
                     LNSLNTLNISLENSIAVGKEFESVSDLWKTFYDGLNRDLEEPIGSQESNKDKTLPQE"
     gene            complement(<591974..>594421)
                     /locus_tag="HG536_0G03390"
                     /db_xref="GeneID:59327718"
     mRNA            complement(<591974..>594421)
                     /locus_tag="HG536_0G03390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285255.1"
                     /db_xref="GeneID:59327718"
     CDS             complement(591974..594421)
                     /locus_tag="HG536_0G03390"
                     /inference="similar to AA sequence:RefSeq:NP_010300.3"
                     /note="ancestral locus Anc_3.240"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141151.1"
                     /db_xref="GeneID:59327718"
                     /translation="MMSHEGGERSEEAVGSLKDTNGSDKKRVSNVIHGRKASTYLRIF
                     RDDEGITDGEVVERDVEPRRRKSVSLYDTHYKSSTVPRRKFSRTKEDGTAGNRAKRPE
                     EECNGLKAVSSATYYPHKAKELAESAKLEQGSVEEAVPKLSAGEVPRESTGEDLSEAL
                     ESDEDEDEEQGAEYPLAVELQPFTNNVGGHTAIFRFSKRAVCKALVNRENEWYENIEI
                     KHKELLQFMPRYIGVLNVRQHFHSREEYLKHLANSKGVKRKKGCDAREKSECVDVDGN
                     FGCRLKQVHTCPCDSEYLEASHQRPALSEVVLDDNRHMIPGFMQNWYPQSPSSAPSDS
                     FLYSHQGSRRSLPCDSNDNRVNLSGSTTVNTKLKELVLQEVFAPTYSSCSRPRRLSKK
                     DRASSHGSSRRNSNQSLRNLPTHASNSPLLKKTAKESISNAISSPNSVMDLKQLERKE
                     IARENARSSAHESPRCSTKSSPLLQPNEAISPLFLPVDRMTNEGGVFEMDDDIEDPEL
                     KRNRLPEADISSAQDKKNEDSVTFEDQSIVSKFILLEDLTRKLNKPCALDLKMGTRQY
                     GVDATRSKQLSQREKCRKTTSRKLGVRVCGLKIWNQTYYITRDKYFGRRVKIGWQFTR
                     VLARFIYDGRRIASIIMQIPRLIRQLDTLAVEISALKGYRLYGSSLLLMYDGQNPGNK
                     RCRVKVNLIDFARCVTKDSLTQGYESFRIPPKNPEIEDRGFLRGVRSLRFYLMSIWNY
                     LTGDVPLSNNDDELTRFLEEHKEKFDANWEWLDQLDKENEEDFNNPNSELRTKWRKYE
                     LIFDLEPRYSDEADVSD"
     gene            <595557..>596750
                     /locus_tag="HG536_0G03400"
                     /db_xref="GeneID:59327719"
     mRNA            <595557..>596750
                     /locus_tag="HG536_0G03400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285256.1"
                     /db_xref="GeneID:59327719"
     CDS             595557..596750
                     /locus_tag="HG536_0G03400"
                     /note="Ty-like retrotransposon"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141152.1"
                     /db_xref="GeneID:59327719"
                     /translation="MILASNSCGENRSAECTTNTHGATDTDRLKDHLANGDDLDSQTE
                     IDAVRTGYRRRRPDPADNPKANSLKRSASGYRSSVSALNAGPANIGRRTALKRGLANY
                     CQSDCSTVLIATEKTAKYSRKPQSQKPPLVGHRREITVLVGNKPTTMLSDTGAGTSLI
                     AAHRAQALNLKTYKTRPIAIKGATSDNSARCTEATILEFKYQNQQFEIPVYVTTAINP
                     DIIIGNPVLETNPRLGQTLDRSSINLATPETEPDWPIGLILTNEDRQVRRFHKKQNRT
                     LSGYIVQVQAIECCDATDTPDPSTFSRLPQYLQEKFRQTVRNDLPRSALDKKEIFHEI
                     ETKPNARMPRIPPHRRSPKEEGEIVKIVDELLEKGFIGPSKSPFSSPVVLVKSSCSLN
                     QECIL"
     gene            <596949..>598379
                     /locus_tag="HG536_0G03410"
                     /db_xref="GeneID:59327720"
     mRNA            <596949..>598379
                     /locus_tag="HG536_0G03410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285257.1"
                     /db_xref="GeneID:59327720"
     CDS             596949..598379
                     /locus_tag="HG536_0G03410"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141153.1"
                     /db_xref="GeneID:59327720"
                     /translation="MTINLGSTGKGDASRPSSSVLARQSLTLDRPKARLGEADKYCSS
                     ADSSFVLEESDYGAEHSNSNMSCSLPEFEDVVGLEQKLEEMSPQKQKQFIFLHSIVNS
                     SSDDSHLDSSDEIVGDSSMIQPLKELYNFRLLERPIPLPEPSNEEYDPIEVQLRSMLM
                     VPRQVSYSIPLVLKHLLCTDDNLIGFEDNITLERVVRRKLLADIIPMCSQGSRTFLPL
                     EMDFSPTHAGQENVINISNFVQKLADKFQPRINSFFNTRFQLSYTFEDGKYKIMYGIF
                     EDHSYFTEKTWNSNYIDLHVFSRYLSKFCFSTAEVDDDSGNMSNSQYEREWKSFVTMG
                     DIFNLVDYLLKGKSSFIQSNSHLLKHIKNGGSLRSAAEKYDLSVRMNKHRILSNVRKY
                     IKGKRIMSAKNFQALSTDDNPDRDFHCGLFDQVMGYYNDLGINDFQESDGMYVIELRQ
                     FEDVIRSIADKYVYEKYVLPASSRTV"
     gene            complement(<598384..>599337)
                     /locus_tag="HG536_0G03420"
                     /db_xref="GeneID:59327721"
     mRNA            complement(<598384..>599337)
                     /locus_tag="HG536_0G03420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285258.1"
                     /db_xref="GeneID:59327721"
     CDS             complement(598384..599337)
                     /locus_tag="HG536_0G03420"
                     /inference="similar to AA sequence:RefSeq:NP_009941.2"
                     /note="ancestral locus Anc_1.430"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141154.1"
                     /db_xref="GeneID:59327721"
                     /translation="MAEDMRRIIICDFDETITDRDTIGILGQLPYAVKPGFEPKWSHF
                     TDTYMENYRKFLEDPVLLECDHNLGRRLPLLPSNDGDITRSNFQCLFKDEIRYQTDAR
                     NLEISSTSEMAKYGLFAGLTHSQVSHFVKEKMREHSFSLRNGFRDFMSSISAPQFFIV
                     SVNWSAEFIRGAVGEELVDFDNICCNQLVSNGDTFTGQFSNQLLTGSDKVSFIEKIFK
                     EQCCRDIEQQYWYIGDSETDILALLHPEVNGVLLIDPELKEQKFRKLTTEVLGIDESL
                     VNRFISSKEVGWLRCYVKNQENSLYLAKSWFDLTNINTNTD"
     gene            600087..600170
                     /locus_tag="HG536_0Gtrna15L"
                     /db_xref="GeneID:59327888"
     tRNA            600087..600170
                     /locus_tag="HG536_0Gtrna15L"
                     /product="tRNA-Leu"
                     /note="codon recognized: UUA"
                     /db_xref="GeneID:59327888"
     gene            <600447..>601274
                     /locus_tag="HG536_0G03430"
                     /db_xref="GeneID:59327722"
     mRNA            <600447..>601274
                     /locus_tag="HG536_0G03430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285259.1"
                     /db_xref="GeneID:59327722"
     CDS             600447..601274
                     /locus_tag="HG536_0G03430"
                     /inference="similar to AA sequence:RefSeq:NP_009942.2"
                     /note="ancestral locus Anc_1.431"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141155.1"
                     /db_xref="GeneID:59327722"
                     /translation="MSSQHIPAWQRIKIKQTQTDENKAEAGFDEEDPLNITTHLATGS
                     LTRREKQRLIKGDQNASRVAKKKAKTTNRKKEKLAKDVRSEIKRKTVLKDQLRYLIDF
                     YLEKSSERLPDAIQNSENVKTNYSEEKLHKAGSDGNSGVVDVWKFSKQKQNWLIKHFC
                     DLEEIPVAYDDLIILYFKDLKGEGLKQSISERCRGKVKEWNDYVQLEMDKIKAIVDGK
                     EMESEQSKEGDEEEKKTDKAKEVEQALQIPPNRDIAQRCLKLLEAWDSAAELQLLSI"
     gene            <601568..>602092
                     /locus_tag="HG536_0G03440"
                     /db_xref="GeneID:59327723"
     mRNA            <601568..>602092
                     /locus_tag="HG536_0G03440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285260.1"
                     /db_xref="GeneID:59327723"
     CDS             601568..602092
                     /locus_tag="HG536_0G03440"
                     /inference="similar to AA sequence:RefSeq:NP_014401.1"
                     /note="ancestral locus Anc_1.433"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141156.1"
                     /db_xref="GeneID:59327723"
                     /translation="MKNHQVSMTEDRMSQKDMPNVTDIDWSREALHSLLHIVTDLDRL
                     PKEYNAFLQPLFNKIKKDEGLSAAALEKCKLAFASWDGQEHNGLDELAIKRCMDLWLT
                     IKGEDYPLKKALSNPANLVVQEVEVCDFVDKHDLRRIEFDSATGEPIENSLGNLIIEE
                     VEAADYVNSSETSD"
     gene            complement(<602183..>605152)
                     /locus_tag="HG536_0G03450"
                     /db_xref="GeneID:59327724"
     mRNA            complement(<602183..>605152)
                     /locus_tag="HG536_0G03450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285261.1"
                     /db_xref="GeneID:59327724"
     CDS             complement(602183..605152)
                     /locus_tag="HG536_0G03450"
                     /inference="similar to AA sequence:RefSeq:NP_009943.2"
                     /note="ancestral locus Anc_1.434"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141157.1"
                     /db_xref="GeneID:59327724"
                     /translation="MNMVTINGKVIPLAHTVCAFAAFFTALVAGYSLHFHKIVQNAHY
                     GYPDEWFPSVSATIGDRYPERSIFQILIALTSFPRFLLLLGHFYLNGSITCLTIGVIR
                     TVSCGGWVYITSTDDHDIHDVFMITYIVLTLPWDIMVVRLSTTGKLLKGSVAALFFGL
                     LIPLIYWFIKHQVEHVPGAYSIYAYFEWSLIILDILFDSLAYKEFDRLRINLRLKDSD
                     DGGWLFQICNQIQDLDLTVEDEKSFTKIDAETTGVSIEEDTHAEVIRSTDEEIEIVLE
                     KTENVTVISQADATPRCTSFLYILTNTLNSFMFWTAVTSLTCSIWYFPLWYMGISGYE
                     AAMLYFLAPLFLYIPMMPTVFYQYGVLLGGLIVVGAHLVGTPEARLLVTGVGTAITVA
                     TFVLNLKSIAEKDTNSYFSTTWLLGLVLSVVIKMGCYSNNPLWPIMNSGNGGYNLLGL
                     SLATVLGMLSPYINSAHFVRVTPESSQSPAGLVSKILTGVGFGSLIFGIHQLLTDAST
                     VIYWSWEGYDQQNQGPLSWPWSGLTCLTMLMATVTSHKFSGKPFIPAVLLALSTAVLC
                     DGRATGWNKYVCGGLVYVTAMVWFVPTYFSALAINASIFSFALSFFVYIVMVLAHVWV
                     VAYAFVPFGWVLRERIWIVLAISTACIIVGSVAARFSIRNSSDGKSAPSNAFIKRMGL
                     LAVLTVGMIASFTYHQRPTGVPAPYHPDSKVLTAGIWTIHFGLDNDMWSSEESMIFLM
                     KEMQLDVVGLLETDTQRIVMGNRDLTSKLGHELNMYADYGPGPNKHTWGCILLSKFPI
                     INSTHYLMPSPDGELAPAIHATIKTYDDILVDVFVFHGGQEEDVEDRRLQSEALSKLM
                     GSTDRPSILLSYLVTNPHEGNYNTFVSEESGMHDIDPEDDDRWCQYILYKNLRRTGYA
                     RISRGKVTDTELQVGKFQVLNQTQLAELGDNIYDYEKTDDPENDDFRFPDKFFDEGER
                     GHCYHVFDKPLYYSSSN"
     gene            605544..605616
                     /locus_tag="HG536_0Gtrna13K"
                     /db_xref="GeneID:59327882"
     tRNA            605544..605616
                     /locus_tag="HG536_0Gtrna13K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59327882"
     gene            complement(<605720..>607834)
                     /locus_tag="HG536_0G03460"
                     /db_xref="GeneID:59327725"
     mRNA            complement(<605720..>607834)
                     /locus_tag="HG536_0G03460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285262.1"
                     /db_xref="GeneID:59327725"
     CDS             complement(605720..607834)
                     /locus_tag="HG536_0G03460"
                     /inference="similar to AA sequence:RefSeq:NP_010905.1"
                     /note="ancestral locus Anc_1.435"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141158.1"
                     /db_xref="GeneID:59327725"
                     /translation="MSTKVPENVKGAVDFDPWLTPFADVLSERRFLADKWAYDITHAT
                     PDGSYQSLTKFARDSYLSYGLHADLQSKEIRYKEWAPNAKRAFLVGEFNEWDETSHEL
                     KHKDEFGNFSITIPPKSNGEFAIPHDSKIKVMFVLPDDSKIYRIPAWITRATQPDETT
                     AKAFGPAYEGRFWNPPNPYRFAHQRPSFNEHTGSLRIYEAHIGISSPEPKIATYKEFT
                     QNVLPRIKKLGYDAIQLMAIMEHAYYASFGYQVTNFFAISSRFGNPEELKELIDTAHG
                     MGILVLLDVVHSHASKNVEDGLNRFDGSDHQYFHSVSSGRGEHPLWDSRLFNYGSFEV
                     QRFLLSNLAFFIDVYQFDGFRFDGVTSMLYLHHGVGESGGFSGDYNEYLSRDRSHVDH
                     EALAYLMVANDLVHELLPESAITIAEDVSGYPTLCLPRSMGGAGFNYRLAMALPDMWI
                     KILKEQKDEDWDMAKIVYTLTNRRHGEKVVAYCESHDQALVGDKTLAFWLMDAAMYTD
                     MTVLKPNTPVIDRGIALHKLIRLITHSLGGEAYLNFEGNEFGHPEWLDFPNKNNGESF
                     HYARRQFNLVDDDLLRYKHLYEFDAALQNCEREHQWLNTPQAYVSLKHEVDKVIVFER
                     NGLLFIFNFHPTQSFTDYRIGVETPGCYRIILNTDRKQYGGFDRIDESSKFFTTNMAW
                     NNRKNFIQVYIPSRVALVCALE"
     gene            complement(<608208..>608816)
                     /locus_tag="HG536_0G03470"
                     /db_xref="GeneID:59327726"
     mRNA            complement(<608208..>608816)
                     /locus_tag="HG536_0G03470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285263.1"
                     /db_xref="GeneID:59327726"
     CDS             complement(608208..608816)
                     /locus_tag="HG536_0G03470"
                     /inference="similar to AA sequence:RefSeq:NP_010904.2"
                     /note="ancestral locus Anc_1.436"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141159.1"
                     /db_xref="GeneID:59327726"
                     /translation="MKLLMSDHEVELVNDNMQEFHVKFCGPKDTPYEGGVWRLHVELP
                     DNYPYKSPSIGFVNKIFHPNIDVASGSICLDVINSTWSPLYDLKNIVEWMIPGLLKEP
                     NGSDPLNNEAATLQLRDKKLYESKIREYIDKYASEERYNQLFGGDEGASGDDVDSVDL
                     EDEDDEDDDDEDEELAADGTGGESLEDSDGLSDELSDIDMSS"
     gene            complement(<609096..>609332)
                     /locus_tag="HG536_0G03480"
                     /db_xref="GeneID:59327727"
     mRNA            complement(<609096..>609332)
                     /locus_tag="HG536_0G03480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285264.1"
                     /db_xref="GeneID:59327727"
     CDS             complement(609096..609332)
                     /locus_tag="HG536_0G03480"
                     /inference="similar to AA sequence:RefSeq:NP_009949.1"
                     /note="ancestral locus Anc_1.437"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141160.1"
                     /db_xref="GeneID:59327727"
                     /translation="MASLRDNGGAETSKISQRKYNNVTLRTLTAHQLMAQREKMCELF
                     QLVDDSDRHSKIVDVERQKQILEDMKKQVDQLKD"
     gene            <609458..>609730
                     /locus_tag="HG536_0G03490"
                     /db_xref="GeneID:59327728"
     mRNA            <609458..>609730
                     /locus_tag="HG536_0G03490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285265.1"
                     /db_xref="GeneID:59327728"
     CDS             609458..609730
                     /locus_tag="HG536_0G03490"
                     /inference="similar to AA sequence:RefSeq:NP_009948.1"
                     /note="ancestral locus Anc_1.438"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141161.1"
                     /db_xref="GeneID:59327728"
                     /translation="MDKLRLPDFIGSTLHISLGDKRVLTGTLMAMDCQLNLLLDHVRE
                     TRLDDGNQRLLGLVSVPRATISSIKLDRDTLEHLCRLRQEFMRQVV"
     gene            <609882..>610550
                     /locus_tag="HG536_0G03500"
                     /db_xref="GeneID:59327729"
     mRNA            <609882..>610550
                     /locus_tag="HG536_0G03500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285266.1"
                     /db_xref="GeneID:59327729"
     CDS             609882..610550
                     /locus_tag="HG536_0G03500"
                     /inference="similar to AA sequence:RefSeq:NP_009947.1"
                     /note="ancestral locus Anc_1.439"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141162.1"
                     /db_xref="GeneID:59327729"
                     /translation="MQGNWGSMATTTECLLAKYQDTFKKATEHQLTKELCQGTLEDAI
                     LYTYLAQDLQFFETGLRLICKVTSLAPSVDSLITLAKKIGFFANDENTYFRDALELLK
                     PAVEASRREFLGKEQIGSIKKYVGFLAEMTEDASYSYGQLVTYLWCAEEVYWKWAHDL
                     PRAENLHWKHQTWIDLHDGEHFQVWCEFLRKEVDKYSLEEVESVFQKTLQLEYEFFDE
                     CYNA"
     gene            complement(<610553..>611635)
                     /locus_tag="HG536_0G03510"
                     /db_xref="GeneID:59327730"
     mRNA            complement(<610553..>611635)
                     /locus_tag="HG536_0G03510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285267.1"
                     /db_xref="GeneID:59327730"
     CDS             complement(610553..611635)
                     /locus_tag="HG536_0G03510"
                     /inference="similar to AA sequence:RefSeq:NP_009946.1"
                     /note="ancestral locus Anc_1.440"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141163.1"
                     /db_xref="GeneID:59327730"
                     /translation="MMTAGNNKPLITTNGMFIIDEIIDRKGNIHQNVAGGGGMFAMLG
                     GCIVSPSRQVAGSLRWIVDCGYDFPAKLKERIESWQSGALFREDFTRETTRGWNGYGD
                     GDLRQFRYLNEKKAITAADWEEFGMDNVSKIECVHFICSGERCSSLIEEMKDLNCRPK
                     VIVWEPVPDLCDKTHFAEISGILALQDDYTVIFSPNAEEGARLLGDKEPLTVEEITQC
                     IWKFDDILSDRHVCVLRCGKLGSMTLTSRNSATGKRTLKRFPAYHEDDVSKVVDPTGG
                     GNAFLGGFCVGYTATASLDVANTCGNIAAGCVIEQMGVPEFNPATREWNGLTLKQRLD
                     RYLERSPSLALHKSDQLCRLLSNRWE"
     gene            complement(611731..611802)
                     /locus_tag="HG536_0Gtrna6M"
                     /db_xref="GeneID:59327894"
     tRNA            complement(611731..611802)
                     /locus_tag="HG536_0Gtrna6M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59327894"
     gene            613329..613400
                     /locus_tag="HG536_0Gtrna8Q"
                     /db_xref="GeneID:59327899"
     tRNA            613329..613400
                     /locus_tag="HG536_0Gtrna8Q"
                     /product="tRNA-Gln"
                     /note="codon recognized: CAA"
                     /db_xref="GeneID:59327899"
     gene            complement(<613609..>615309)
                     /locus_tag="HG536_0G03520"
                     /db_xref="GeneID:59327731"
     mRNA            complement(<613609..>615309)
                     /locus_tag="HG536_0G03520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285268.1"
                     /db_xref="GeneID:59327731"
     CDS             complement(613609..615309)
                     /locus_tag="HG536_0G03520"
                     /inference="similar to AA sequence:RefSeq:NP_010903.3"
                     /note="ancestral locus Anc_1.441"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141164.1"
                     /db_xref="GeneID:59327731"
                     /translation="MGACCSCLKDSSDEASVLPIADNEREAVTLLLGYLEDKDRFDFY
                     SGKPLKALTTLVYSDNLNLQRSAALAFAEITEKYVRPVSREVLEPILILLQSQDPQIQ
                     VAACAALGNLAVNNDNKLLIVEMGGLEPLISQMMGNNVEVQCNAVGCITNLATQDDNK
                     HKIATSGALVPLTRLAKSKHIRVQRNATGALLNMTHSEDNRRELVNAGSVPVLVSLLS
                     SPDPDVQYYCTTALSNIAVDESNRKKLAQTEPRLVSKLVALMDSTSSRVKCQATLALR
                     NLASDTSYQLEIVRAGGLPHLVKLIQSSSMPLVLASVACIRNISIHPLNEGLIVDAGF
                     LKPLVKLLDFKESEEIQCHAVSTLRNLAASSERNRKEFFESGAVEKCKELALDSPVSV
                     QSEISACFAILALADVSKLDLLDANILDALIPMTFSSDQEVSGNAAAALANLCSRINN
                     YSRIIDAWETPKDGIRGFLIRFLHSDYATFEHIALWTILQLLESHNDKVAELVKKDSE
                     IIGGVKRMADITFNRLQRVPPGSKNNEIDLSNSKSSEPAEDASVELYNITQQILQFLN
                     "
     gene            complement(<615734..>617323)
                     /locus_tag="HG536_0G03530"
                     /db_xref="GeneID:59327732"
     mRNA            complement(<615734..>617323)
                     /locus_tag="HG536_0G03530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285269.1"
                     /db_xref="GeneID:59327732"
     CDS             complement(615734..617323)
                     /locus_tag="HG536_0G03530"
                     /inference="similar to AA sequence:RefSeq:NP_010901.1"
                     /note="ancestral locus Anc_1.442"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141165.1"
                     /db_xref="GeneID:59327732"
                     /translation="MSQFFGFGIRVELKDGKLIEGKIAKATSKGLTLNEVKFGDGGTS
                     QAFKVRASRLKDLKVLSVATSKKEPKEQKLTQRSHSEGKDWQDDDVSKLKEQEDFDFQ
                     GNLRMFNKKDVFAELKQKDDVAPEDRLVSHNKKAKETNGRYQNDEMVIPNAKDDAWNA
                     ISSDDDDEYDDDDEEYYDVDNGTYLPVTKSINITHLLHSAKGGTDKDSQQGQVVAQLE
                     KMIKGQTRARSISAGPGNPASTALLKIKDSDQTVPMATPVQLMEIERVNSEQFGVTSD
                     IMLENFATNASFFLKHKLGGRTRLRRDNHNPEPLVVILTSDSNRSGARSMALGRHLCQ
                     SGHIRVIALFTCSAGDLQDSQVKEQYERFRKCGGKVVNSVGALKSTVDKLNSPVEIVI
                     DAMQGFDCSLTDLDESSSATQDYDTSTSMEARALDMINWCNLLQGQVQVWSLDIPSGY
                     DSGTGLANFGAMVSATGVISSGWPLAALKTVKQGGSYRLQECAAIDMGTPHCVYSQRT
                     SLRKFQSRDLFITEGFITLEF"
     gene            <617547..>618188
                     /locus_tag="HG536_0G03540"
                     /db_xref="GeneID:59327733"
     mRNA            <617547..>618188
                     /locus_tag="HG536_0G03540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285270.1"
                     /db_xref="GeneID:59327733"
     CDS             617547..618188
                     /locus_tag="HG536_0G03540"
                     /inference="similar to AA sequence:RefSeq:NP_009956.2"
                     /note="ancestral locus Anc_1.443"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141166.1"
                     /db_xref="GeneID:59327733"
                     /translation="MEYKRGSSTATPPASSFQRKIAVLGARNVGKTTLTVRFVESHFV
                     ESYYPTIENEFTKIIQFKNHNYTLEILDTAGQDEFSLLNMQSLMGVKGIVLCYSVANR
                     SSFEMVPVIWEKLVDQLGRDNLPVIVVANKIDIRDGDRSNSKRYVSRLEGEQMASGIA
                     SSDRKLQAGFIESSAKEDINVDAAIMLLLKKMEIAESGGSFDGSSDAKGCRVM"
     gene            complement(<618287..>619339)
                     /locus_tag="HG536_0G03550"
                     /db_xref="GeneID:59327734"
     mRNA            complement(<618287..>619339)
                     /locus_tag="HG536_0G03550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285271.1"
                     /db_xref="GeneID:59327734"
     CDS             complement(618287..619339)
                     /locus_tag="HG536_0G03550"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141167.1"
                     /db_xref="GeneID:59327734"
                     /translation="MTTETQNHIREGPTVIGVDDSAAREAAHVEEVTANTANRLSDGI
                     VCGATPDTPSIPLVSDIVPNYRLDGHVTIVTGGSGGLAHTLCQALVAQGSELALVDLT
                     VDKLSIVEGDLKEFIRVNKLAPVTISTWACDVSDSTQVEELVRAIPHEHQGLLPDKLV
                     HTAGYCQNIPAADYPAARAEHLVKVNLMGSLYICQAMTRQLLEKTKRRKSISAMANSA
                     AEALPRFPNASYVLIASMSGMIVNTPQPQVAYNMSKAGVLHLVKSLACEWARYGIRVN
                     AISPGYIATPLTKQVIGASPEGAALQHEWTSRVPMGRMAEPKEFVGAMLYLLSSHASS
                     YTTGENLVVDGGYTNW"
     gene            <620012..>622063
                     /locus_tag="HG536_0G03560"
                     /db_xref="GeneID:59327735"
     mRNA            <620012..>622063
                     /locus_tag="HG536_0G03560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285272.1"
                     /db_xref="GeneID:59327735"
     CDS             620012..622063
                     /locus_tag="HG536_0G03560"
                     /inference="similar to AA sequence:RefSeq:NP_009955.2"
                     /note="ancestral locus Anc_1.444"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141168.1"
                     /db_xref="GeneID:59327735"
                     /translation="MSDIDSLASVSGGNEEHILEEDYLNDERRATIGHWGRLKYWITR
                     NLLSRDRSNESWQGHGIPLYELNAEGQEMSGTIEPAATFVYRHSNKIPWRLIARFIGL
                     SFFFVITAFLIFGVIESGPKKGRFSTSALFDPYVRYSNGTLDFFPLTVMVSLDGFHPS
                     LISKKYTPFLYQLYTLAYEGNVTSTPFMIPSFPSQTFPNHWSLVTGEYPRDHSLVSNV
                     FWDADLKEEFYPGLMDPLIWANTSRPIWQVLQAAFNHNSAKEFPFKVATHMWPGSDVN
                     FTGLPQVPAERMPYYIDAFDGDEKLETKLTKVLGYVDIDSIEKRPQLILSYVPQVDAF
                     GHKHGYPINDPENKMFDKFTQVLSSVDSFVEGLFEGLRERNVTNFTNVVIVSDHGMSN
                     IKFPEHVLIWEELLDKDLIKNHVEHAYGEGPMMAVTTKDSSDVNEIYQELKKSLANQG
                     ELGSKFKVYLNGNFPEHFKFNDLANRRIAPIWIIPEPGYAVMSHKFAKKQRSSLIGNH
                     GYDNHEAEMRSLFIGVGPFFENGYVEPFENIEIFDMLCDVFGVAMDDRLGDQQDTFFY
                     RKPLEQPLVDDFESLRAKYGNGTAYNIIWGGEQEEEEVVADTSGTSTTSSSSGTSTTS
                     SSSGTSTTSSTSTTRTTSTTSTTTSTTAAGGWLDDLLHDAEELIEELVDEIQEIADTH
                     H"
     gene            complement(<622104..>622895)
                     /locus_tag="HG536_0G03570"
                     /db_xref="GeneID:59327736"
     mRNA            complement(<622104..>622895)
                     /locus_tag="HG536_0G03570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285273.1"
                     /db_xref="GeneID:59327736"
     CDS             complement(622104..622895)
                     /locus_tag="HG536_0G03570"
                     /inference="similar to AA sequence:RefSeq:NP_010899.3"
                     /note="ancestral locus Anc_1.445"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141169.1"
                     /db_xref="GeneID:59327736"
                     /translation="MSSFSRWKKVELLDLAEKLRLPNVGNNVRKSDLIAMIEEHLNVL
                     NEPLDVEVDYPELKSFYDAIVVKHETEEAEAEEVEGEEAEDQLPERVLDGFNKLDFSE
                     ESDEDSTFKFAFEDYLSDVAVQVQKLNESLQDSLSTIQSVDALFYLVEFYFVVRPLVA
                     RQDAWLSSSTLVTWAVFSAGVPALVGYYVNFIRYELPEVQVDPMVFHLAKFLVGLGIL
                     NVELDASGSGWQLFFKLGLTSWVHYLGQLPLVFGLVGALLTIYIF"
     gene            <623425..>623544
                     /locus_tag="HG536_0G03580"
                     /db_xref="GeneID:59327737"
     mRNA            <623425..>623544
                     /locus_tag="HG536_0G03580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285274.1"
                     /db_xref="GeneID:59327737"
     CDS             623425..623544
                     /locus_tag="HG536_0G03580"
                     /inference="similar to AA sequence:RefSeq:NP_010898.1"
                     /note="ancestral locus Anc_1.446"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141170.1"
                     /db_xref="GeneID:59327737"
                     /translation="MLPAGVILVFVLVGLACIAIICTILYRKWQARQRGLQRF"
     gene            complement(<623919..>624671)
                     /locus_tag="HG536_0G03590"
                     /db_xref="GeneID:59327738"
     mRNA            complement(<623919..>624671)
                     /locus_tag="HG536_0G03590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285275.1"
                     /db_xref="GeneID:59327738"
     CDS             complement(623919..624671)
                     /locus_tag="HG536_0G03590"
                     /inference="similar to AA sequence:RefSeq:NP_010897.1"
                     /note="ancestral locus Anc_1.447"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141171.1"
                     /db_xref="GeneID:59327738"
                     /translation="MQPEISELIVLQIIHTLLVLQSPSSGSVGVISGKVSLVRLTNEI
                     QNNVLVNQMVERGEDKLDINDILVVVKRVFPNQRISLVDGQLSFHNLQLTELQNGIRE
                     RLHRFCHAQQAAIARLEDDILNPQRRTAAGGAGGGTNVDPKREKLLQLYRDTVLNKLQ
                     AKSGGKMDLQTLYETLNASGALDSAVRQVIEIDRIKNDTPSSVHDLQLVIQKSICDGV
                     MSCETDTDTWLAARQLQAHFDDTVQFMRRALE"
     gene            <624772..>625542
                     /locus_tag="HG536_0G03600"
                     /db_xref="GeneID:59327739"
     mRNA            <624772..>625542
                     /locus_tag="HG536_0G03600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285276.1"
                     /db_xref="GeneID:59327739"
     CDS             624772..625542
                     /locus_tag="HG536_0G03600"
                     /inference="similar to AA sequence:RefSeq:NP_010896.3"
                     /note="ancestral locus Anc_1.448"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141172.1"
                     /db_xref="GeneID:59327739"
                     /translation="MAKLPEALPIHRHARGAFHELSVGDVSRCYRAVAQQLLETYRHT
                     MDDPGEDVDAQMNELIAAYQELASLETSSRSLDARLESAKQKYRESSHNLEPVDLSWW
                     NRYSSKSPDGLPKLSDIFEREEISPGRRSRLTREDKLLDAIAYLWRDPTGMMPDEQNN
                     DEDVHIEGGKIELRCPITCQDFKQPMISKKCNHVFDLEGLQEYFKDHATRDCAQGGCS
                     QKLSMSDFEEDEIMRLRCQIEKVKKKSSTEEQIAMDVI"
     gene            <625829..>627295
                     /locus_tag="HG536_0G03610"
                     /db_xref="GeneID:59327740"
     mRNA            <625829..>627295
                     /locus_tag="HG536_0G03610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285277.1"
                     /db_xref="GeneID:59327740"
     CDS             625829..627295
                     /locus_tag="HG536_0G03610"
                     /inference="similar to AA sequence:RefSeq:NP_009953.1"
                     /note="ancestral locus Anc_1.449"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141173.1"
                     /db_xref="GeneID:59327740"
                     /translation="MVMVPFKHIVRNYGTVQQCVLPITIRDLYKRTANPPRTVKNVNG
                     WIRSVRLLKKMAFLDIQDGSCLHTLKVAIPIKKMDETAFLKGMKTGQSISIACAQWQD
                     TPQREQPFELKIEDPLESISIRGTVTHDYPLQKKNHSLLFLRSLPTLKHRTTYLGSLM
                     RFRSFAEQRLMNILQSDDFTKVSPPVLTSSDCEGAGELFEVKTASSKNYFGKPSYLTV
                     STQLHLEILAMSLSRCYTLTPCFRAERSDTNRHLSEFWMLELEMCFINDVRLLTMVVE
                     SVLRRLIESCCERSSELIPEITLQECLSKEEVLNRWNMLLNPEPWKVITYTEAIDILS
                     DKHRMAPFEKYEPKWGEPLQTEHEKWLAGVHFQSPVFITDYPRDCKAFYMKTNTSASP
                     GRETVACFDLLFPEMGEIAGGSIREDNYNELAQEMRRRGMNSSGELDWYLSLRLEGSV
                     PHGGFGLGMERLISYLFGNHNIRDAIAFHRSATGTIDL"
     gene            <627477..>629147
                     /locus_tag="HG536_0G03620"
                     /db_xref="GeneID:59327741"
     mRNA            <627477..>629147
                     /locus_tag="HG536_0G03620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285278.1"
                     /db_xref="GeneID:59327741"
     CDS             627477..629147
                     /locus_tag="HG536_0G03620"
                     /inference="similar to AA sequence:RefSeq:NP_010895.1"
                     /note="ancestral locus Anc_1.450"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141174.1"
                     /db_xref="GeneID:59327741"
                     /translation="MEIRITDYFTELLKDYGIDTVFGIVGIPIVELANTMIAQGIRFI
                     ACRNEQSASYAASAYGYLTGKPGILLVVGGPGLIHALAGIYNSMSNKWPLLVIAGSTE
                     DPYKGGFQELDQISLLRGHLKFTGKLSKDQQSIQLITYEAMRFAVGGIPGATYIDFPG
                     RLIEESIDVTGSRNVRSLPKIKYAPDPKAVSKVADLLSDSKNKRVLLVIGKGAVEHSV
                     QLRKFVDDFNVPFLPTPMAKGVVPDSHPLNVSSARSKALKEAEVVLILGARLNWILHY
                     GQAPKWNPNAIFVQVDNDPTSLGQNNSMGLSYALCGDLELTLRQLTFPLSRIGWKHNG
                     LSKELQDSIRANQEKLLLKETSATSAMLNYNQVYHTLRPLIDDSQTIIVSEGANTMDI
                     ARISFPTDYPKHRLDAGTNATMGIGLGYAIAAKLSDPEKNVILIQGDSAYGFSAMELE
                     TAARNQLALVVIVMNNSGIYHGTQQDSLSKAPSTALSKECRYELVGKGLGTNGFLVRT
                     LPELKAAFQKALNASRTDKRSSVINVIIEPGEPRKIAFGWQTGKRQSL"
     gene            complement(<631688..>631951)
                     /locus_tag="HG536_0G03630"
                     /db_xref="GeneID:59327742"
     mRNA            complement(<631688..>631951)
                     /locus_tag="HG536_0G03630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285279.1"
                     /db_xref="GeneID:59327742"
     CDS             complement(631688..631951)
                     /locus_tag="HG536_0G03630"
                     /inference="similar to AA sequence:RefSeq:NP_010894.1"
                     /note="ancestral locus Anc_1.452"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141175.1"
                     /db_xref="GeneID:59327742"
                     /translation="MDQLNGREQQEFQKLVEQKQMKDFMRLYSNLVERCFADCVNDFT
                     SSKLTSREQSCIMKCSEKFLKHSERVGQRFQEQNAALGQGLGR"
     gene            complement(<632136..>632942)
                     /locus_tag="HG536_0G03640"
                     /db_xref="GeneID:59327743"
     mRNA            complement(<632136..>632942)
                     /locus_tag="HG536_0G03640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285280.1"
                     /db_xref="GeneID:59327743"
     CDS             complement(632136..632942)
                     /locus_tag="HG536_0G03640"
                     /inference="similar to AA sequence:RefSeq:NP_010893.3"
                     /note="ancestral locus Anc_1.453"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141176.1"
                     /db_xref="GeneID:59327743"
                     /translation="MSTATYQERAARHPSPVASKLLSLMHEKKTNLCASVDVQTTAEL
                     LKLVDTLGPYICLLKTHVDIISDFSFEGTVKPLKELASKHNFLIFEDRKFADIGNTVK
                     LQYSSGVYKIAEWADITNAHGVTGAGIVTGLKQAAQETTTEPRGLLMLAELSSRGSLA
                     HGEYTKGTVEIAKTDKDFVIGFIAQRDMGGRDEGFDWLIMTPGVGLDDKGDALGQQYR
                     TVDEVVSTGSDIIIVGRGLFAKGRDPKVEGERYRAAGWKAYEKRCQARAV"
     gene            <633143..>634450
                     /locus_tag="HG536_0G03650"
                     /db_xref="GeneID:59327744"
     mRNA            <633143..>634450
                     /locus_tag="HG536_0G03650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285281.1"
                     /db_xref="GeneID:59327744"
     CDS             633143..634450
                     /locus_tag="HG536_0G03650"
                     /note="ancestral locus Anc_1.454"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141177.1"
                     /db_xref="GeneID:59327744"
                     /translation="MSSDDDSAKTASASQLPYDNRSSSLIGALTAGGRSIVYQMTSFY
                     LRTPLKLFRPPRFDYLHYVRIVLTGEENERGLPNDSASHRRLGVARSKYFNYLENSSL
                     GILTKALNKYGWKVIPDRILPPLIVNSATGVVLYTTYLTSFNHFSSKSTPTSSAKNPW
                     DVWRSGFVAGAMQALVSTPIDAIYARSSTSEFLSVAKKYDSLWMYGLDKLKEIGMIGC
                     FGGFGLALVKESLGFAVYFTTFELMKGQVCTWFKTVVRQYAEVKYVIHNTKLADLIPS
                     TTPSPPTEQAKIEFLSKKEEKWLNRAFIFVGGVTAAFLLQVVQYPFKKIQKIHQSRLE
                     AFDIVSRSLNHQPATASSLSKATKIWVSEPASRRLHIYYNSYLDTFEHVLFIHKNTNS
                     MMRWLYKGFARNTLAIIPGTTAGLLMLDYMRSSFEQSLLQVND"
     gene            complement(<634598..>638833)
                     /locus_tag="HG536_0G03660"
                     /db_xref="GeneID:59327745"
     mRNA            complement(<634598..>638833)
                     /locus_tag="HG536_0G03660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285282.1"
                     /db_xref="GeneID:59327745"
     CDS             complement(634598..638833)
                     /locus_tag="HG536_0G03660"
                     /inference="similar to AA sequence:RefSeq:NP_010892.1"
                     /note="ancestral locus Anc_1.455"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141178.1"
                     /db_xref="GeneID:59327745"
                     /translation="MNLDSPGSAAAVDPVTIVIKECINLSSAMRKYSKYTSQSGVAAL
                     LGGGSDIFSNQDESLVSTFNNLSANRSNDPLLSGFIQLRLMLNKAQGLENIDSLTLLQ
                     PFLLVISTSSVSGYITSLALDSLQKFLTLNVINESSLNHRAAYHETVNSLTHCRFEGS
                     EQLSDDSVLLKVVILLQTIIQSRCGDLLSDAIMYDVLQTILSLACNKRRSEVLRRAAE
                     STMIAITVQIFSKLKHIDPTNLAQKYINDESYANNELQDDVIGTTAGKDDATSDHDTK
                     EDQSLPSANADISKLDPTEIKATRITDPKYGLPVIKQYLNLLLSLIVPENQTKHTNSA
                     RIFGLNLINTAVELAGDIFPLHPRLFSLISDPICKYVLFIIQNSNKLSLLQAALQLFT
                     TLVIILGNHLQMQVELTLTRIFTILSQSASQSNNEAKERPAAVKELLIEQISILWTRF
                     PCFFTSTFITFDCNLDRADLSIQFLNSLTKLALPEAALTTTDSVPPICLEGLVYFIDE
                     MYDHLQSVNREIFLSGDASIHLLEQRERKKEFIKCATIFNDKPKKGIPLLIEKGFIKS
                     NTEEAISGFLFENNSRMNKKTIGLLLCDPTKATLLRKFIDLFDFKGLRVDEAIRILLT
                     KFRLPGESQQIERIIEAFSARYVECQSYDSNEINNEATDDVRAVQPDADSVFILSYSI
                     IMLNTDLHNPQVKEHMSYEDYSGNLKGCYNQKDFPTWYLERIYSSIRDKEIVMPEEHH
                     GNDRWFEDAWNNLISSATVLTEIAKDSTSAIEGLSPEELAHFDKAIFKQVGSSIAKTL
                     FKIFQVASDDHISTRMLTSIDKCSYIASFFNIKGLYNDILGRISELTTLVPAASTAKR
                     QSSDADEIPLVEIAMEDCNTSIVVSTESVRLGRSFKGQLCLVVLFRILRRKNSPGVIN
                     DELWSKIVQVILVLYENLLISPDVFPEIQQRLKLGSLRRPEPEISIKKARENKGLLSA
                     FASYLKGDEEPTEEEIDASIKAIQCIASTDVASSVFRNETNIAANLVKVLLSSIKKDI
                     SSENGRFFESEMLFLVELSVALLHIHNLGEDVASILLDRVTALSQSVTLSKAAVMRLA
                     SYRMLLLSAVDECHSPLLELINKDLLGKNEVFTQKYFAGDAGSEVLHGILGLTENGQN
                     RKHILKDAGFWKLLRSLAAIRRHTKEIYQFLERCLLKSDGDLTEKNFMWILGLLDEIS
                     SAGAIGSKWEQEYDRLVRKGQKVDKENPYQDVVELSLKSINLTSLLLDEEVTTLRLTK
                     SETIALIQALSHQCLNPCQQIRSYSLKTLGVAITERIHFPSEEITTAEEVIDGGLLPL
                     LESNATRQENNVPIPEILAVISIFYLHCLRNKLATNQTFLKVLNVYNKFVDMPAVEKQ
                     LQELITEKKKIEKEFSQEENSSSQEVNEHVSEA"
     gene            <639069..>640256
                     /locus_tag="HG536_0G03670"
                     /db_xref="GeneID:59327746"
     mRNA            <639069..>640256
                     /locus_tag="HG536_0G03670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285283.1"
                     /db_xref="GeneID:59327746"
     CDS             639069..640256
                     /locus_tag="HG536_0G03670"
                     /inference="similar to AA sequence:RefSeq:NP_012566.1"
                     /note="ancestral locus Anc_1.456"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141179.1"
                     /db_xref="GeneID:59327746"
                     /translation="MGQLLQTYLDIAIDGKKIGRIVCQLREDKAPKAARNFYALCVGE
                     RPNGSANELSYKGNYFHRVIKNFMIQCGDITHCSGDFSKSDDAGKGGCSIYATNEELE
                     RSGDENSNAGCLGNFEDENLGEFTEPFLLAMANTGSQNTNSSQFFITTYPSPHLNGKH
                     SIFGKVIHGKSVVRTIERCKIDSDGFPELCIRIEDCGKWDESCGVPLFNASNDPIGGD
                     IYEEYPEDTEGIDSEDFTAAYEAADTIKQSGTLLYKKKDFQNSYFKYIKALRYINEYI
                     PDMDVDKGNNVKFTALKVKLYLNLSLVLYNLRRYDDAITYATYLLDMEDVPELDRAKA
                     FYRRGNSYLMKNNLESARSNFQMCKENNPNDTAIIHKIEYVDDLLERRKEKTKKSLGK
                     FFS"
     gene            complement(<640296..>644324)
                     /locus_tag="HG536_0G03680"
                     /db_xref="GeneID:59327747"
     mRNA            complement(<640296..>644324)
                     /locus_tag="HG536_0G03680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285284.1"
                     /db_xref="GeneID:59327747"
     CDS             complement(640296..644324)
                     /locus_tag="HG536_0G03680"
                     /inference="similar to AA sequence:RefSeq:NP_012567.3"
                     /note="ancestral locus Anc_1.457"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141180.1"
                     /db_xref="GeneID:59327747"
                     /translation="MSLRFLPGRPNDTQGSTCQVRWQEQIVFAYCSGNNVILLSNQFS
                     RLQTIYLEEDGIAVDINPANGFIAVAVGKTVNVYKPIYQVMKTPKWEFCCQIFHDDTR
                     VNSLCWGDSNEIAIGSNYLSFWKLRDEFGEYKPLLLWNKRQPRPVYQCKVSENSQLIA
                     SFGKYDSTVKLWRRISISGEQDIFNLTLLPHAAPVTTIRWKKSGPKCNDREFDELQVI
                     YILCTDKRLRVWSCYETDSNRTVQQWGSLQLSSEQKYCLLIDNWILRKCLGKGLPKLK
                     GIDEECDLALLGSPEGRFDVIMLTGLSVCPPRPMGRNQLPSKQVRCASFVNDPDFVYF
                     AEAQPYDSSSEMMSVVVHDLRGVIRQSVFNVRHLFDNEHSEIGELQNKLTGHNKSVQR
                     LVRSSDGEAMLTISRFSENCVWRPNKKDSASLQLTNIINTKKPIKLAIIHEKGQLVIC
                     LLENSKIQAWHCPRDRDEKKRSLLKAEYELPFIPELGEPVLMLNTPEQRHNHERHFIA
                     LIYRDGTVKAFKVSFATGIEEIQSERLNIVTERIYRVSTIDPVHSQFYSNRPLITLTT
                     EKGVITTYKALVDSEAQKIKWIKDFEVNTGIENIALIRGSSTGKLCIADSTGGKLSLW
                     DMKRGVLEYEECFDDIIEDIDWTSTAFGQSIVSIGFKSYALLYTQLRYDYTNHNPSYL
                     PIEKIDITAHTDHDIGDSIWLKDGTFVVASGNQFYVKDKYFDQNDPFTHHSIGSRKIL
                     SNDILHLSSVLNGPLPVYHPQFLIQALFANKLQLTKEILLRLFLELRKFNFGSEDLIN
                     LSSNLHIESDKFLIYHDRDYPETVFPDPFPEYNAKVSAALTEQLTKVTLPYLTRHQQI
                     TIITVIGALNDIMENESVVDYNGIRFLLGVKLFMSHKNTQKELLMRDVAWALHSDSKE
                     LLMAICGSNMVSWEKAREFKVAYWSRESDLLNLFEQIAKYEFSKNETRDPSRCAIFYL
                     ALKRKQILISLWKMSFGHPEQQKMLKFLSNDFSQPRWRSAALKNAFVLMSKHRFMDAA
                     CFFLLAKSLEDAANVLYKQVKDMDLAIAVCRVYEGDNGPALGGLLSKQVLPEAIIQND
                     RWMTSFIYWKLRKQHMAIKALVTQPIDLEENAELVNEEICIKRSFLVEDPALLILYSH
                     LRKRNINYFMGSLEIENRLEYSSVLRVTDILKRMGCEYLALSLTKNWEFIKDNQSHEN
                     GFQSPKVDEAGFTITSIANEPTKTELVRPSLFDKFLDSDSTFKNTGPRSDNVSSATET
                     RNLLDDFMTPSTNQSSPRNLLDDFSSSNSNSASTASQSILNEYRLNSRGTESSTDGVK
                     DMLQIDAKPAKNAPRSLLDDFM"
     gene            <644673..>644999
                     /locus_tag="HG536_0G03690"
                     /db_xref="GeneID:59327748"
     mRNA            <644673..>644999
                     /locus_tag="HG536_0G03690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285285.1"
                     /db_xref="GeneID:59327748"
     CDS             644673..644999
                     /locus_tag="HG536_0G03690"
                     /inference="similar to AA sequence:RefSeq:NP_012568.1"
                     /note="ancestral locus Anc_1.458"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141181.1"
                     /db_xref="GeneID:59327748"
                     /translation="MGASCKDQKKAVAVCLQRSPCVMIERNTPQRCIDDPNLNKDLPE
                     LCIAQMKAFLDCKRGMVDMTKRFTGNAPLSTGRYDQQYENLCSGKFNPREEMQKLNLL
                     DSSNRE"
     gene            645702..645811
                     /locus_tag="HG536_0Gtrna7P"
                     /db_xref="GeneID:59327897"
     tRNA            join(645702..645738,645775..645811)
                     /locus_tag="HG536_0Gtrna7P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:59327897"
     gene            <645984..>649166
                     /locus_tag="HG536_0G03700"
                     /db_xref="GeneID:59327749"
     mRNA            <645984..>649166
                     /locus_tag="HG536_0G03700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285286.1"
                     /db_xref="GeneID:59327749"
     CDS             645984..649166
                     /locus_tag="HG536_0G03700"
                     /inference="similar to AA sequence:RefSeq:NP_012569.1"
                     /note="ancestral locus Anc_1.459"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141182.1"
                     /db_xref="GeneID:59327749"
                     /translation="MDGKDADLQDLGVDVLDQSSLEKKIEKNAESLITQQLLEQEQKR
                     LERAKNALDKCKLKRDLIRRRLNNATRISVKLKLRQDIEEIENEELPPLITDVRDIQK
                     RIVELKTPNIRLDVKRDNQERRPDETEKDFLIRTGEITAFGSKTGFTLDKGQDDHKDS
                     WFSVKKEESHDFAMANEQMVENILGESPDENNQESEEYVDDELHEDDLLDTEEPEITS
                     RPGEARDDGDELYYQHRLRRWIRQRSSGRTHDPQPDLPEWLKAHPSISDAKLNDEFKV
                     PGDVFSLLFNYQRTCVQWLYELFQQKCGGIIGDEMGLGKTIQVIAFLAGLHHSNLLDG
                     PVLVVCPATVMKQWCNELHHWWPPLRTIILHSIGSGMDNKKKIDEGDLEELIMSSDPT
                     QVSYEDYKNSAKIKSHLESTSNLQSLVDKVVSDGHVVITTYVGLRVHRDILLNVDWGY
                     AILDEGHKIRNPDADISLTCKKLKTHNRIILSGTPIQNNLNELWSLFDFIFPGKLGTL
                     PVFQQQFVQPISTGGYANATNVQVQTGYKCAVALRDLISPYLLRRVKADVAKDLPEKK
                     EMVLFCKLTQFQRRKYLEFLHSKELDQIKTGKRQVLFGIDILRKICNHPDLLDREEKR
                     HQAAYGDPRRSGKMQVVKQLLLLWKKQHHKALLFTQSRQMLDILEEFISFKDESLSSL
                     KFLRMDGTTNISVRQSLVDEFNNGEYDVFLLTTRVGGLGVNLTGANRIIIFDPDWNPS
                     TDMQARERAWRIGQKREVSIYRLMVAGSIEEKIYHRQIFKQFLTNKILSDPKQKRFFK
                     VNELHDLFSLGGEDGHAIEELDEEVQKHTNELRHSKTQESDDFEQVVSMAGVSKLESF
                     YSGKEKKEKSQTEDDRLIEGLLGDNNLQDAMTHEALVHSHSNASKVIVEKEAAKAAEG
                     ALNALRKSRRETKKYSIDTPTWTGKFGQAGKVRKKTGNVKSQKMTGSSAILANMRAAQ
                     QQAKKSPLQHDELKQTDSADSERILGTIERYLSECPGYFASSLDIIGHIGVPLKDKDE
                     IIRVRALLKSIATFDRIKKGWILNEEFRSD"
     gene            <649359..>651341
                     /locus_tag="HG536_0G03710"
                     /db_xref="GeneID:59327750"
     mRNA            <649359..>651341
                     /locus_tag="HG536_0G03710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285287.1"
                     /db_xref="GeneID:59327750"
     CDS             649359..651341
                     /locus_tag="HG536_0G03710"
                     /inference="similar to AA sequence:RefSeq:NP_010891.1"
                     /note="ancestral locus Anc_1.460"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141183.1"
                     /db_xref="GeneID:59327750"
                     /translation="MGAKRHKNLILCFDGTRENFGPHPISNVLKLYQMLKNDDDKIQM
                     CYYQSGIGTEADFDPVVDIRRKLTLSHLQNITDAMFASSLEHHIVTGYIFLMENYEAG
                     DQIFMFGFSRGAFIARALAGMLERVGLLNRGLTGMVSMAWRIYEKWEFSEQPGQPDYS
                     STLADEFKRTFSRSYEVRIHFQGLWDSVNSVGILRDKLFPCTQRSAIVDHVRHAVSLD
                     ERRGKYKQQLFAPYPMLNQPASENDSQSHCNSLPSLASDSALQMDHAYSAPSLLCSTG
                     GETQISGPQDPKQTTSGQISCLNTARRAFINNSCSSSEVSNIDAENQDEFESRNRSTD
                     TRTGVSPDLIEKWFPGDHSDIGGGWGADCSTREDLSNLSIRWMIAEAFKHGVKFKPGS
                     VTSFASKHTNIGSLFSTIHDRLSFNQGIKLTALDEEDIEKPYIATSSQIGSSAVSWFG
                     KILIDLREMRKTESLTDEEAARESYSAKCQGIGKFETFLWWVLEFIPIGLRIETQAGK
                     WENVYNPNLGRHRYVPLNGDLHWSVFWRIKYDQRYRPSNLPSYARELLREFEGLELKT
                     DPVTNINTRALPLDTYPATKVGATNTTLSRERYQDAQTLMQSLLPAEDLAMIVTKQSA
                     KSRYLAMRKRFVRWAATCWQEFPDDLSELLQKNPGV"
     gene            complement(<651502..>652155)
                     /locus_tag="HG536_0G03720"
                     /db_xref="GeneID:59327751"
     mRNA            complement(<651502..>652155)
                     /locus_tag="HG536_0G03720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285288.1"
                     /db_xref="GeneID:59327751"
     CDS             complement(651502..652155)
                     /locus_tag="HG536_0G03720"
                     /inference="similar to AA sequence:RefSeq:NP_010890.3"
                     /note="ancestral locus Anc_1.461"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141184.1"
                     /db_xref="GeneID:59327751"
                     /translation="MFSLRNSVRTSLKSMCKTQTRLLSSSSIAAKSTYRTPNFGDAVQ
                     DDVNADKSRSFAYFMVGSLGLLSSAGAKSTVETFVSSMSASADVLAMAKVEVNLAAIP
                     EGKNVVVKWQGKPVFIRHRTAHEIQEANQVDMSALKDPQADSDRVKDPEWLIMLGICT
                     HLGCVPIGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPQYEFEDGKSKLIVG"
     gene            <654315..>657614
                     /locus_tag="HG536_0G03730"
                     /db_xref="GeneID:59327752"
     mRNA            <654315..>657614
                     /locus_tag="HG536_0G03730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285289.1"
                     /db_xref="GeneID:59327752"
     CDS             654315..657614
                     /locus_tag="HG536_0G03730"
                     /inference="similar to AA sequence:RefSeq:NP_012573.1"
                     /note="ancestral locus Anc_1.463"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141185.1"
                     /db_xref="GeneID:59327752"
                     /translation="MLDTINETHWIIDVLLLGRRNLLIVEPRRFLRGVYSDAMKWDDM
                     EVIKVSDDPTRPQSNNVAASLFWDPLLDREFIFLLKDSGTLEILDSELGIVDVCETGM
                     EQEARSRFLITDPTSGKVFVNLTDNAIYSLDIRRTNDSIRFVKDGGPPRCFYETSGEI
                     LFYEAVWHIDLESGGDFITIAVLVDTYVQSGLSFEVIRQTQKGLRSKKGEWESLIELT
                     RLVDLADPSSDAVAPAALKTVPNVGFFLFASNCTIFFDLPPGSRNSISGSKVTNYTLC
                     NGLQSDVLNEAQQKTLRLQRKVILKQGAKGLEFTVFTNSRYAFSARLDLIFEHPEEYI
                     DEWGELTVECAAILPAEAAEGFNNSVMNVITINPSTALIWSRRTGITFINLTTMCQIH
                     SLEFSQPSSLYAGTMGYDISRLIACCGFDGGEGYIQSISYGYKKLLLHKTDIITLKEN
                     VLSVWLTKDDLWWKTESGLLMSKYTIAESNPEVSYVTWSGQKLSTVESVLVSVNIWDD
                     DDGNFVWLNGDGVINWSMSHRSVKIASGKIPLDAQLQLACMKNPNGSYFTVVNVENKM
                     TLVSDETVTTTRDLGSGLESSSVCDLFIIPGPELRHMLIGTTDGSIKLFDLQTFRVQA
                     TLRVGSKKLRFCGIPKSRFIFAYTEEDLILVEIDRIEGYNISKVHFTSTINFMSARNI
                     GEIYIFDKKGLISCFEMPSTIDEPTEIRECLIVPSDCPTKFISFGCSNRLIVASSMRT
                     TYNAAQCANSYSSCLLLFDIESQEQLFSYDLSDRYPQAIISDIVAIPYEGPHVNGAPL
                     RKELLYAKRLTLSRCFLVALNFENAEDDTLDNLLLFSIDENKCTLDFHCSLKIHWVIT
                     ALSNYHANTFVVSGECLQIFTIDYLLQENAFRISQASNSVPVFGYPIKVLGKIPNIIS
                     STMEEGSKSTERSTTALVVNLLEGLQEYSVSSGQVSALHSSNRPTTYQIKPASGPRKR
                     VPFLLNSTESNRAIIDCALVLYDQVFWIAVAYSDCSLEVYCIESGKDGIQLLNRMAHI
                     KLDCQITALTTFGRTKQERPAGSENLDHMFSLSKPSGAQLFCVSTVRGGIYTLEESRL
                     RLWLDTQDDMC"
     gene            <658256..>661495
                     /locus_tag="HG536_0G03740"
                     /db_xref="GeneID:59327753"
     mRNA            <658256..>661495
                     /locus_tag="HG536_0G03740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285290.1"
                     /db_xref="GeneID:59327753"
     CDS             658256..661495
                     /locus_tag="HG536_0G03740"
                     /inference="similar to AA sequence:RefSeq:NP_010889.1"
                     /note="ancestral locus Anc_1.464"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141186.1"
                     /db_xref="GeneID:59327753"
                     /translation="MDNLKALDQVLRVEKSSVPPRRTGILYSTKLEGSIRFLGCQRLH
                     DERHYVVCTSEGLHLFDRTVLKASYGSFGRCFSYLYVETETKDLAPLHAMFMSDGHVQ
                     LFEIDHHSIELHTSFSISHQPVDYGRAFISAASSGAIYVSFDSQTIFQCNKVGNLREI
                     YKVGMGELMSFFFMRNGAFLFCLYRHKSTGHFYIEIAKFTTDKCFGDDEEDDSFYLPS
                     GTYITSNRHRLKAADQTNCYFKNLNDVCAICITSQHTYILEPESPLVTVKNLRGLNLR
                     DAIGVNGSAYLIESRNQYVVRASVFDGSGNVMESAIELRPKVPQRATWTQTPLLAGQT
                     FEQDELSFVDQLFTQNFSSYLLVSSLTGVSIVDRMKHSISIILPGQSKKVSDGNCIPK
                     DGSDLDSHIFCGAYTKSHGFIEKRTLVYETDIIQPIAKKQLLHHPVVNLWDIDRGLLY
                     ESMGYLYSTITDKRIIYFENSLWLTRNNVKIDVLQEGTVSVSEIDVAAEGTTCCVSVI
                     SVDGILKVLDYRDSEQSEILLSLDLGVTNIQNGKSAVLYSADDNCYYAICYHAHGCLK
                     FFRDAVRIRIQSMGMDYFLSDLLLKSANGGLYVVLTSIDGRAKVLEWESGKCVLDISA
                     SSGSSVKILDLGRRSPCVLFYNENDCILANLDGMVYGRLDIGTRPVKIITASSESEGM
                     VYLLDDNGCLNTLRFLSCYDYRSRMLSTVWKSDLYDLPDCVPMRLLPFSDPALAVLIL
                     KFKETGRLSASLFDYDKMCLVDSQDLGTSDSHLSNVLLRSLDDDSIPSESLRIFMKRF
                     LIICCATDRESNIHVLHLNGYKLERLHSEQLPFPVLSICLIKAGTKILLGGSQTVSYE
                     IKYEPKEHVITLNRMATNLVGKSAEHLRPPLFYSCRNNSCMAISLLGHYCEFDFSSSE
                     MGGSQVCSHRRLARFGSYPLVQVVTKRLPNRRDVGLQSEASTKGSSFKTSADILRTLS
                     ASLTTGPEEFYMLTIDCGGYVNLYNGAADAPIGHFRLTSPMLSASPIATQHVGLQLGR
                     LPGRRKDTRSLFMITCTDGLAYIVSEAYGFAKSDLGDARLLAIGSTTSG"
     gene            complement(<661541..>661921)
                     /locus_tag="HG536_0G03750"
                     /db_xref="GeneID:59327754"
     mRNA            complement(<661541..>661921)
                     /locus_tag="HG536_0G03750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285291.1"
                     /db_xref="GeneID:59327754"
     CDS             complement(661541..661921)
                     /locus_tag="HG536_0G03750"
                     /inference="similar to AA sequence:RefSeq:NP_010888.1"
                     /note="ancestral locus Anc_1.465"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141187.1"
                     /db_xref="GeneID:59327754"
                     /translation="MSAPNPKAFPLADEALSQQILDVVQQASNLRQLKKGANEATKTL
                     NRGISEFIIMAADCEPIEILLHLPLLCEDKNVPYVFVPSRVALGRACGVSRPVIAASI
                     TTNDASSIKNQIYAVKDKIETLLI"
     gene            <662317..>664623
                     /locus_tag="HG536_0G03760"
                     /db_xref="GeneID:59327755"
     mRNA            <662317..>664623
                     /locus_tag="HG536_0G03760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285292.1"
                     /db_xref="GeneID:59327755"
     CDS             662317..664623
                     /locus_tag="HG536_0G03760"
                     /inference="similar to AA sequence:RefSeq:NP_012574.1"
                     /note="ancestral locus Anc_1.466"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141188.1"
                     /db_xref="GeneID:59327755"
                     /translation="MSGAYSRLGKGDDGRNRFENIAETQNFDSFVTIDLVSEENTPIS
                     GKYGDRYDFGVRFRRLRKLIWDRCSTVVTLTLIAVTIGCIAGFLQIFTETLVNWKTGY
                     CARNWLLNKSFCCVEKEVLSSQKSPLLTKRQEMECVNNGLWATWSFGPLPFLIFFSLS
                     VLFALVSTLLVKHVAPMATGSGITEIKVWVSGFKYKDEFLNLSTLVVKSIALPLTISS
                     GLSVGKEGPSVHYAACCGYVITSWLLRDALTFNKQADYLTAASGAGVAVAFGSPIGGV
                     LFGLEEIATAREYTASALWKSFYVALGAVATLEYINPFRSGKIVLFNVTYDKDWRVQE
                     IPVFIILGIFGGLYGKLVSKWNINYVHFRKTYLSKWPVQEVLVLVIITSSISYFNEFL
                     KLDMTESMGILFHECQTNDNSSAFTHRLCQLDENTHMVSFLRVFCSLVIATVVRAILV
                     VVSYGAKVPAGIFVPSMAIGATFGRALSLLVERFVSGAGVITPGAYAFLGAAATLCGI
                     TNLTLTVVVIMFELTGAFIYILPTMLVVAVTRMVLSSSGTAAGIADQMILVNGFPILE
                     EDDLGEFMSEYTARDIMAEDLITINDDIYLSELESLIYDTSQKSVNGYPIVQNQSEET
                     SGKKCVGYVLRRHLITKLRVSETSSLDSNLTLVSFTRNLPPPTPDVAGQSLLSFKDIA
                     NPYPVTVKPEVLTSSLFRMFRKLGCKAIMVEECDVLKGLITKKDILRFERTKREEIFG
                     PRYRFNASFDQKLWSIVERIIQRFSYAE"
     gene            complement(<664688..>668167)
                     /locus_tag="HG536_0G03770"
                     /db_xref="GeneID:59327756"
     mRNA            complement(<664688..>668167)
                     /locus_tag="HG536_0G03770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285293.1"
                     /db_xref="GeneID:59327756"
     CDS             complement(664688..668167)
                     /locus_tag="HG536_0G03770"
                     /inference="similar to AA sequence:RefSeq:NP_012575.3"
                     /note="ancestral locus Anc_1.467"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141189.1"
                     /db_xref="GeneID:59327756"
                     /translation="MEIPRTTEALTKLLRSKEISTREICEVVSQLDQLHLYFPNKENF
                     ILELIVDRWNDQKLSGYKKDHRIWKLFNELWMALGDEVILKRLLKKLRFVPHLIQTLQ
                     IVDSEFLVFLQTLKHTCSLINSLTTVEVSLDNANVIIGGALELLLKIPPSERDAEAAF
                     EFMNEIETLVDVRNMAEVFARSTASYCSQLLLPSLKYFAEFKDSNDPIAALLTERLGS
                     FVFGRSVDTVKLLDRFVQSKSTELSSQNCSALFSKCILFLSKEHFKELEKIFSILIRI
                     HPELCSELLGELSLSKKTMSQGFLQGLFEDSISAIQRDTTNLELWQLIYYILTLDIEI
                     GIKNSEQILALISKGRDQCIDWSIKLWSQLIKCHRNARELPQFFDKLESYCQQNSDSA
                     FLINDDKFAEFLSDCLTTFSATQLKNELSEYLDVLQNSPANKLNAQLLIVLLKGLPKL
                     AYATLADYRILLKRVFDLKLDDQKLCWTARYLVMGVFDDIIPEEILDSPEKLMETSNL
                     SCKSPIELFYYLLKLREYRAFDMLPVIDPFMKKISSLPVEEQSGVLRIVFNNWSTIIS
                     SLFPQSEVKRLVDMVFTEDRIFILDDILNNDDVFEEQGIMHFIIRSVSQSYEDQSTLR
                     FLLKVPIQCITKSIRIDLINKISQKADITETDMQVLVHLLKNATFRSDIEKDWYALQS
                     FMVAKMKDLTYQNSVFETVWLNHLAQIKESVSEAFIQRGIESLYDQLRTEECDPACFQ
                     IAFLVLKSTTSDESQRLRSIYVEKAVKLFMDGTINKDLKMTSWLLRTLYQIFKAQGLH
                     YCQEIPYKEALSRFIKSRFTGIQKTDNDLLISMFLLYSILYSTELEYLYAQYMVLRGA
                     GIEATLLTAGIETAVRLSQEQDVKTFNRAFASTFESFESCPPDFANALLELYQLQIKL
                     LDKGNNAAGKLFLRSVSDFYTHCSKFDPLVESISKIMNCIGELLISKAWLFSQYCIEM
                     LFPLCLRLNLIFVDSTVDGYSDQIFITTMKVISNVLFTQRIKLSNRHHIVIAFLCENL
                     ELLSAYKDTKLTFESAKSLARLIINLCEPNSSLVKQASGRNILNSRTSEIKSSLRKHV
                     PALLIRYIHLSVHSPFDPRARSQLTTAIYSIFDLLSQDGLSLVNSALDHAGRQYLRGL
                     YADYKKYGKWLAD"
     gene            <668494..>670698
                     /locus_tag="HG536_0G03780"
                     /db_xref="GeneID:59327757"
     mRNA            <668494..>670698
                     /locus_tag="HG536_0G03780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285294.1"
                     /db_xref="GeneID:59327757"
     CDS             668494..670698
                     /locus_tag="HG536_0G03780"
                     /inference="similar to AA sequence:RefSeq:NP_012576.1"
                     /note="ancestral locus Anc_1.468"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141190.1"
                     /db_xref="GeneID:59327757"
                     /translation="MAGEVQADAEKLLINVDSMDFLDAEGSERDESMDLNALDDEMET
                     DPVTGAYMISLSRGSEPLSFNENGKLKFKLSPLAYQNIGFVTEPKQYKLYPVSLPRVD
                     TTEEYVSYVSKVFEIYRDLGDDRRFSVPTIGVINQTEGKEHIAAVNLAMEALSVELEL
                     YIESIKEKSSLFGRFYELEESLTIINCLKTFHFTVDTPDQDIRGQFIKNLLAWINRSD
                     GEPNEEATSQVLSSSSGTRKCFQNPPFWKLINTLLLRGLFEQAIACLETSGLLPYLEG
                     QCKVSSNAIHDLISLIRRYPMDAADDFREWKNLALELAQTFSESDAKITGEMRDLIED
                     SLLLIGGHQAKILAYSKTWYESLSGLLLYYIPSLELCEEYLHLSLKKNALDVTNTWQQ
                     ACVDIIKGKVHSILPLLEALDSCTAAVSAAICQAKGLIEIYYEDGQDEVEPTEEILSP
                     RNGMASYMLNSFALELCSYDDKKLWSVAIGLITLSPTENTTAKKLAIAELLPHYPFQT
                     NDDIEWMLSVAAKWRLPQVTKSIYIMLGNKLLYESNTIEAMANFSKAGKFEWVKRYSW
                     MMFEASVLQGAPLDDIILNAIVSEDSEQVIPKELLDSLMTNAMKQTLAPYAVLFQFYE
                     AQSKENWSDALQFLLALIDFPYLPKCYLVLLVAKFLYPLFLKDPLKPIQEESILRIME
                     AMESKWDDKDVKSQNIFRCVQESSMGALPDTLEALHRAVRKELNLKLCQEYM"
     gene            complement(<670842..>671330)
                     /locus_tag="HG536_0G03790"
                     /db_xref="GeneID:59327758"
     mRNA            complement(<670842..>671330)
                     /locus_tag="HG536_0G03790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285295.1"
                     /db_xref="GeneID:59327758"
     CDS             complement(670842..671330)
                     /locus_tag="HG536_0G03790"
                     /inference="similar to AA sequence:RefSeq:NP_010887.3"
                     /note="ancestral locus Anc_1.469"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141191.1"
                     /db_xref="GeneID:59327758"
                     /translation="MSELCPVYAPFFGAIGCASAIIFTSFGAAYGTAKSGVGICATCV
                     LRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLQQQQALYTGFIQLGAGLSVGLSGL
                     AAGFAIGIVGDAGVRGNSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQDVVC
                     HY"
     gene            complement(<671564..>672595)
                     /locus_tag="HG536_0G03800"
                     /db_xref="GeneID:59327759"
     mRNA            complement(<671564..>672595)
                     /locus_tag="HG536_0G03800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285296.1"
                     /db_xref="GeneID:59327759"
     CDS             complement(671564..672595)
                     /locus_tag="HG536_0G03800"
                     /inference="similar to AA sequence:RefSeq:NP_012577.1"
                     /note="ancestral locus Anc_1.470"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141192.1"
                     /db_xref="GeneID:59327759"
                     /translation="MAEEVFEYINERLFTEEKPVLFTDLICRFKVGPSKAKYLMYSYY
                     KQNTSTKFNCIIICVGKDGSIKVVNDLDSFDDQQTLADCFIYALNTTDIFTPVSIARD
                     LHDFLPIRNCFDLKVVPKRAKTLDAEPTAKPSPLPTARSRTVPEAKETTRKPPAKSKN
                     TGLRSTAILAKMRGERERKERERREELQRRRQEQVERETKNDKKRSAQMAELDNLFDD
                     EDDMPDEKQPSATPEPYTATPEREESTPLDKQELEELLETTADDSLMHTKNAEEQDTP
                     ETRPGADSSYVDEDGYTVTNRAATSTPPQKPAHKRPSTASKPDVPAKRAAAKGKTTQG
                     TLESFFQKR"
     gene            <672854..>673270
                     /locus_tag="HG536_0G03810"
                     /db_xref="GeneID:59327760"
     mRNA            <672854..>673270
                     /locus_tag="HG536_0G03810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285297.1"
                     /db_xref="GeneID:59327760"
     CDS             672854..673270
                     /locus_tag="HG536_0G03810"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141193.1"
                     /db_xref="GeneID:59327760"
                     /translation="MQISCSLIYLILCFQLVSGHLGTWIEKDQDGDQCDEKAAFSYLN
                     SLIEKHGARLQLETESLREDFGVTIQQADAHDEGRIWHVGEVSLSLLDKHSVSSLTNR
                     LEKAWRLPWKLLNRFRVPELGLFFLSIGDTNIFDEL"
     gene            complement(673445..673516)
                     /locus_tag="HG536_0Gtrna7M"
                     /db_xref="GeneID:59327896"
     tRNA            complement(673445..673516)
                     /locus_tag="HG536_0Gtrna7M"
                     /product="tRNA-Met"
                     /note="codon recognized: AUG"
                     /db_xref="GeneID:59327896"
     gene            <675326..>676585
                     /locus_tag="HG536_0G03820"
                     /db_xref="GeneID:59327761"
     mRNA            <675326..>676585
                     /locus_tag="HG536_0G03820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285298.1"
                     /db_xref="GeneID:59327761"
     CDS             675326..676585
                     /locus_tag="HG536_0G03820"
                     /inference="similar to AA sequence:RefSeq:NP_011346.1"
                     /note="ancestral locus Anc_8.111"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141194.1"
                     /db_xref="GeneID:59327761"
                     /translation="MLRRQLVRKMSQRAFETKILKVNPLSIHFSPNAHIDGSLPTISD
                     PETEKALLEAAKIIRDSDDTVAFPTETVYGLGGSSLNDKSVLSIYRAKNRPSDNPLIT
                     HISSIDQLNRRIYGEESNSNESPLRNIPEIYHSLIAKLWPGPLTILLPVPPMESGTLS
                     KLTTGDQPTFAVRIPSSRIARALIALSDTPIAAPSANASTKPSPTLASHVLHDLEGRI
                     PLILDGGPCKIGVESTVVDGLSQPPSLLRPGGFTYEQIVELGGSQWADCRVERRQTVG
                     ETEKVRTPGMKYKHYSPSAKVILLVPNRKDSTNSRLEKLRDIIRTEQSLRSESLKSIA
                     VLTASHLNNTSLDNILPSGSNLKMIVESLGSTGREIQANLFAALRRVDEVENVDLIIV
                     EGLPEVDEGLAVMNRLKKAAGGNCISF"
     gene            complement(<676718..>679552)
                     /locus_tag="HG536_0G03830"
                     /db_xref="GeneID:59327762"
     mRNA            complement(<676718..>679552)
                     /locus_tag="HG536_0G03830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285299.1"
                     /db_xref="GeneID:59327762"
     CDS             complement(676718..679552)
                     /locus_tag="HG536_0G03830"
                     /inference="similar to AA sequence:RefSeq:NP_011348.1"
                     /note="ancestral locus Anc_8.112"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141195.1"
                     /db_xref="GeneID:59327762"
                     /translation="MGDNPFNTSIEDSASDDETRNMFRATAEALSKPNPSLEFCTLTV
                     EETLERLDSNGKDGLSSLEEASRRKLAHGPNEVVGEESEPLWKKFLLNFVEDPLILLL
                     IGSAVVSFLMGNVDDAVSITLAIVIVVTVGFVQENRSEKSLEALSKLVPAECHLIRCG
                     QESHVLAVNLVPGDLVRFGIGDRIPADLRIIESVDLSIDESNLTGENEPVQKSSHHVS
                     KESFNDQPYSIVPTSDRTCIAYMGTLVREGHGKGIVVGTGRNTSFGSVFEMMSSIEKP
                     KTPLQLAMDKLGKDLSLMSFVLIGIICLIGIIQGRSWLDMFQISVSLAVAAIPEGLPI
                     IVTVTLALGVLRMAKRKAIVRRLPSVETLGSVNVICSDKTGTLTSNHMTVSRIWCLAS
                     MENKSNMLVLDKNKSGSFRNYLTDDVRAILAISNVCNNASFSQEHGKYMGNPTDIALL
                     EQLSKFDIKDVRADYKKLQEIPFNSKRKFMATKVVDPEGKCVVYVKGAYEKLLANSTH
                     FVNQKGKAEQLTDSHKETINDTANALASNGLRTLAFGKLELRDASEKLDEGSITGLTF
                     AGLIGMSDPPRPTVKPAVEQLLQGGVHVIMITGDSENTAVNIARRIGIPVMNPEFSVL
                     TGDKLDNMSDDDLANVIDHVNIFARATPEHKLNIVRALRKRGDIVAMTGDGVNDAPAL
                     KLADIGVSMGKMGTDVAKEASDMVLTDDDFSTILTAIEEGKGIFNNIQNFLTFQLSTS
                     VAALSLVALSTALKLPNPLNAMQILWINILMDGPPAQSLGVEPVDHEVMKKPPRKRTD
                     RILTKFVLKRLLISAAFIIVGTVYVFVGEMTEDNQVTARDTTMTFTCFVFFDMFNALA
                     CRHATKSIFEVGIFANKMFNYAVGLSLLGQMCAIYIPFFQRIFKTESLSLGDLIYLLT
                     ISSSVFIADEVRKWWSRRFSSLDSLRYSNV"
     gene            complement(<679971..>683561)
                     /locus_tag="HG536_0G03840"
                     /db_xref="GeneID:59327763"
     mRNA            complement(<679971..>683561)
                     /locus_tag="HG536_0G03840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285300.1"
                     /db_xref="GeneID:59327763"
     CDS             complement(679971..683561)
                     /locus_tag="HG536_0G03840"
                     /inference="similar to AA sequence:RefSeq:NP_015335.1"
                     /note="ancestral locus Anc_8.113"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141196.1"
                     /db_xref="GeneID:59327763"
                     /translation="MSKIIKPPKARTADFRTLERESRFINPPKDKSAYPLLQEAVQPH
                     IGSFNALTEGPGGGLLNQAVKDIGEKVVFDGKTTESDYLGNKLSLSVEQVSITKPMSN
                     DGVTSAVERKVFPAEARQRLSSYRGKLMLKLKWSVNDGNDEVFTEVRDCGGLPVMLQS
                     NRCHLNKLSPADLVKNKEESDEVGGYFIINGIEKLIRMLIVQRRNHPMAIVRPSFANR
                     GASYSQYGVQIRCVRPDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVIMIFKALCDT
                     SDREIFDGIIGSDVTNSFLTDRLELLLTGYKKRYPQLKNRRQILQYLGDKFRVVFQAS
                     PDKSDYQVGQEVLDRIVLVHLNNDTNKDKSSMLLFMIRKLYSLVAGECCPDNPDATQH
                     QEVLLGGFLYGMIIKEKIEEYLQSIVAQIRTDINRGSPINFKDRKYVTRVLMRVNENI
                     GSKLQYFLSTGNLVSQSGLDLQQVSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTT
                     TVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTEQSDVTKIPSILYSLGVSPV
                     SQTFAAGPSLCCVQLDGKIIGWTSHTQGKIIADTLRFWKVEGKTAGLPLDLEIGYVPP
                     SARGQYPGLYIFGGHSRMMRPVRYLPLDKEDIVGPFEQVYMNIAVTPEELQNNVHTHV
                     EFTPTNILSILANLTPFSDFNQSPRNMYQCQMGKQTMGTPGVALCHRSDNKLYRLQTG
                     QTPIVKANLYDDYGMDNFPNGTNAVVAVISYTGYDMDDAMIINKSADERGFGYGTMYK
                     TEKIDLSLNRSRGDPISQHFGFGSDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFD
                     DTLNKTKIKTYHSSEPAYIEEVNLIGDESNKLQELQTVSIKYRIRRVPQIGDKFSSRH
                     GQKGVCSRKWPTIDMPFSETGIQPDVIINPHAFPSRMTIGMFVESLAGKSGALHGIAQ
                     DATPWIFSENDTPADYFGEQLRQAGYNYHGNEPMYSGATGEELRADIYIGVVYYQRLR
                     HMVNDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTAFLLQDRLLNC
                     SDYTQTSVCRECGAILTTQQSVPRIGSMSSVRCRRCAVKFDDAKRMLSKYQGNDSVFI
                     DDSHIWEDGQGNKFVGGGDTTTVAIPFVLKYLDSELAAMGIRLRYNVEPR"
     gene            683928..684000
                     /locus_tag="HG536_0Gtrna14K"
                     /db_xref="GeneID:59327885"
     tRNA            683928..684000
                     /locus_tag="HG536_0Gtrna14K"
                     /product="tRNA-Lys"
                     /note="codon recognized: AAG"
                     /db_xref="GeneID:59327885"
     gene            <684347..>686233
                     /locus_tag="HG536_0G03850"
                     /db_xref="GeneID:59327764"
     mRNA            <684347..>686233
                     /locus_tag="HG536_0G03850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285301.1"
                     /db_xref="GeneID:59327764"
     CDS             684347..686233
                     /locus_tag="HG536_0G03850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141197.1"
                     /db_xref="GeneID:59327764"
                     /translation="MDPALDDAFRQHQDGQIDVGFLQRMRVFLIWMLQKFTTKEGLLG
                     DYNYRYLFTPSYPFQNWISRRRGVSPSKVDQPFFPLNEDVPVALGLLLGLQHALSMLA
                     GVITPPMIISGAANFSTELTQYLVSASLITSGLLSMVQISRIRIPWTSYHIGSGLLSV
                     VGTSFAVIGIVTKSLPIMYKSGYCPSASDGTPLACPDGYGAILGTAACCALLEIALSF
                     TPPKILQKVFPKIVTGPVVLCIAVPLIQSGFNDWIGGGGCVDKICPYENGPQAAPWGS
                     AKFIGLGFLVFFTIVMCEKYGPPIMKSCAVIVGLIVGCIVAAAAGYFDRSSIDAAPAV
                     TFIWVHTFRLRVYGPAVLPSLVMFIVLAQEAIGDITATSDVSRLDVEGPEYESRIQGG
                     VLSDGLGGVISALFTVTPMSIFAQNNGVISLTKCASREVGYWCCFFMIIMGIFAKFGA
                     ALVAIPKPVLGGMTSFLFTTVAVAGLRIISSIPFTRRDRFVLTGSLLFGFGAILVPDW
                     FSHVFTYSGDNHALQGFYDAIVLVMESSFTVCGLVGIILNLLIPQELDEELIDDIELQ
                     QENLSVLDGREPLQMNLAATLKGKEAQLGAVSGPNESMSSSEAHEMKDTAQYNVTAAG
                     STKS"
     gene            complement(<686378..>686669)
                     /locus_tag="HG536_0G03860"
                     /db_xref="GeneID:59327765"
     mRNA            complement(join(<686378..686566,686637..>686669))
                     /locus_tag="HG536_0G03860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285302.1"
                     /db_xref="GeneID:59327765"
     CDS             complement(join(686378..686566,686637..686669))
                     /locus_tag="HG536_0G03860"
                     /inference="similar to AA sequence:RefSeq:NP_001091638.1"
                     /note="ancestral locus Anc_8.114"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141198.1"
                     /db_xref="GeneID:59327765"
                     /translation="MRPAQLLLNQAKKGSGIGIPVELTPLFIAMGLALASGTYFTYKK
                     FRHDDSLRVTKNPEMSNLKKVLAESENKE"
     gene            complement(<686877..>687815)
                     /locus_tag="HG536_0G03870"
                     /db_xref="GeneID:59327766"
     mRNA            complement(<686877..>687815)
                     /locus_tag="HG536_0G03870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285303.1"
                     /db_xref="GeneID:59327766"
     CDS             complement(686877..687815)
                     /locus_tag="HG536_0G03870"
                     /inference="similar to AA sequence:RefSeq:NP_015336.1"
                     /note="ancestral locus Anc_8.115"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141199.1"
                     /db_xref="GeneID:59327766"
                     /translation="MSELTLVKELLKQDSNVAFLAGGIAGAVSRTVVSPFERVKILLQ
                     VQNTTQAYNQGIFGAIGQVYREEGWKGLFRGNGLNCIRIFPYSAVQFVVYEACKKHLF
                     HVDSVQRGEQLNNWQRLLGGALCGGASVIATYPLDLVRTRLSIQTANLRKLNKSRVST
                     AKPPGIWELLVKIYREEGRIQALYRGVWPTSLGVVPYVALNFAVYEQLKELAPGTDLS
                     PLYKLAIGAISGGVAQTVIYPFDLLRRRFQVLAMGGNELGFYYSSVADALTTIGRTEG
                     VAGYYKGLTANLFKVIPSTAVSWLVYEVVSDAMRSW"
     gene            complement(687919..688017)
                     /locus_tag="HG536_0Gtrna16L"
                     /db_xref="GeneID:59327890"
     tRNA            complement(join(687919..687963,687979..688017))
                     /locus_tag="HG536_0Gtrna16L"
                     /product="tRNA-Leu"
                     /note="codon recognized: CUA"
                     /db_xref="GeneID:59327890"
     gene            complement(<688134..>688676)
                     /locus_tag="HG536_0G03880"
                     /db_xref="GeneID:59327767"
     mRNA            complement(<688134..>688676)
                     /locus_tag="HG536_0G03880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285304.1"
                     /db_xref="GeneID:59327767"
     CDS             complement(688134..688676)
                     /locus_tag="HG536_0G03880"
                     /inference="similar to AA sequence:RefSeq:NP_015340.1"
                     /note="ancestral locus Anc_8.117"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141200.1"
                     /db_xref="GeneID:59327767"
                     /translation="MLTRSNPSVSSGENYYYGQPTTGPVVNDPIPVPAPLMVMYPSRP
                     SWGTGPPVPVRLPPISSLVGPPASYVPASGVPQRPPRMMVAGEHACAGAGAGAAPAPA
                     ANSLDPAVRLRKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWANCNKSFNVKSNML
                     RHLKSHERKLAKKQAKRVSL"
     gene            complement(<689121..>689858)
                     /locus_tag="HG536_0G03890"
                     /db_xref="GeneID:59327768"
     mRNA            complement(<689121..>689858)
                     /locus_tag="HG536_0G03890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285305.1"
                     /db_xref="GeneID:59327768"
     CDS             complement(689121..689858)
                     /locus_tag="HG536_0G03890"
                     /inference="similar to AA sequence:RefSeq:NP_015341.1"
                     /note="ancestral locus Anc_8.118"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141201.1"
                     /db_xref="GeneID:59327768"
                     /translation="MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGD
                     AIPIAHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDTVKIQRVEERLS
                     ALGNVICCNDYVALVHPDIDRETEELIADVLGVEVFRQTISGNILVGSYCALSNQGGL
                     VHPQTSIQDQEELSSLLQVPLVAGTVNRGSAVVGAGIVVNDYLAVTGLDTTAPELSVI
                     ESIFRLNDARPEAIAGNLRDTLIETYS"
     gene            complement(<689974..>690369)
                     /locus_tag="HG536_0G03900"
                     /db_xref="GeneID:59327769"
     mRNA            complement(<689974..>690369)
                     /locus_tag="HG536_0G03900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285306.1"
                     /db_xref="GeneID:59327769"
     CDS             complement(689974..690369)
                     /locus_tag="HG536_0G03900"
                     /inference="similar to AA sequence:RefSeq:NP_015342.1"
                     /note="ancestral locus Anc_8.119"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141202.1"
                     /db_xref="GeneID:59327769"
                     /translation="MSVRCSFEDCKCAVITVDSAIKVQLPGQAAETFQLMRGATATSE
                     QNEFLLVKDVWDFDNVGVSKQIPPGLLVDSDRAISFVWENKPWTIEKCLKYLICAECD
                     KGPIGMVCQVKNDHESTTLYLLSLSSLTV"
     gene            <690563..>691825
                     /locus_tag="HG536_0G03910"
                     /db_xref="GeneID:59327770"
     mRNA            <690563..>691825
                     /locus_tag="HG536_0G03910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285307.1"
                     /db_xref="GeneID:59327770"
     CDS             690563..691825
                     /locus_tag="HG536_0G03910"
                     /inference="similar to AA sequence:RefSeq:NP_011345.3"
                     /note="ancestral locus Anc_8.120"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141203.1"
                     /db_xref="GeneID:59327770"
                     /translation="MTDDIEDAVKRFEAVHLKRGPDEQRYGELAQIKNENYHLKLALD
                     EKNMELEKLKKTVQRGVFLEDVHKFSSQVESNAPMFVAGPPSDSGSCGTDLEIVTHFS
                     GSPYKGKRTNSKATENSVATTSTSNIKAEHVFFKQNVVPFIEQMIASLKLSSVFKQEG
                     RKLQEKYDKFEGELWDSKFDTCLLTDIFDDILYFYRQMTSVLNRELKFKELSQRLEYL
                     FSIFLDPREYDLDPQEHIEYLREEISDTLIRIFHYQDMPPEKERIDYDNTNEAMHHDY
                     TPGRISGPLLSRNKKQAAKRLKCIEQGFEICANAMNQAFGDKQQLRVQEDSIPSVLSS
                     TGMVSEISENAMREKDRLKESKSSLEFIPIGYDENTLNSKTPQRKAYQTQQLNEITPK
                     ANDENDPLQMFFQEQASFYDNNIDRRCK"
     gene            <692379..>694025
                     /locus_tag="HG536_0G03920"
                     /db_xref="GeneID:59327771"
     mRNA            <692379..>694025
                     /locus_tag="HG536_0G03920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285308.1"
                     /db_xref="GeneID:59327771"
     CDS             692379..694025
                     /locus_tag="HG536_0G03920"
                     /inference="similar to AA sequence:RefSeq:NP_015343.1"
                     /note="ancestral locus Anc_8.121"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141204.1"
                     /db_xref="GeneID:59327771"
                     /translation="MAAPGMDGEKRSILTLFSRNIGDSKESKDKHPNEPLGIVIDLEE
                     PKESTIASEAASTVEPANAKKAVIESIEDAAEDEKTKRKELAALRREDLRQEKELKKK
                     QREEEKRRREAVKEEQKRQKEQQREEERLKREERKKQKERQRLEIRKQKELEKTQKEL
                     EKQRKEEAKERAQSRIGNFFKKVSDSSKQSEEKSDYRKYFLPFYAKDGVVLPVDHFLS
                     PLEERKKEVDRQLSLRSSADDTVLNWLVSKSAKRNGRVKFTAVSLLQQMTSKGKTDEE
                     LQSLLKMVPQKYIKFYENVRPPYIGTYSKDVTLPADNPFCTDGTGYDYGYDSDLEWIN
                     EEEEDGEQGGVDNLESGEEDEDEEDEEASEGEFEGFLDAEDGSNKSRPAGKRKFIGPL
                     IPTVHLRSNIENLDEDDRKYFELAKVEFLAEQQPFPIDPYFLVNKAQSLNSSKRLADA
                     DRDSGSSSNSPSVSPEKKRPKTLITETAHLLKLFDEIHDSTFSLGTVTEIAQKNLPQY
                     SKQTIKNTVKEYAVRGAGKGDFGRKWVIRDMKHWEDLRSL"
     gene            <694279..>697050
                     /locus_tag="HG536_0G03930"
                     /db_xref="GeneID:59327772"
     mRNA            <694279..>697050
                     /locus_tag="HG536_0G03930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285309.1"
                     /db_xref="GeneID:59327772"
     CDS             694279..697050
                     /locus_tag="HG536_0G03930"
                     /inference="similar to AA sequence:RefSeq:NP_015344.1"
                     /note="ancestral locus Anc_8.122"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141205.1"
                     /db_xref="GeneID:59327772"
                     /translation="MSNQSSSPVRGNFDSSSSPARAPNANVRQPSSPALFYNTSSSQP
                     DTYERDSARQPRRNVPAAQGSSPFFYPSSYDDRYSSLGSHRREQIAEQRTTPGRNLTS
                     DLGNDPAGSLSSTFGGRPSNRVHMRRNDIHASDLSSPRRIVDLDVRSGLPASSSSALP
                     SEATEPLRIIWGTNVSIQECANDFRSFLMSFKYKYRKTLDDREILINSTTDEELYYVK
                     QLNEMRELGLSNLNLDARNLLAYKQTEELYYQLLNYPQEVISIMDQTIKDCMVSLVVD
                     NNLEYDLDDIETRFYKVRPYNVETERGMRELNPNDLDKLISLKGLVLRSTPVIPDMKV
                     AFFKCNVCDHTMAVEIDRGVIQEPARCERVDCNEPNSMSLVHNRCSYADKQVIKLQET
                     PDLVPDGQTPHSVSLCVYDELVDSCRAGDRIEVTGTFRSVPIRANPRQRILKSLYKTY
                     IDVVHVKKVSEKRLDIDTSTVEQELLQNKLNHSDTEELRRITAEDIAKIKEVAKREDL
                     YELLARSIAPSIYELDDVKKGILLQLFGGANKKFTKGGRYRGDINILLCGDPGTAKSQ
                     ILQYVHKIAPRGVYTSGKGSSAVGLTAYVTRDVDTKQLVLESGALVLSDGGVCCIDEF
                     DKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARASILASANPIGSRYNPNLPVTANI
                     DLPPPLLSRFDLVYLVLDKVDEGTDRELAEHLTSLYIEDKPQHVATDDVLAVEFLTAY
                     INYAKENIHPGITEQAKTELVRAYVGMRKIGDDSRSDEKRITATTRQLESMIRLSEAH
                     AKMRLSEQVEIQDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLEEDLA
                     REILRILTDHTSDSMSFNELNKQINEHSQDRVESSDISEALSRLQQEDKLIVLGEGVR
                     RSIRLNVRV"
     gene            <697395..>697793
                     /locus_tag="HG536_0G03940"
                     /db_xref="GeneID:59327773"
     mRNA            <697395..>697793
                     /locus_tag="HG536_0G03940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285310.1"
                     /db_xref="GeneID:59327773"
     CDS             697395..697793
                     /locus_tag="HG536_0G03940"
                     /inference="similar to AA sequence:RefSeq:NP_015345.1"
                     /note="ancestral locus Anc_8.123"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141206.1"
                     /db_xref="GeneID:59327773"
                     /translation="MPVFFGSINSGIMLGRIQSYATCFVSKTSRLATKTVYYGKVGAE
                     LSKQVYLKEGLQPPSVADFQKVYSQLYKNLLHYSVKPKEVLGLLKSLGKNDVVKYGSY
                     AIQIVGFYSVGEIIGRRHLVGYKNYQPSHH"
     gene            complement(<698014..>699696)
                     /locus_tag="HG536_0G03950"
                     /db_xref="GeneID:59327774"
     mRNA            complement(<698014..>699696)
                     /locus_tag="HG536_0G03950"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285311.1"
                     /db_xref="GeneID:59327774"
     CDS             complement(698014..699696)
                     /locus_tag="HG536_0G03950"
                     /inference="similar to AA sequence:RefSeq:NP_011344.1"
                     /note="ancestral locus Anc_8.124"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141207.1"
                     /db_xref="GeneID:59327774"
                     /translation="MDIFRVLARGANVRKDTKRIGKDVDFSVVETTVKDNDKQITREL
                     DFFHNKRIMKKVEDSRDKEKEAIEDEREELVENDIGQLKVRNIDEATSLRKSYKAKVT
                     GEDIPLPIGSFEDLVTRFSFDKRLLNNLIENHFTEPTPIQSEAIPLSLNGRDIVACAP
                     TGSGKTLSFLIPLLQLVISEATGGTGLRALIVSPTKELANQIFIECGKLSRKIFLDKK
                     RPLQVALLSKSLNAKLRNRVVSDKKYDIIVTTPLRLIDLMKNEALDLSTVKHIIFDEA
                     DKLFDKTFIEQTDDILSSCSNPKLQKSLFSATMPSSVEEIAQSIMMDPVRVIIGHKEA
                     ANANITQKIVYCGNEEGKLIAIRQLVQEGEFRPPVIIFLESIERAKALYHELIYDGLN
                     VDVIHAERTQMQREKIIESFKKGDLWCLICTDVLARGVDFKGVNLIINYDVPRTAQAY
                     VHRIGRTGRGGRSGNAVTFYTKQDSLAIKPVINVMKQSGCQVAEWMDGISKLSKREKE
                     SIKKGKARVNRKQISTVPKVDRLKRKRKHDMIEASKKRKHQHKAVDSKRSTS"
     gene            complement(<700118..>701500)
                     /locus_tag="HG536_0G03960"
                     /db_xref="GeneID:59327775"
     mRNA            complement(<700118..>701500)
                     /locus_tag="HG536_0G03960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285312.1"
                     /db_xref="GeneID:59327775"
     CDS             complement(700118..701500)
                     /locus_tag="HG536_0G03960"
                     /inference="similar to AA sequence:RefSeq:NP_011343.1"
                     /note="ancestral locus Anc_8.125"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141208.1"
                     /db_xref="GeneID:59327775"
                     /translation="MFSFNKASSAGASSTTSGGLFGQKPNNAGGGFSFGQTSGAGGNA
                     TGGGSGFSFGGQAAQSGDSKGGLFGNKPAGGTASGTGFSFGQQQQPQQPGGTTVGGLF
                     GSKPVGSATGTGISFGQQSQSQQPAGTAGLFGNSGTNTGTGSLFGSSNSGTTGTTGAG
                     GSLFGKTGTTAGSTGGGLFGSKPAGGSSLFGSSSGTGGGLFGSKAAGTSLFGTSGTSN
                     ASGSLFGAQQPQQYQQPSTLQAISQLPITPMTKISELPPQLRQEIEQLDQYIQRQVQI
                     SQHLKADTPEHTELINSIPRDIAYLLKTVSSASESLTQDLKKLTSIKDITDQSIADTQ
                     TFAMILQQLLTPGSKISSMELEKFFHHRIQVYQEKLDDYFRVLSDIESAVNGIDNDVF
                     GAPPDAKGFSKNNESSGHVDVYAMKTGINALISTVIEEFSLFMDTAERVAQIHQKVKE
                     ICVNRSEVQS"
     gene            <702118..>706449
                     /locus_tag="HG536_0G03970"
                     /db_xref="GeneID:59327776"
     mRNA            <702118..>706449
                     /locus_tag="HG536_0G03970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285313.1"
                     /db_xref="GeneID:59327776"
     CDS             702118..706449
                     /locus_tag="HG536_0G03970"
                     /inference="similar to AA sequence:RefSeq:NP_011342.1"
                     /note="ancestral locus Anc_8.126"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141209.1"
                     /db_xref="GeneID:59327776"
                     /translation="MGIPKFFRYISERWPMILQLIEGNQIPEFDNLYLDMNSILHSCT
                     HGNDDDVTKRMTEEEVFAKIFAYIDHLFHTIKPKKVFYMAIDGVAPRAKMNQQRARRF
                     RSAMDAEKALEKAIMRGEEIPKGEAFDSNAITPGTEFMAKLTKNLQYFIHDKITNDSK
                     WREIDIIFSGHEVPGEGEHKIMDFIRNLRAQKEFDSNTRHCIYGLDADLIMLGMSVHD
                     PHFALLREEVVFGRRGSVAKSLESQNFYLLHISLLREYMQLEFQEIADELQFEYDFER
                     ILDDFILVMFVIGNDFLPNLADLHLNKGAFPVLLQTFKEALLHLDGYMNEHGEINLKR
                     LGVWLEYLSQFELTNFEQSDIDVDWFNQQLENISLEGEKQRARTGKKLLLKQQKKIVG
                     IVKPWVIDVMSKRYPADLPEDDVPTLKLDDDRIEENLEFLKELAFQLGLFVTHSKSQD
                     VYSLKMDIDAINPDETDVQFEERQKSVRKTIKRYQQAILVEDQEELDNEKEIYNERFI
                     QWKDKYYKTKLGFSYDDAEKLTDLCQNYVEGLQWVLYYYYRGCPSWGWYFHYHYAPRI
                     SDLAKGLNQIIKFNKGKPFTPFQQLMAVLPERSKNLIPTPFRPLMFDEKSPIRDFYPR
                     EVELDKNGKTADWEAVVLLSFVDEQRLIDAMAPYLGKLSPEEKIRNGCGKDLIYTFNP
                     QVDVLYKSPLSGMFSDIEHDHCVEREFTPPNIDESQFRYGLLEGAKVGSNLLAGFPSL
                     ETIPFSAELAYNETRVFQQPSKQQSMVLRIENVFEQNSLTLDELSKRFMNKVVYTRWP
                     FLRESKLVSIIDDHNVYESLKPGKTLRRPVEASEIKLFKSLTASMIKNYSQEKAVSLG
                     KVSAIVKVLPVTDLVRTSKGSYVKTFSSEAEYYPLQLMVESVANQDERFVEREPVPIE
                     KEFPQGSHVIFLGDYAYGGETIIDGYNSGTRLKLTVKKRVSQAEPTIGKERARIDSSL
                     VKYFPSFIVAKKLQLHPLFLSKITSKFLIANVAGKHVNVGIPIKFEARHEKVLGYARR
                     NPKGWEFSTLAIQLIEDYRRTFPDFFERLSQTHSNIPSIGQLYPELPEDKVSQILDSI
                     VTWLKTATEKFVKVSLESDSLTKVSMQAIEEHVLAYSAHMEAIEKKQLAKVPCDAILD
                     PKTSFTLLRGQKFDLGDRVVYVQDSGKVPLFSKGTVVGYTTLGSRLSVQVLFDNELVA
                     ANNFGGRLRTNRGLGLDASFLLNLTNRQFIYHSKASRQATEQKKNVKTSATAQRAKTV
                     TVKPNQARELLTHIKKSDKAGLSTKTDNRLDSQRPATAAGERPVPREASYAPGINAVS
                     ANALYNVVLNQYSGNFYPPNMAFPPPPADSQGMPYHMPPGYAQPFVPMQPPYPTEMRP
                     PVNGGHVPVPHGMSSNHGTGVKTSRRSQNGTKIHMKGRDDHRGVNSKSNEEQGLKSER
                     KGVEAQS"
     gene            complement(<706548..>707381)
                     /locus_tag="HG536_0G03980"
                     /db_xref="GeneID:59327777"
     mRNA            complement(<706548..>707381)
                     /locus_tag="HG536_0G03980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285314.1"
                     /db_xref="GeneID:59327777"
     CDS             complement(706548..707381)
                     /locus_tag="HG536_0G03980"
                     /inference="similar to AA sequence:RefSeq:NP_011341.3"
                     /note="ancestral locus Anc_8.127"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141210.1"
                     /db_xref="GeneID:59327777"
                     /translation="MSLHSYLEEAYGSGSKKKKGKTKTKTKENATYEASNGSITITEG
                     PERPFESESVEARSLKSASRKESKKLWKNLDTDELVTEKGTSTCNTGIKKLSSGAHAG
                     LQTVEQLEGQTRIKDVQVAKSNAGTTVNQTTVFRDERGHRITDYEVHVAREAQEKDAR
                     ERLEAKRLAELNMGEIQRYMMENSLSQVPQVASHNKMASDDPATLFANQMTGQENTRV
                     SFLGRRLYDKISMENRFGIAPGCRWDGVDRSNGFERKWFAKQQELNEKKVEKYTLQED
                     D"
     gene            <707606..>708646
                     /locus_tag="HG536_0G03990"
                     /db_xref="GeneID:59327778"
     mRNA            <707606..>708646
                     /locus_tag="HG536_0G03990"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285315.1"
                     /db_xref="GeneID:59327778"
     CDS             707606..708646
                     /locus_tag="HG536_0G03990"
                     /inference="similar to AA sequence:RefSeq:NP_011340.1"
                     /note="ancestral locus Anc_8.128"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141211.1"
                     /db_xref="GeneID:59327778"
                     /translation="MILRSKLDVLLELDLLSLLAVQSDVTRLIEQKAVLLEAGRRNGH
                     IAQLESEVSPKDIRSLPAEEIGSVTRDDSDEDDFLLTQFDQIAREKLLNKGPGAGESK
                     EADGHEAFCKKPDLSSPLKGTQSLPDSLGSLESDLQIFPPKMKDAASFEINGKSVLQS
                     SNGRIPELSPGKRQKIKKSRLDDTVRPKSLVSFNSNPLTKKPWILEDFRLNEDLSSVK
                     RGRKKLSTMKLNNFYEQGGRPPDVEVLEEAADHGIDNSCEFENLRQRSKSPPGFGRLD
                     FPSTQERVDDKKKSQEIIHRKTRHRFLAATRCDIPQQERQYLFKSDYLNQLVKDGTFK
                     WDDKNLKIFSRR"
     gene            complement(<708714..>711434)
                     /locus_tag="HG536_0G04000"
                     /db_xref="GeneID:59327779"
     mRNA            complement(<708714..>711434)
                     /locus_tag="HG536_0G04000"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285316.1"
                     /db_xref="GeneID:59327779"
     CDS             complement(708714..711434)
                     /locus_tag="HG536_0G04000"
                     /inference="similar to AA sequence:RefSeq:NP_015346.1"
                     /note="ancestral locus Anc_8.129"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141212.1"
                     /db_xref="GeneID:59327779"
                     /translation="MEQNNSYGEKKLQQVEIFKKYASVLTDEQRRLQDPYCFVGGKEE
                     PRQREENGGQLILRHDDFIKLIASSRRLYSKFSDHSFDLNRIPSHTFGCIFFALDENN
                     KGYLTINDWFHFNNLLENDNFHLIILYEFFRKFDVARLKAKRIESEGRYRGGFLSSSL
                     IGADDMRTKSINYASKALSFDELLLNVDQFKETIGFLHSCVEDDFIKRNNLFLDWSQF
                     KFLKFYESFPYGVKDGPHLSLNSFITILQNDLKNEKLFVGFDRLSHIDPVKNCLTLNK
                     NQLVYLLKLFYSHRISADVFDSLNLTNTNLIKSNNNSIAFNVFKDIFYLFQNFDLLNQ
                     ALIKNATMNDFTERDLRERVITKADFMEVLNTQYNKVNNITEFSPSQINLLFSIVANS
                     KMNNKLKKLNLHHQDTSIEHFIQNEYAHGISGSERQLERFNTNYQEVAGSFDQDSTSK
                     KLSQASTGLFELFSSKTDKATMGSNLTTEDFMKILNPNYLNDIVHQLELRKIQEASLY
                     TNYFFFPIFDSLYNFTLGSVAGCIGATAVYPIDLVKTRLQAQRSTSQYKNSIDCFLKI
                     FSKEGIKGLYSGLGPQLLGVAPEKAIKLTVNDLMRKTLTDRNNKLTVPSEILAGASAG
                     ACQVVFTNPLEVVKIRLQVRSEYATENLAKAQITAVGIVKRLGFAGLYKGVLACLMRD
                     VPFSAIYFPTYAHIKRDLFNFDPQNDSKRSRLKTWELLLSGGLAGMPAAYLTTPCDVI
                     KTRLQIDPRRGETHYKGILHAARTIMKEESFRSFFKGGGARVLRSSPQFGFTLAAYEL
                     FKGLFPLPEDSTEPQPDKDDEIPTVTNSFTTFFSDLGIAPRSNQHGPLQPEFFSPTVD
                     PYSSNYLNYYYKSCQAAKVFIDLDNNFSKFDFPTYRKFHDYLRGIEASKK"
     gene            complement(<711756..>714905)
                     /locus_tag="HG536_0G04010"
                     /db_xref="GeneID:59327780"
     mRNA            complement(<711756..>714905)
                     /locus_tag="HG536_0G04010"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285317.1"
                     /db_xref="GeneID:59327780"
     CDS             complement(711756..714905)
                     /locus_tag="HG536_0G04010"
                     /inference="similar to AA sequence:RefSeq:NP_015347.1"
                     /note="ancestral locus Anc_8.130"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141213.1"
                     /db_xref="GeneID:59327780"
                     /translation="MGELGRESSHQTGYGVHGHGANHSVQQMSSSESGGRFKCPHPAC
                     DKSFTRQEHLSRHKLNHWPKEIFKCSYVFPNTGLVCNRTFVRKDLLARHVKRHTKTGS
                     RLQNNTVPIGDEFVSRTAGAAGSAPPVLLPQQSIGFAGQSAGPLPTGEGVPMPPELQL
                     GAYPVQQYGRQTRPNSQEYGTAASGSRLNNSEGSQNVSQFFNWLFENGAGSAGQQANY
                     SSNSVKNSLTSSPLPTSSGGTSEQPLPIGNVRNASSATQPFSPTGNQFYQNPGPLFPE
                     GSPSARPLQGSQEPIATSASLTKMQDLFSIDFLTNDPLQTFMQELSETAVPSQDHQAQ
                     NEGNFSSSSVSPTHSDLMARANPRLSDRRRNSVKDNLLVQKSNIAELQRQTSNEKRIA
                     NSPNYKQRVLSSMKMVPSFFHSDPATKYNLSSESYEKIIQIVPELREVSLDDLRMSLR
                     SFWCNFHPQLGLLHKPSFHIDQQPPILTLALIMAGASFLSGHYRETISDVICTPLRWI
                     IFSHEDFQPPSKTYIIQSLLLLEGYEKTSTNRYLHERSYLHHGTTLQLLRRTPSFGGH
                     PLILKTEQDPTGLQDPQEVYRRWIDFEMLKRVAFYAFYMDTTHAAIFGYLNLFINCNQ
                     IQLTLPCSDSVWESYDLSYEVLLEQGFEKERRTFLCTLKQLMGEIIQNLQNASDPSKK
                     EKSYELKSWEVNSVFGKKILLAGIISTMFQCQESNEGDLFATTIKCNLGKEKENISWQ
                     DVFSFAMDYWLYQIQGSCTETKYCLIDPFFSQVGSNPEENAQSPGMASDIFSINSDVG
                     CKIPEYHMAQVILRIYQYDYYIYSGAPWRMNVRSGNEEYNLVSKRISQFASDPRSGGV
                     AMIYAYQFMFQMFIDKKTGGMITKPYDVNSDFCITRPNTVALLALLIWSYNFSLYGPE
                     AHVWDNKEPSPALNDGSPRDLENSSSPMNLYNKRAKESYVPKESFEAYLTRMYRLLNV
                     EDSSDDVISYHNNILSKALVLQTIPGTNNLCGMMIFMKQLFENSYWDLGREFSKLFDN
                     CLERSMGKAAPICESMYKV"
     gene            complement(<715087..>716148)
                     /locus_tag="HG536_0G04020"
                     /db_xref="GeneID:59327781"
     mRNA            complement(<715087..>716148)
                     /locus_tag="HG536_0G04020"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285318.1"
                     /db_xref="GeneID:59327781"
     CDS             complement(715087..716148)
                     /locus_tag="HG536_0G04020"
                     /inference="similar to AA sequence:RefSeq:NP_015348.1"
                     /note="ancestral locus Anc_8.131"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141214.1"
                     /db_xref="GeneID:59327781"
                     /translation="MFEIGGKCLAYHGPMLYEAKILRVWDPESEKVSVLREGQVVVVE
                     EESDEGASGIPGELLGAACYFVHYQGWKSTWDEWIGPARILEYNEENLALKRSLVEEA
                     RNAKRLQQEQQRRKKASGSSSGAGSRRGRPEAGKGAGKKGGNANGVAGGGAAAAGGGD
                     GALGRQEGASQPPAPRIILHIPVKLKSLLVDDWEFVTKDKKICQLPSPTMTVQQTLDS
                     YEEAAANRLESPAAQAQLSEYCAGLRLYFERSLPILLLYRLERLQYDEVLKKQKFKDM
                     AFCDIYGPIHLLRLLSVLPELMATTTMDAQGCQLIVKQTESLLEWLVVNMDELFDTEN
                     SRDYYINTSSQYEGVALGM"
     gene            <716510..>717991
                     /locus_tag="HG536_0G04030"
                     /db_xref="GeneID:59327782"
     mRNA            <716510..>717991
                     /locus_tag="HG536_0G04030"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285319.1"
                     /db_xref="GeneID:59327782"
     CDS             716510..717991
                     /locus_tag="HG536_0G04030"
                     /inference="similar to AA sequence:RefSeq:NP_011049.2"
                     /note="ancestral locus Anc_8.132"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141215.1"
                     /db_xref="GeneID:59327782"
                     /translation="MSQRSSQHIVGIHYAVGAKIGEGSFGVIFEGENILNCGYNGADE
                     EHGGERGGCEPVAIKFEPRRSDAPQLRDEFRAYRILSGCRGIPHAYYFGQEGMHNVLI
                     LDLLGPSLEDLFEWCGRKFSVKTTCLVAKQMIDRVRTIHEHDLIYRDIKPDNFLIAEY
                     QRSTGERQLTKSIAGSADGDPNLIYMVDFGMAKQYRDPRTKQHIPYRERKSLSGTARY
                     MSINTHFGREQSRRDDLESLGHVFFYFLRGSLPWQGLKAPNNKLKYEKIGLTKQKINP
                     DDLLTESIPPQFSAYLKYARSLRFDEDPDYDYLVSLMDDVLRLLGLQDDGHYDWMDLN
                     NGQGWNIKVNKRANLHGYGNAGPRHNENANNATRPSTHANARAKAQPNNPSSVNLAKQ
                     KLRQSNAGLGVVPNSPNTLVKHRNYDSMGSRVLKQSMAANGPGGYNDFRMGGPKMEDK
                     NAVYYRRQQSQQVQAQNSQRSQLDNGDSEENKGFCARMCCCWF"
     gene            complement(<718472..>720154)
                     /locus_tag="HG536_0G04040"
                     /db_xref="GeneID:59327783"
     mRNA            complement(<718472..>720154)
                     /locus_tag="HG536_0G04040"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285320.1"
                     /db_xref="GeneID:59327783"
     CDS             complement(718472..720154)
                     /locus_tag="HG536_0G04040"
                     /inference="similar to AA sequence:RefSeq:NP_011050.3"
                     /note="ancestral locus Anc_8.133"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141216.1"
                     /db_xref="GeneID:59327783"
                     /translation="MESSKYYTPANVFRQPAIIVKKRSGRVAGSDTRNMSWRHSRSWQ
                     NDASRLGSPLLRKVSDDFNDFYTTKKLESSYWRVNDETKSASLPASLSVVDDALLISD
                     MESRDNLKLMRIEGQANEQPSLHELQAISVPGTPIFTSMLLPRPQFTADYVDGHDQLL
                     LTGHQDGVVNLISTSTDEGNAKIVKRYKHGKFLSHRNPVRLDNWLQSFESLPVRKLKF
                     WSDRGFVSLVNDSLFIYDINGSRTPQYLQSFAGVESFAINKNPYLLSLCGSQFGGSGV
                     ALLDLRSDQKSSGSLYIPDNCSSSSLSRSSLQNSASYDCVWIDEFHLANCINDTVKVW
                     DIRSSTGDCKFEMLPMKGCIQSLKYHEESKTLYTADDQGFIISWDMKFANNMKRATLA
                     QGFSSIVLENDLDIHDISQCGNIVVNGTHSANLTGVKVQGSVFMDTLSDGSLLTLGSR
                     ELGLHRICDVRCQASTEKTAETSLEENTIAVQLEAAENDNRVAEESDFTFLSNDIDMS
                     SLSMHSDCSSSHTLHSEPGLELLHYEKQPERRANSNIYSLSDIVLSGSTIYH"
     gene            <720957..>723323
                     /locus_tag="HG536_0G04050"
                     /db_xref="GeneID:59327784"
     mRNA            <720957..>723323
                     /locus_tag="HG536_0G04050"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285321.1"
                     /db_xref="GeneID:59327784"
     CDS             720957..723323
                     /locus_tag="HG536_0G04050"
                     /inference="similar to AA sequence:RefSeq:NP_011051.3"
                     /note="ancestral locus Anc_8.134"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141217.1"
                     /db_xref="GeneID:59327784"
                     /translation="MAGIVVKLVAAESLYKRDVFRSPDPFAVLTIDGYQTKSTSAAKK
                     TLNPYWNENFKFTDVNENSILTIQVFDQKKFKKKDQGFLGVINIRIGDVLGHLDEDTA
                     AGTRPPEETITRELKRSNDGMAVSGRLIVVLSKEATSSGGSSNETPQANGGRLTSSSR
                     SQSGSHTPRPTAGSVEHTLQSGANASAEASSGTNGSARQYSSFEDQYGRLPPGWERRT
                     DNFGRTYYVDHNTRTTTWKRPTLDQSEAERGNQLNANTEAQRRQHRGRTLPTGSNDSS
                     SVTVQTGFSPQTPAVNGSAAAAFAATGATTSGLGELPSGWEQRFTPEGRAYFVDHNTR
                     TTTWVDPRRQQFIRTYGPTNTTIQQQPVSQLGPLPSGWEMRLTNTARVYFVDHNTKTT
                     TWDDPRLPSSLDQNVPQYKRDFRRKVIYFRSQPALRILPGQCHIKVRRKNIFEDAYQE
                     IMRQTPEDLKKRLMIKFDGEEGLDYGGVSREFFFLLSHEMFNPFYCLFEYSAHDNYTI
                     QINPNSGINPEHLNYFKFIGRVVGLGVFHRRFLDAFFVGALYKMMLRKKVVLQDMEGV
                     DAEVHNSLKWMLENSIDGILDLTFSADDERFGEVVNVDLKPDGRTAEVTDENKKEYVE
                     LFTQWKIVDRVQEQFRAFMDGFNELIPEDLVTVFDERELELLIGGIAEIDVEDWKKHT
                     DYRGYQESDEVIKWFWKCITEWDNEQRARLLQFTTGTSRIPVNGFKDLQGSDGPRRFT
                     IEKAGEQGQLPKSHTCFNRVDLPPYEDYDSLKQKLTLAVEETIGFGQE"
     gene            <723758..>725251
                     /locus_tag="HG536_0G04060"
                     /db_xref="GeneID:59327785"
     mRNA            <723758..>725251
                     /locus_tag="HG536_0G04060"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285322.1"
                     /db_xref="GeneID:59327785"
     CDS             723758..725251
                     /locus_tag="HG536_0G04060"
                     /inference="similar to AA sequence:RefSeq:NP_011339.1"
                     /note="ancestral locus Anc_8.135"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141218.1"
                     /db_xref="GeneID:59327785"
                     /translation="MPPKLPGLYFDEVKGRYFPLKASVGSEYGEREQKKRKIRLQREE
                     HARQLKDQRCRNYEKYASRLVGSVDKLFGGSDGFRFANALEIEATSVDSCVKSNLERE
                     IYDLGIRLHNMNGPVVCEQVRPDRLLLATSTTEGAIIGVEQLFNGNGVVISNYLSGNS
                     EISCYASNNIIRFTGNSFGELGLYCHMAQAVTTLHTFTRVRRRGEIIVDTLHRELGSY
                     GNVYDSVNLGRTFIVAAGSSLQVCSWNDKSNDGCRKFRSFPNKSDILCLAVKSGDPGV
                     LYAGTRNGWIYVVPVERNGTLSQTAIKRFKVQGARSIISIKTTDTQGLIFVSAISNDT
                     HQALLLLDTMLEPEECTLATFRTSFSNVTRDQEFFEVTHDGRFLLYGSATGGNGSGDF
                     EVFSSHLGDNLAHERNGRAFTFFPLNSLRDGYLKYPEFCALRDLQLRSAIFINCKRNP
                     GALKYESEMDETYSITCPEDWRVSAFLRSESNGEYYARVTMLLKRIV"
     gene            complement(<725968..>728232)
                     /locus_tag="HG536_0G04070"
                     /db_xref="GeneID:59327786"
     mRNA            complement(<725968..>728232)
                     /locus_tag="HG536_0G04070"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285323.1"
                     /db_xref="GeneID:59327786"
     CDS             complement(725968..728232)
                     /locus_tag="HG536_0G04070"
                     /inference="similar to AA sequence:RefSeq:NP_011337.1"
                     /note="ancestral locus Anc_8.136"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141219.1"
                     /db_xref="GeneID:59327786"
                     /translation="MSYNHQPQLSVNSIQSLVEPVTPPPLGQMNNKKYHQKTQSLDLS
                     EFNQFISSSSASESPLAMAKNFSPNATAANNASSNLPLINEFEIAFENCNANSTNSNT
                     TTTASSLRNVSITSNEQLLNNNPMLEITSLPLSELDYVKLATDQFGCRFLQKKLESPS
                     ESNIVRDLMYDQIKPYFLELILDSFGNYLIQKLCEYLTADQKTTLIQSIYPNVFQISI
                     NQYGTRSLQKIIDTVDNENQIDLIIKGFSQEHTTVDQVVTLINDLNGNHVIQKCIFKF
                     PPSKFSFIIDAIVEQNNIITVSTHKHGCCVLQKLLSVCTLQQIFKISVKIVQFLPGLI
                     NDQFGNYIIQFLLDIKELDFYLLAEIFNRVSGELCRLSCLKFSSNVVEKYIKKLFRTI
                     VVTVPKSDSEVARDLNDDVVSAAMRILLTIIDIFTLNLNILIRDNYGNYALQTLLDVK
                     NYSLILEYPGNPVIRNSRLAKFSHDFTAKIGNLVVMTKEFLPSIKTTSYAKKIKLKVK
                     SYAELSGIQFGDLSPKKATHNHNSNGNQGGNHFGHFKNNKSGSGAGQKQHARHFSLPA
                     NVYHRRSSSSASLPFAVPQQGVQQNQNIMNTLCDHVGVNSVSSISYQSPYVPNGSLTQ
                     GFPPQQPFVGTPLPKPNSNPNLQNEHQPIVSMGFVNDSSSSNSSSTNLFQNTGNDLTM
                     MNTFAYSTSSQSSLREPNFSQQRVVSNPFPMQPQPFQQQPNLMGTNYLTPPLYMDGVQ
                     GDYVQGSKQHFGFH"
     gene            complement(<729833..>730618)
                     /locus_tag="HG536_0G04080"
                     /db_xref="GeneID:59327787"
     mRNA            complement(<729833..>730618)
                     /locus_tag="HG536_0G04080"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285324.1"
                     /db_xref="GeneID:59327787"
     CDS             complement(729833..730618)
                     /locus_tag="HG536_0G04080"
                     /inference="similar to AA sequence:RefSeq:NP_011052.1"
                     /note="ancestral locus Anc_8.137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141220.1"
                     /db_xref="GeneID:59327787"
                     /translation="MPQNEYIEQHIKQHGRRLDYEERKRKKEAREAHKVAERAQKLTG
                     WKGKQFAKKRYAEKVAMKKKIRAHEQSKVKGGSKPLDESGEALPTYLLDREQSNTAKA
                     ISSSIKQKRLEKADKFSVPLPKVRGISEEEMFKVVKTGKSKSKSWKRMITKHTFVGEG
                     FTRRPVKMERIIRPSALRQKKANVTHPELGVTVFLPILAVKKNPQSPMYTQLGVLTKG
                     TVIEVNVSELGMVTSGGKVVWGKYAQVTNEPDRDGCVNAVLLV"
     gene            <730854..>731909
                     /locus_tag="HG536_0G04090"
                     /db_xref="GeneID:59327788"
     mRNA            <730854..>731909
                     /locus_tag="HG536_0G04090"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285325.1"
                     /db_xref="GeneID:59327788"
     CDS             730854..731909
                     /locus_tag="HG536_0G04090"
                     /inference="similar to AA sequence:RefSeq:NP_011053.1"
                     /note="ancestral locus Anc_8.138"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141221.1"
                     /db_xref="GeneID:59327788"
                     /translation="MSELELALQSIKDSLQSTSEALEKVQQLYNSQDNDAENGNAGKL
                     KLRILKEGLATDRVSLLSLKNCSMLAYINSLLLVVGGKLDTSCKDPTVKEGRQRSIQH
                     RVVLERGVKPLEKKLSYQLDKLTRAYTRMEKEYVEAENRALAKSQSSVDQESNDDDSS
                     DEELSYRPNVSSSLAAGTKTKKPAEPVEEEEEASAEGAVYKPPKISAVLPPQQLHQFE
                     DKFNARDHRDRSGRSRMQAMEEYIRESSDQPSWESSIGANIVTHGRGGIKSLRDTEKE
                     RDIARYEEANFARLNHGTSKADKRKQKQRERQNQANVIGGEDFGIFNSKRRMEDSTSR
                     RNAKRSRSAWDRAKKKL"
     gene            <732046..>732645
                     /locus_tag="HG536_0G04100"
                     /db_xref="GeneID:59327789"
     mRNA            <732046..>732645
                     /locus_tag="HG536_0G04100"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285326.1"
                     /db_xref="GeneID:59327789"
     CDS             732046..732645
                     /locus_tag="HG536_0G04100"
                     /inference="similar to AA sequence:RefSeq:NP_011054.3"
                     /note="ancestral locus Anc_8.139"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141222.1"
                     /db_xref="GeneID:59327789"
                     /translation="MINEYVARKVATKDTQPCLICSKPTVTVLYNASGPDWLYTCDIH
                     LHDNPQFAIPIHSMEYQEAVEKLKTLKLQAGQAAAAKGSKSWDGWVSHIFTKKPAKEE
                     DNSKSDSSNESQEAEQPEDVQKKYNQQIDLVANLQKKTRKYQLSDITFSSRIERRNNR
                     QRMAERRKKEQELYANTDPNELASQFTFPSVPNNPVTRG"
     gene            <733225..>736623
                     /locus_tag="HG536_0G04110"
                     /db_xref="GeneID:59327790"
     mRNA            <733225..>736623
                     /locus_tag="HG536_0G04110"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285327.1"
                     /db_xref="GeneID:59327790"
     CDS             733225..736623
                     /locus_tag="HG536_0G04110"
                     /inference="similar to AA sequence:RefSeq:NP_011055.3"
                     /note="ancestral locus Anc_8.140"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141223.1"
                     /db_xref="GeneID:59327790"
                     /translation="MDLPVGSMEEVDVPADLSVELRSSAEDLYVPLVKNKNHGTKVGV
                     TSLQASSDCLSGSSSIESLNMLVEKQRKRRLNHPQHQQFIGERLRPQETVKETSEIYL
                     KYDPISRRKVLNTYEIIGELGHGQHGKVKLARDLLTKQLVAIKIVDRHEKRERKLFRF
                     RKSGSQAHSDKIKREIAIMKKCQYKHVVKLREVLDDSKSRKIYLVLEYCGKGEVKWCP
                     GDRMETEARGPPLLSFQRTREILRGVVLGLEYLHFQGVIHRDIKPANLLISDDDTVKI
                     SDFGVSLAATGGDDEDGLDSVDEVELAKTAGTPAFFAPEICLGNEAFERFQLKRQDLF
                     KGSSISFMIDIWALGVTLYCLLFGMLPFISSYELELFEKIVNDPVKYPSYAEVRANNV
                     SEVSGEEEYKAAIDLLDALLQKNPMKRITITQIKKHPFTCWDFNHITSTEDDYIDSKL
                     REIKEFQTDKQEQFKQISISRQELNNAVLGVGKKMIEPMLKKALNGRDGARSKSALSE
                     GQKKNQEDYSDSSYILSEGSVMSNLGNLTDPQIDKLRENNSFAINGIHGRCSTLPTLK
                     PRYSINNDNDNDNNGNDNEPNDKDSDKNNIETGQLSKSEFERELQKFDDKHDPKSMVD
                     LPINSSFASLDSLYIDSFALSKHGKDSDADHPDVKTPSIHVRPPQLGALRNSSYVGRN
                     NRGYPGVLRNPSSQLNLLSSSTRSDRVPHTRPQAISDRRKVANRQWVTNDTSCLQSSP
                     HPEQRRPRGNDDDHFTATAIECKPATPNPWEARGDKESHSFRIKTGNFFSSFDGQDER
                     TSTSSDSSTSEPSTYSSCSDGESDGSNAESLPFEFALDSANASVLSLRDVGGFETVRP
                     FMHSQPATHRPACEKLGKSDSGNSGADSSEHSDSSDELVLSVGPSGFQRRQGSAQSSN
                     NSSRKSTLPYLYPSSDATVTLKGDSTWTMSNASAPTILSQQSQRTLNMCTGPEVQTLD
                     IPAHLSRPLNNLSAGNIAPSTSDHSGSPSSGVMQFTSTPSSSGSLLLSRASAKPTTQA
                     CNVDGVLSKVTPQEHPQDSSRDLLKTVLITAAGSNRRKSVPCIAMPENADGERLIKSS
                     HDGNVPEEHLQKRFPRCAVRHRSDACPSRSQSISLGTLSKKHTK"
     gene            <737025..>737783
                     /locus_tag="HG536_0G04120"
                     /db_xref="GeneID:59327791"
     mRNA            <737025..>737783
                     /locus_tag="HG536_0G04120"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285328.1"
                     /db_xref="GeneID:59327791"
     CDS             737025..737783
                     /locus_tag="HG536_0G04120"
                     /inference="similar to AA sequence:RefSeq:NP_014244.1"
                     /note="ancestral locus Anc_2.106"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141224.1"
                     /db_xref="GeneID:59327791"
                     /translation="MTAAVEKETGMLDAGSHCSFCRQLDFLPFHCKYCEGNFCASHRS
                     KESHHCRWLIENEQKAQPVQTKVVDNDGKYFQSLLPEKGYIRVRQVDSSKKESSSVRP
                     KGSKSALDKLAKFFKKRDSINKSKPKSSKPNAFIELAKLKKNAMGDDKIPVSNRVYVY
                     CYKIDDKENDSAAHEIYINKIWPLGRALDSIAQRLNVSNHNVDLNVTSREKLYLYKRD
                     EKKGDLQLLELSSRVAAEIRDLDTLYLVRGDDTI"
     gene            complement(<737866..>739602)
                     /locus_tag="HG536_0G04130"
                     /db_xref="GeneID:59327792"
     mRNA            complement(<737866..>739602)
                     /locus_tag="HG536_0G04130"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285329.1"
                     /db_xref="GeneID:59327792"
     CDS             complement(737866..739602)
                     /locus_tag="HG536_0G04130"
                     /inference="similar to AA sequence:RefSeq:NP_012003.1"
                     /note="ancestral locus Anc_2.105"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141225.1"
                     /db_xref="GeneID:59327792"
                     /translation="MAQVQGSQAIAAANSALAVNNLANSGMGRFATGGNTPVGSAGNS
                     NNNTNVPITSNIVAVNNHVAHQAGGVNGFGARDDSTIVGLHYRIGKKIGEGSFGVLFE
                     GTNMINGLAVAIKFEPRKTEAPQLKDEYRTYKILSGTPGVPQAYYFGQEGLHNILVID
                     LLGPSLEDLFDWCGRRFSVKTVVQVAVQMITLIEDLHTHDLIYRDIKPDNFLIGRPGQ
                     PDENKVHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDME
                     AMGHVFFYFLRGQLPWQGLKAPNNKQKYEKIGEKKRSTNVYDLSQGLPIQFGRYLEIV
                     RNLSFEETPDYEGYRRLLLSVLDDLGQTADGEYDWMKLNGGRGWDLAINKKPNLHGYG
                     HPNPPNEKSRKHRSKFSANNHHQTNQISQQQPQLAQQQQTQQQQQQQQQVQQAQLQQQ
                     LNQRNQIPSNQLQHAQQQEMSDHYRPGQNQFANNLDPTSYEAYQQQTQQKYAQQQQQQ
                     KLKNNQQGPNSYQNNRGPNNYRSSPQVVTNKYQYQEQPTTNPLQHDGSKNGGDQGSAE
                     SAKGFFRKLGCC"
     gene            <740830..>742314
                     /locus_tag="HG536_0G04140"
                     /db_xref="GeneID:59327793"
     mRNA            <740830..>742314
                     /locus_tag="HG536_0G04140"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285330.1"
                     /db_xref="GeneID:59327793"
     CDS             740830..742314
                     /locus_tag="HG536_0G04140"
                     /inference="similar to AA sequence:RefSeq:NP_012005.1"
                     /note="ancestral locus Anc_2.102"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141226.1"
                     /db_xref="GeneID:59327793"
                     /translation="MDYDRLKERYSKFLSKRDERRELVSFWDGDLPSKDLICLEAGMP
                     NEKLFPIKAIDLHLVDQPFDDGDGDKVSITRYEQPAEMPIARAFQYSEVRGMLPMVSF
                     CKRIVEMTNRPVYDNWDVLLSNGSSDSMFKVFETLCDESSTVLMEEFTFSPVVSNVTS
                     TGASCVPLKMHLTTDPRDQGIDVEYMEQLLDNWHELEEYKRLNKPKLLYTIVTGQNPT
                     GMTLSMQKRQQIYRLAQKHDLIIVEDDPYGYLTFPPYDPENPMKNVYTDTENPMSIDE
                     YLQKRLIKSFLTLDTDARVIRLETFSKMYAPGLRLSFIVANKFIIDRLLNLSEITTRA
                     PSGASQAIVYATVKAMAARETAYQDEQDRMFYGWIRWAMKLAGTYTHRRNVAFKALYE
                     TDAYKSHLFSVLEPSAGMFINVKINWPHAPPDDMRRSLDQLDTVLVKNGVKVVLGYKL
                     AVDQSFSIDSSGFLRFTVAYASHDEQLIEGCHRIGNGIQEFLGY"
     gene            <742445..>742834
                     /locus_tag="HG536_0G04150"
                     /db_xref="GeneID:59327794"
     mRNA            <742445..>742834
                     /locus_tag="HG536_0G04150"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285331.1"
                     /db_xref="GeneID:59327794"
     CDS             742445..742834
                     /locus_tag="HG536_0G04150"
                     /inference="similar to AA sequence:RefSeq:NP_014246.1"
                     /note="ancestral locus Anc_2.101"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141227.1"
                     /db_xref="GeneID:59327794"
                     /translation="MELLPQGKKNNVNVTFEDQQQINKFSKLIMRKDNLEKELSQQRQ
                     EKDYLDDVSLELELVDEDELVPYKIGAIFVHLKQSEVVEQLERDAEIVDGVIESLEAQ
                     QTELDEDIRVLKSSLYGKFGDNINLER"
     gene            complement(<742874..>743119)
                     /locus_tag="HG536_0G04160"
                     /db_xref="GeneID:59327795"
     mRNA            complement(<742874..>743119)
                     /locus_tag="HG536_0G04160"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285332.1"
                     /db_xref="GeneID:59327795"
     CDS             complement(742874..743119)
                     /locus_tag="HG536_0G04160"
                     /inference="similar to AA sequence:RefSeq:NP_012006.1"
                     /note="ancestral locus Anc_2.100"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141228.1"
                     /db_xref="GeneID:59327795"
                     /translation="MSSAILDDIKSVVYNMGAKITHEYSLIKGFTMDASDELLPRLKQ
                     KLLEIENTFGYRVHLERDSEVHSFRSHDESLEKGEHS"
     gene            complement(<743417..>744916)
                     /locus_tag="HG536_0G04170"
                     /db_xref="GeneID:59327796"
     mRNA            complement(<743417..>744916)
                     /locus_tag="HG536_0G04170"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285333.1"
                     /db_xref="GeneID:59327796"
     CDS             complement(743417..744916)
                     /locus_tag="HG536_0G04170"
                     /inference="similar to AA sequence:RefSeq:NP_014257.1"
                     /note="ancestral locus Anc_2.99"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141229.1"
                     /db_xref="GeneID:59327796"
                     /translation="MSLNLTGTPTGVGTGGNSLTTDMNTQFNSADMAWLGVSAAGVWI
                     MIPGIGLLYSGMSRKKHALSLLWASMMAASVVIFQWFFWGYSLAFSHSVKGHGFIGTL
                     QNFGFMKVLGAPSSVSSVPDILFAVFQGMFAGVTGALMLGGACERARLFPMMIFLFLW
                     MTIVYSPIACWTWNSQGWLALLGALDYAGGGPVHICSGHGALIYALILGKRNDPVAKK
                     GMPKYKPHSVTSVVLGTVFLWFGWQFFNPGSAGNASIRAWYSAMNTNLAAACGGLTWM
                     FIDYFRSGGKWTTVGLCSGIIAGLVGITPAAGFVPIWSSVVIGIVTATGCNFASDLKN
                     LLHIDDGMDVWALHGVGGAIGSVFTGIFAADYVNATAGAEAVPIAGGWINHHWKQVGY
                     QLAAMCSTIAWTVTVTACLLLIMDRIPFLRLRLRADEEELGTDEAQIGEFTYSEETPY
                     IPEPIRSRVSAIDPGQEHIDDKIVGSTEPQEPSSVSDSNEMAPAEKATA"
     gene            complement(<745362..>746378)
                     /locus_tag="HG536_0G04180"
                     /db_xref="GeneID:59327797"
     mRNA            complement(<745362..>746378)
                     /locus_tag="HG536_0G04180"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285334.1"
                     /db_xref="GeneID:59327797"
     CDS             complement(745362..746378)
                     /locus_tag="HG536_0G04180"
                     /inference="similar to AA sequence:RefSeq:NP_012007.1"
                     /note="ancestral locus Anc_2.98"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141230.1"
                     /db_xref="GeneID:59327797"
                     /translation="MKLSIVAAVMAACSTVLSSPVYEKFRHGPLNVTTNGTTVWNRSN
                     HSNVSGGAAGAIGTKLKVFITGGSVPLSNTSQFPNVEWQTLFNASSALNITQLYNVAS
                     SVNQTLQDDTFSGVVIVANKPSIEALGFFSAVVFDTNKTVVVTEDPASGIPVAKDFGS
                     QFRGALTVDKKSGLIYSGVFAPAERGAAGVPVGLLHETQVNWFMEPSLPLLIDTTSPI
                     RVTYSNFTTTNVSNNSPVVPIIFDGNFSQSIVNRLAGSINGLVVAVPDFVSNSSTSTL
                     SSTQLPVVFAGVSSGIPFVAGDDVPSDAIAAGYLSPIKSQVLVSIAAANNVSSPASVD
                     QLFP"
     gene            <746907..>747599
                     /locus_tag="HG536_0G04190"
                     /db_xref="GeneID:59327798"
     mRNA            <746907..>747599
                     /locus_tag="HG536_0G04190"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285335.1"
                     /db_xref="GeneID:59327798"
     CDS             746907..747599
                     /locus_tag="HG536_0G04190"
                     /inference="similar to AA sequence:RefSeq:NP_012009.1"
                     /note="ancestral locus Anc_2.97"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141231.1"
                     /db_xref="GeneID:59327798"
                     /translation="MEPPVTVVSFVINVASLIVVSYGLYTCTGVELPPSLKDAGHKQF
                     LTNLCATFTILNDLCNIANFVAQSSGSPVHSLSFVARHVTLPLAMGVESVVAAVYWPL
                     RLFAMHLIFTSSADNDRCPIPLPSDLAIHLAPITFLLCDHYLSGAGTKFRISNRVASS
                     IVLALGFGYKAYLDRLIDKDAGQAFPYPFLDVEEPKRSIIAGLVTSLFMLFYLLYQSK
                     PPKSVRLPGKID"
     gene            complement(<747917..>750058)
                     /locus_tag="HG536_0G04200"
                     /db_xref="GeneID:59327799"
     mRNA            complement(<747917..>750058)
                     /locus_tag="HG536_0G04200"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285336.1"
                     /db_xref="GeneID:59327799"
     CDS             complement(747917..750058)
                     /locus_tag="HG536_0G04200"
                     /inference="similar to AA sequence:RefSeq:NP_014238.3"
                     /note="ancestral locus Anc_2.96"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141232.1"
                     /db_xref="GeneID:59327799"
                     /translation="MMFGNQNPYSSSSNGQQRSQRRDGGYQMGRSVEGNYGNDAKRQP
                     GSQPPLREQVYAESPITGGFTDLPPLNYPVTPPNRNAPILQHQQLTPPQSVPGLYMNN
                     NDSSSHLQNGTHLQQQQHYQQQYQQQQPIIQFSPGQYSTGSDYSHNINRSGSSSPLHQ
                     PQQLHSIGSQHSSPVRSIGNMPVQQHPQPQLNQQLYQGKPPQQQQQQVLAQQSQSNYM
                     YFERRPDLLTKTTQDKAAAVKLKIENFYQSSVKYAIERNQRRVELESSLNAQDWSEER
                     RSRELTSLGKKESQFLRLRRTRLSLDDFHTVKVIGKGAFGEVRLVQKKDTGKIYAMKT
                     LLKSEMYKKDQLAHVKAERDVLAGSDSPWVVSLYYSFQDTQYLYLIMEFLPGGDLMTM
                     LIRWQIFTEDVTRFYMAECILAIEAIHKLGFIHRDIKPDNILIDIRGHIKLSDFGLST
                     GFHKTHDSSYYKKLLQQDEANGNDLPKPRQPNGNEDENSNRQTMIVDAIHLTMSNRQQ
                     IQTWRKSRRLMAYSTVGTPDYIAPEIFLYQGYGQECDWWSLGAIMYECLIGWPPFCSE
                     TPQETYRKIMNFEQTLHFPDDIHISYEAEDLIRRLLTHADQRLGRHGGADEIKSHPFF
                     RGVDWNTIRHVEAPYIPKLSSITDTRFFPTDELENVPDSPAMAQAAKQREQIIKQGGN
                     PNANGTPVKEDLPFIGYTYSRFDYLTRKNAL"
     gene            complement(<750420..>750979)
                     /locus_tag="HG536_0G04210"
                     /db_xref="GeneID:59327800"
     mRNA            complement(join(<750420..750736,750976..>750979))
                     /locus_tag="HG536_0G04210"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285337.1"
                     /db_xref="GeneID:59327800"
     CDS             complement(join(750420..750736,750976..750979))
                     /locus_tag="HG536_0G04210"
                     /inference="similar to AA sequence:RefSeq:NP_012010.1"
                     /note="ancestral locus Anc_2.95"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141233.1"
                     /db_xref="GeneID:59327800"
                     /translation="MVNVPKTRKTYCKGKACRKHTQHKVTQYKAGKASLFAQGKRRYD
                     RKQSGFGGQTKPVFHKKAKTTKKVVLRLECVACKTKAQLTLKRCKHFELGGEKKQKGQ
                     ALQF"
     gene            <751855..>752805
                     /locus_tag="HG536_0G04220"
                     /db_xref="GeneID:59327801"
     mRNA            <751855..>752805
                     /locus_tag="HG536_0G04220"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285338.1"
                     /db_xref="GeneID:59327801"
     CDS             751855..752805
                     /locus_tag="HG536_0G04220"
                     /inference="similar to AA sequence:RefSeq:NP_012011.1"
                     /note="ancestral locus Anc_2.94"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141234.1"
                     /db_xref="GeneID:59327801"
                     /translation="MAYGDFSDICLKTPLPLCSVVKSTTHMVLSNSTTMHNFDPTNMN
                     VGILPRCYARSIDVANTVIFGIGNAFVNIGALVVILIIMYNVRQKYTAIGRSEYLYFF
                     QLTLLLIIFTLVVNTGASPPGSGSYPYFVAIQIGLAGACCWTLLINGFLGFNLWEDGT
                     RKSMLLVRGSSVLGFIGNFLAAILTFEAWIERGKIDPMNTVGLFTMVYVVNAIVLGIY
                     TICQLLVSFFVVRSLWVTGAIMLGVFFFVVGQIIVFAVSDILCQKANHYIDGLFVGSL
                     CNLFTLMMVYKIWDMTTDDDLEFSVSVSKEGAVIHSNTLR"
     gene            complement(<752839..>753078)
                     /locus_tag="HG536_0G04230"
                     /db_xref="GeneID:59327802"
     mRNA            complement(<752839..>753078)
                     /locus_tag="HG536_0G04230"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285339.1"
                     /db_xref="GeneID:59327802"
     CDS             complement(752839..753078)
                     /locus_tag="HG536_0G04230"
                     /inference="similar to AA sequence:RefSeq:NP_076906.1"
                     /note="ancestral locus Anc_2.93"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141235.1"
                     /db_xref="GeneID:59327802"
                     /translation="MSGDKREDIDLESDELMAEMCPQCGEFLQKCLIQQNYAVIICPS
                     LQCAFPFNQNKALDNIVYVDESEVLEVARQRLTKS"
     gene            <753623..>756892
                     /locus_tag="HG536_0G04240"
                     /db_xref="GeneID:59327803"
     mRNA            <753623..>756892
                     /locus_tag="HG536_0G04240"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285340.1"
                     /db_xref="GeneID:59327803"
     CDS             753623..756892
                     /locus_tag="HG536_0G04240"
                     /inference="similar to AA sequence:RefSeq:NP_014236.1"
                     /note="ancestral locus Anc_2.92"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141236.1"
                     /db_xref="GeneID:59327803"
                     /translation="MPRVESDTFIRLQNDPSCIRNICIVAHVDHGKTSLSDSLLASNG
                     IISQRLAGKIRYLDSRPDEQLRGITMESSAVSLYFRVLHKQEGLEEPLVNEHLINLID
                     SPGHIDFSSEVSAASKLCDGAVVLIDVVEGVCSQTVTVLRQSWTEKLKPVLVLNKIDR
                     LITELQLSPTEAYIHLSKVIEQVNSIIGSFFAGERQLDDYSWREQLEKNESARYVEKD
                     DSDLYFNPIDNNVIFASALDGWGFNISQIAKFYERKLGAKRENLQKVLWGDYYLDPKT
                     KKIINSKGLKNRPLKCLFVSLVLENIWKIYENVILSKNTEVMEKITKALNIEVLPRDL
                     RSKDDKQLLRKIMGQWLPVSTAVLLTVIEKVPSPLESQRERLDKILSGASGVEKVDAE
                     VLESMRKCDRDGVASGYVSKMLSIPREELPIEPRGNFGDNLLEKNHRARAQALRAAKQ
                     AELNDKLSNMNISDDAKAADIDLYQRAKDTVLTPEIEDFQGKGSKFGSQEESQSSNLG
                     FQFEVEDAGNDMTGFVPTLDPNDPLSSMFDYEEEDPFNSQALKNELEDSGDEYDEEHE
                     VMIGFARIYSGTLKVGQEISVLGPKYDPESPDQYTQTATITGLYLFMGRELVPLDSCP
                     SGNIVGISGLAGKILKNGTLVQKGVTGVNLAGTSLQTPPIVRVAIEPANPMEMNKLVK
                     GLKLLNHADPCVETYVEDSGEHILCTAGELHLERCLKDLRERFAGIELTHSEPAIPYR
                     ETFLSTSEMNRSKNTEGKRGLVTLMLGPYKIRYRMIPLPLEITALLEENQAAIKSLLE
                     ESPKDRAQHIVKDRSFVQQLSNALSRYSDEVVGLPGSVDKIAAFGPKKVGSNILFSEG
                     GLLGSIFSAAAARFEYSDSLVNGFQLAVGEGPLAKEPVQGMFVVVEDVSEVTEEDIAS
                     SEDVQYQREIVDVSGRLITSSRDVIHEGFMDWSPRMMWAMYSCDIQTSVDVLGKVYAV
                     VQQRRGRIVSEEMKEGTPFFQIEAHIPVVEAFGFSEDIRKKTSGAAQPQLVFVGFECI
                     DMDPFWVPTTEEELEELGEFADKENIARRHMNSVRRRKGLFVNEKLVENAEKQRTLKR
                     N"
     gene            <757181..>758200
                     /locus_tag="HG536_0G04250"
                     /db_xref="GeneID:59327804"
     mRNA            <757181..>758200
                     /locus_tag="HG536_0G04250"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285341.1"
                     /db_xref="GeneID:59327804"
     CDS             757181..758200
                     /locus_tag="HG536_0G04250"
                     /inference="similar to AA sequence:RefSeq:NP_014235.1"
                     /note="ancestral locus Anc_2.91"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141237.1"
                     /db_xref="GeneID:59327804"
                     /translation="MLVVIARKLVNRGGRTSDLCNYWHSTLPLLGMSSPAINQNGSLP
                     VNMMMQEGMQALSKILKGPLLEQKRVNMDQATMQVLLGQGQNRKGREAAQHGVHDLNY
                     DQYGIDDTVPTNQIVVETNHDEGIDDPELHLGDEEGEIIFDCGTQELVGSPDKIGEHI
                     TQMLESVLPNGIQSGADGRLHAVVNGDELNITEESFMDFKEAMSSLGQVQKLQRHQKE
                     PKPSAERSAVEKSSDGAHEPYQGQEMALSDENHHQKLENSNRRNPVGHLEYDYPTTQP
                     RKAPNFTALMSVKKPLCLFCEYYMVFGEPPRNMIKWYNNNYEYDDLPRTEEKLQHKNR
                     RKRNR"
     gene            <758787..>759455
                     /locus_tag="HG536_0G04260"
                     /db_xref="GeneID:59327805"
     mRNA            <758787..>759455
                     /locus_tag="HG536_0G04260"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285342.1"
                     /db_xref="GeneID:59327805"
     CDS             758787..759455
                     /locus_tag="HG536_0G04260"
                     /inference="similar to AA sequence:RefSeq:NP_012012.1"
                     /note="ancestral locus Anc_2.90"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141238.1"
                     /db_xref="GeneID:59327805"
                     /translation="MKFQLKSILSSVAFLLAAVKADEVKLFTSDGVVYSYAVVTSTIA
                     PPSVRVETHYYTTFRVRETTLADSEVQTTTEKIISASETTSPVESPYSSTTPTFSSPS
                     SSQTEESRSISTLMPSSVVSLTTNTGFTSSSSSSTSFSQSSSSAISIVSTSSQSASPT
                     VSSVDGSSTTRTTVTGTDGKCTVYYDDAEYYSTVYLTEPNQSVDAATTITSTRLVYET
                     LTLN"
     gene            complement(<759604..>760710)
                     /locus_tag="HG536_0G04270"
                     /db_xref="GeneID:59327806"
     mRNA            complement(<759604..>760710)
                     /locus_tag="HG536_0G04270"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285343.1"
                     /db_xref="GeneID:59327806"
     CDS             complement(759604..760710)
                     /locus_tag="HG536_0G04270"
                     /inference="similar to AA sequence:RefSeq:NP_014234.3"
                     /note="ancestral locus Anc_2.89"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141239.1"
                     /db_xref="GeneID:59327806"
                     /translation="MNRVRNIIGHQHTGSNRQQVNRDQHETGDDLDDQSTMFERQSED
                     LEDSVTLNTAVSGSVTIGDFQRLGFVNRCPSFDAERTMPLASVLLTKGFFCFPSELSL
                     RTFLDNKRRLDALDSINGLGIPLFHAVSAGVVKSIFNRHAPIMRIYRYVLIDSNREKP
                     PQNGELISQDGFKMLFKCLFCSVYQEIVCNYSRVEHKFVFNATRENETVPETLVMASH
                     VQSRGSDTRLMGLNLRWYGTTGFASPFGSGSFKLLVLDDGMPSRMDCRTLDEFDRESR
                     SYHGRMSGRLPTWATYSDQCSSVFPRKRTLRLAEFKIGELNRVNGVCSSGIFDIPKET
                     LALTCMCLVLHDFETRKDKRGGTAMALPSVPFLL"
     gene            <761209..>761991
                     /locus_tag="HG536_0G04280"
                     /db_xref="GeneID:59327807"
     mRNA            <761209..>761991
                     /locus_tag="HG536_0G04280"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285344.1"
                     /db_xref="GeneID:59327807"
     CDS             761209..761991
                     /locus_tag="HG536_0G04280"
                     /inference="similar to AA sequence:RefSeq:NP_014233.1"
                     /note="ancestral locus Anc_2.88"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141240.1"
                     /db_xref="GeneID:59327807"
                     /translation="MGVDQEAIRKRFSQLEMDINNINKMIDDKLQISTERETEDDTVV
                     AAEAAAATVEQPQTSAASGSESIGAGETAPEQQPAKLEESAADHVIDQTTDTSEDFTA
                     GNVTTGISSNSSLSSPGRPETPIFIPKNGSESTTTLRRPTNPFRVISVGTPHTDATRK
                     PSSETTAADSDSVTKLQKRLDYLTKKCVKLQKEIKYLNDMNHKSTLSIEDGRKLSSAI
                     EKLQEYLDRKTKEKYDLGVLVSRQLRKEIDRGENGQFWIGTK"
     gene            <762173..>762385
                     /locus_tag="HG536_0G04290"
                     /db_xref="GeneID:59327808"
     mRNA            <762173..>762385
                     /locus_tag="HG536_0G04290"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285345.1"
                     /db_xref="GeneID:59327808"
     CDS             762173..762385
                     /locus_tag="HG536_0G04290"
                     /inference="similar to AA sequence:RefSeq:NP_012013.1"
                     /note="ancestral locus Anc_2.87"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141241.1"
                     /db_xref="GeneID:59327808"
                     /translation="MSREGFQIPTNLDVAAAGTSQARSATLKYICAECSSKLSLSRTD
                     PVRCKNCGHRILLKARTKRMVQFEAR"
     gene            <762831..>764780
                     /locus_tag="HG536_0G04300"
                     /db_xref="GeneID:59327809"
     mRNA            <762831..>764780
                     /locus_tag="HG536_0G04300"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285346.1"
                     /db_xref="GeneID:59327809"
     CDS             762831..764780
                     /locus_tag="HG536_0G04300"
                     /inference="similar to AA sequence:RefSeq:NP_014232.1"
                     /note="ancestral locus Anc_2.86"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141242.1"
                     /db_xref="GeneID:59327809"
                     /translation="MAQNDRRNGVVPVSESASMFDLEPNPFEQSFASTKKSQPTSGAV
                     PSPQDQRLAGVAGQTGEKSSKVTIPEINSNIKESDVGNQRRSSVFSYGTQKPHLQSPP
                     LLTPGGSRRLPPILLSPNFIQQAPSGSLAVQGPLGSLMANYSSMSPKNELPSADTELQ
                     RPPLSLGLSKTVFAANESSLRTGLTPNIQGTIAQVGPTHHPAHALPYFGGPRNDIGSQ
                     EDNRSATVYGTSMATGSDLGGPSQPYTPGIGSLLGFSSTQAFQRSTNPPPRNGVLPVA
                     GPLADPNSAQRFAQIQNYTAEPITASIKDQHTKSLGSNSPPRTAVRRKRKSSTPSRGS
                     KSSKSSRRNTPTSHDSKNAGKKEVSDSADKDSDDGQERKRREFLERNRVAASKFRKRK
                     KEYIKRVETDLKFYEAEYEDMSHAINKLCGIVNVSCSPVASSSLVCMLETAISKNDAP
                     SSLSILAHIKQILYQTRYFQRNGRNPRREIEYPPDSDDDDRQRTDKESSSRHNSIAAI
                     PSSVNSSRAPDTSIPGPVAASYITSGGPPSGGTGSSKSTLTDTTSAPSIVKEEDPVPA
                     VYTIPLAEDKKSSDGSTVASAIGTISSLPTVINGRPVIPLSDIDPHRNSDPSSISGIR
                     QSSLVNLTSDVVNTEQISFKYPNSD"
     gene            <765016..>765801
                     /locus_tag="HG536_0G04310"
                     /db_xref="GeneID:59327810"
     mRNA            <765016..>765801
                     /locus_tag="HG536_0G04310"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285347.1"
                     /db_xref="GeneID:59327810"
     CDS             765016..765801
                     /locus_tag="HG536_0G04310"
                     /inference="similar to AA sequence:RefSeq:NP_014231.1"
                     /note="ancestral locus Anc_2.85"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141243.1"
                     /db_xref="GeneID:59327810"
                     /translation="MSYHYLKSARKVMCIGRNYAAHIKELNNATPKQPFFFLKPTSSI
                     ITPIDRDNARKSLPGNSSYHGLSEDGTNPSPIYIPKGVVVHHEVELALVINKYISNAE
                     ASEFGPKQVYDAISGVFLALDLTARNVQDEAKKKGLPWTIAKGFDTFLPCSRLVPREQ
                     LVKDRENLQDAFRLSCSVNGTVRQDGTTGLMLHPLHKIIQHISTMITLEPGDIVLTGT
                     PAGVGKLHPGDVIESSLYYHDDKLIDMTFDCEERPGPYFFRET"
     gene            complement(<765840..>766769)
                     /locus_tag="HG536_0G04320"
                     /db_xref="GeneID:59327811"
     mRNA            complement(<765840..>766769)
                     /locus_tag="HG536_0G04320"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285348.1"
                     /db_xref="GeneID:59327811"
     CDS             complement(765840..766769)
                     /locus_tag="HG536_0G04320"
                     /inference="similar to AA sequence:RefSeq:NP_012014.1"
                     /note="ancestral locus Anc_2.84"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141244.1"
                     /db_xref="GeneID:59327811"
                     /translation="MLVAVSGTKYSGIELAIEILVEQFGFELLSYAQDADELLDYATR
                     HYTKNMTVRCEKLSLLETLEKRPFFVHVSLDAPVGTRYKLSSEKRSLEEFIRALDAHD
                     FTDQSVVMRERSHVKLKVMDGDVETIRARLADALGSQLQALSSSSMSDEVIPPLRPDW
                     DSYFMKLATLAASRSNCMKRKVGCVIVRDRRVIATGYNGTPRHLKNCFNGGCPRCNGG
                     DSHALHTCLCLHAEENALLEAGRDRVGTNAILYCDTCPCLTCSVKIVQTGITEVVYSQ
                     TYRMDEASFQVLRDAGVKVRQFSFILEPRIMMV"
     gene            <767650..>769125
                     /locus_tag="HG536_0G04330"
                     /db_xref="GeneID:59327812"
     mRNA            <767650..>769125
                     /locus_tag="HG536_0G04330"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285349.1"
                     /db_xref="GeneID:59327812"
     CDS             767650..769125
                     /locus_tag="HG536_0G04330"
                     /inference="similar to AA sequence:RefSeq:NP_014230.1"
                     /note="ancestral locus Anc_2.83"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141245.1"
                     /db_xref="GeneID:59327812"
                     /translation="MIPVGKAFTHGRTIITMPVGRLAHKIQLRNRTATLWSKNFSSGG
                     PALQKPRGDSVVQRVSGNHAGRMLSRKSAIKWVVLTGVTIALSSIILNSQHNEGDDDE
                     DTKHRRKKPRIKIFDNDWLFFCYSTLPLNALSRLWGQVNSLTLPVWFRPWGYKCYSYL
                     FGVNMDEMADPDLRHYANLSEFFYRSIKPDVRPIHPGANVVVCPSDGKVLKIGIIDSE
                     KGEIEQVKGLTYSIKDFLGTHSHPSMSKSQSTLDLQADEEQDRKFAEQINFKLSDDRG
                     YESEQPIKIKREGDKVIEESKPPISKSLKLLSELSLMTAYHMPYNEPNDTQLYFAVIY
                     LAPGDYHHYHSPVDWVCKLRRHFPGDLFSVAPYFQRNFPNLFVLNERVALLGHWKHGF
                     FSMTAVGATNVGSIKLSFDKELVTNVKRNKHNEPHSCYEATYQNASKILDGMPLLKGD
                     EMGGFMLGSTVVLCFEAPKSFRFNVKVGDKVKLGQKLGTVE"
     gene            complement(<769219..>774177)
                     /locus_tag="HG536_0G04340"
                     /db_xref="GeneID:59327813"
     mRNA            complement(<769219..>774177)
                     /locus_tag="HG536_0G04340"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285350.1"
                     /db_xref="GeneID:59327813"
     CDS             complement(769219..774177)
                     /locus_tag="HG536_0G04340"
                     /inference="similar to AA sequence:RefSeq:NP_014227.4"
                     /note="ancestral locus Anc_2.82"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141246.1"
                     /db_xref="GeneID:59327813"
                     /translation="MNDCPSPEIIDAARESCGISHATEEDYFQWDPQGRGDLWICNQR
                     RTVEWFVGGQSIRKFSYDQSVIKAGFVNFATVSNCLVIIFKDVAYVYYLSNGDSTTVC
                     FPFNISNAFWYSQGVVLERQSCLARLESPEMEAQHKFITLSDPMAPFGFITFSAQQKN
                     DDGLRNFRMLMFPKDEDHNITVLYDVHQLKLHFYYTTVLDIDPEIESGKKDYIANSGS
                     PTNVVDPSKNLRKISILNRRVNSTTTAHEINDSAQTDGINAFQPGAKPTRSMSATVDR
                     MSGSSTSPTVDFSANPIQQPQQQSDFLSQTISSKNVQLTKISSMTLPHQSAQEIEILQ
                     CVALRLQDQEAITIFDGASNFSKVWIIDLIPDVINSISFRLYGNSPQELIRLSNLDTQ
                     QPVDDILPFCSTKITGTLALMFDNRKKICLYNPFVELETPQLELPSENLCFISDEKMI
                     FKDFDLSTKCGHYEARSDFPYPHKSSIKLCFEAIKWICPPGVFYAIIFLWQFVVSNHD
                     WPRQDREFLGLKYIISSLISPADERITINLSQINAFRYLTSADPSCLVPKIIMGLHLV
                     REELALNILAKKDVQQLGDFLFFATSKMGWPAEWRLYYGNGSMELDSNLIVESFAHPL
                     DEPPSILKSLYSVTENSQLPTTPFICFSRLAERDSQVDQLVTPKTFKTLRLYELTRAS
                     NYTDEYLMEILTKLQIDKEDIETYPLGVMTPLRKILGLIEQRLSRINVNLDMSTISRP
                     DIERCMAMVKQIDKDIESSHRRFQAFKPYYIKGESKPESKGIYTILTDVIKSTRQFTL
                     EKTSFTDNNHMDDFDEGSTLKRNAGMIFSEDHRLNYVLSLLTYYRPHKVHFISKESNY
                     RKLLNQKKMVAKIMSIRTCTSGIGFGAVAYATEKPLVTQKWSRQQLNFSYIFPDGSKL
                     SVQASDLNTEMIEWGDFHSGVSSGLRISKKAKGINGSWIAFSRPKILDAQLGGFLLGL
                     GLNGHLSGLEEWHVYNYLSPKKSPVSIGLLLGMSASMRGTMDLKLTKVLSVHTVAFLP
                     PGSSDLNINLRVQTAGLIGMGLLYLKSQHRRITDVLFSQLPTFIMINEEPVSDEGYRL
                     ATGIALGLINLGAGKSNGDLDFSGHADRDDAPDFSSSNATGPDERVVIGLLQFVRENR
                     DVEESWIPENSQTGAIIALMLIFLKTHNRYISNSIKPKLDQTSNIRPELFMYREWAYY
                     MIMWDEIGRDLSFMLDGLGKCVEPEITTDNLATYYTIAGRILAIGIRHASTGDRVIRD
                     SLLLLMDKFLPFYQYPGTERLDFRLSIDGINTLINVLSVSVSMVMCGTGDLSVMRRLR
                     YLEEVTTGRFSDLFKTSAIRLKRRIIDPSEAEDLQVEGEADISGDTGSQSENELNEGE
                     QETIADGTQLSDLLNEENHFAKFLATNLSLGFLFLGSGQYALKTSELECIAHLIITAL
                     PTYTSKCPLQETKHFWSMAVEPRCLVIRDASTEKIINNVPFEVTVKVNDSFDETRSLV
                     APCLLPDIRKLRSLRINNAEYFPLEIKFDNNLSAADFFQNGTILYIQPKKHNGLPTES
                     FPSRSHQAKQIERALKARMEALDKDLERDELFLDGSSTDRLIDRWGFEDTTMAELRTM
                     TTESLSTEHGIYGYDLDMLCSDVNNGDVGDYQLEIWRKKQKI"
     gene            complement(774916..775025)
                     /locus_tag="HG536_0Gtrna8P"
                     /db_xref="GeneID:59327898"
     tRNA            complement(join(774916..774952,774989..775025))
                     /locus_tag="HG536_0Gtrna8P"
                     /product="tRNA-Pro"
                     /note="codon recognized: CCA"
                     /db_xref="GeneID:59327898"
     gene            <775299..>777254
                     /locus_tag="HG536_0G04350"
                     /db_xref="GeneID:59327814"
     mRNA            <775299..>777254
                     /locus_tag="HG536_0G04350"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285351.1"
                     /db_xref="GeneID:59327814"
     CDS             775299..777254
                     /locus_tag="HG536_0G04350"
                     /inference="similar to AA sequence:RefSeq:NP_012016.1"
                     /note="ancestral locus Anc_2.81"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141247.1"
                     /db_xref="GeneID:59327814"
                     /translation="MLIEENASNYSNNLSSFQKFVMSGSTTVDYTFEWPAGPEEVLVT
                     GEFDEWKGTMPLLKTSSGDFELTFPVKIPADKDRVFFKFIVDGTWLASDAYTKGADEN
                     GIENNYISRNEALALSENPVGTKIPEAGGLVCRTTDSAVADDAIPEPGAYPKTPADGK
                     SEEARSAASKDAPKLEPEAIVSIPAVTGTSQVQEHVTKKAEDAENPENSTEGTEKTER
                     AERSVEKREESIEGTEKTERPEQSVEKSVESAEKAAKSAEKSAKFAEKSAKSAEKSVK
                     SAEKPEQSAEKVAGTGNPEQAGEPSRTPVAAANATTSAPAPEPASVPKPVKTTEAEGI
                     KGTETAAKPQPAAIPSLTVKTTAPGDSNANLTPSGPSDKDVVTSTITSPPRPAGSTAI
                     SEVTGSTVAAKDTALDTIPTVSSSESKKRFKIKRRFKKNKITGEKTIVSEERVPLDSE
                     ESGTEHPLVDEELVASPSEAAAGDVHIMPVGPPIQSENMKFTSLAGEPGPVVPGNVAE
                     VKEFTEVRNVDVDELNERLNKQEREKEAVVDQTEKTSPADAGKQGTLTLDPKTHQNEL
                     RPQTSNKLYEVTNGDSEHVKDDSDAKAAAIPAAAPAKESEPSSEKPATTKNEKKPIAQ
                     KTSATAPKQEEKKKKGGFFSKLKKIFH"
     gene            <777693..>778826
                     /locus_tag="HG536_0G04360"
                     /db_xref="GeneID:59327815"
     mRNA            <777693..>778826
                     /locus_tag="HG536_0G04360"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285352.1"
                     /db_xref="GeneID:59327815"
     CDS             777693..778826
                     /locus_tag="HG536_0G04360"
                     /inference="similar to AA sequence:RefSeq:NP_014224.2"
                     /note="ancestral locus Anc_2.80"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141248.1"
                     /db_xref="GeneID:59327815"
                     /translation="MSTEKEAKIQQALVDPTKKRKAEDEIEIDLKSSVPLSKKQKRLL
                     RRGKITLEELNKKFNIDPTSVEEFEKENEAKGSSEEENSNSIPSDFDEQKAVKKEKKF
                     GVWIGNLSFDTTKEDIMRFIIAKSKGSEDKIQISEEDIIRVHMPLAQNDGKKVKNKGF
                     CYMDFKTREQMEYVVTLSEAHLNGRNLLIKNSKNFDGRPDKNDLVSMSKNPPSRILFV
                     GNLSFDTTDDLLKKHFQHCGEIVKIRMATFQDSGKCKGFAFVDFKEEEGATNALKDKS
                     CRKIAQRPIRMEYGEDRSKRQVKKKPQETQTKRFDLPTDNESKKSERKDNRPAEKPPT
                     RSFKKRNPNVDSNNRLRSSVALASAPRASAAIVPSTGKKVKFD"
     gene            complement(<779109..>781163)
                     /locus_tag="HG536_0G04370"
                     /db_xref="GeneID:59327816"
     mRNA            complement(<779109..>781163)
                     /locus_tag="HG536_0G04370"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285353.1"
                     /db_xref="GeneID:59327816"
     CDS             complement(779109..781163)
                     /locus_tag="HG536_0G04370"
                     /inference="similar to AA sequence:RefSeq:NP_013667.1"
                     /note="ancestral locus Anc_1.493"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141249.1"
                     /db_xref="GeneID:59327816"
                     /translation="MLRSYDAGGRALVVSIYFVLPLSSAISRCLRKIITYKPRRARWQ
                     QMTVRESDANELDTSPDSFDALEGLDPSFLKENAELVDAYKNIRWNSVQSLNALVGCI
                     EKTILKYKNPNDAIKRAMESIYRQLLQKYPLLFGYWKRFTAVQYQLYGLEKSIATLKE
                     ALESFPNSLELWCDYLNVLCVNSADKVELIRENFLMAKDKIGYHFLSHPFWDRYIEFE
                     TKHQEWNSLNSIYAELLCIPLHQYARYGTAYRKFLADHVEFTPHNNLDVEIRKTHGLV
                     TAVWPFESKIKQGFFNVTPVSDEELANWDRYLTYVEENEATKVFPTKFIESVFQRCLV
                     PCLYYEHFWIKYHNWLELAKNSDLLTLIDSYQRGISRLPRSSKQFRYRFLDFLKKNYR
                     KDKELILLSFTQTTAACIKLFPSETFLISEYLVLLKRSRFASSINQDEKEIHGQQILY
                     AKELESAVSSYLNGTVDKGKPLQDMINDVNLPTVVVELIKTTWLTLKNSMQTRKYFNF
                     YGKNRLFRSSTAFWLTYYKFEKSNQNFAKLNRFINDLGTEINLPVTIINDILRDYNSF
                     YLANSNAGMYQTVRSAEEDYNKLYSVDPILLSRFKRNDPLWVPGRSQNTSIADWYRTK
                     QFRENGHPGILSDKPQISNTIVESSTRSQGNRRPPLPSFKNLEKINQQPRYENSELPL
                     SC"
     gene            <781196..>782932
                     /locus_tag="HG536_0G04380"
                     /db_xref="GeneID:59327817"
     mRNA            <781196..>782932
                     /locus_tag="HG536_0G04380"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285354.1"
                     /db_xref="GeneID:59327817"
     CDS             781196..782932
                     /locus_tag="HG536_0G04380"
                     /inference="similar to AA sequence:RefSeq:NP_012587.3"
                     /note="ancestral locus Anc_1.494"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141250.1"
                     /db_xref="GeneID:59327817"
                     /translation="MSIRPSKFEEQPETSFEDMDTTFAKDLARNIQPKSRSSPVSRQA
                     PAAIPTPSVSTTSSEGTTFSRSGERYLGDNRTEEEEEDDDVDEEFLNDFQEFQNRKDD
                     FDDALRTFLTLRGRSSSSAGARQKDYGSDTNDLTAMFSKRLSIGRPTALRQPRSMMEL
                     KSRPASSGISPQMPNSLSAGDLRVQSNNTVRFKKSMPSLSNYNHTIDEEEEEEEEEDE
                     EDQERTLRRNGKKSLSNWRRHQKPYLNEFMEGDEEEEDADKDFIFDENLIQPQFLNKT
                     SEASPLKLSPSQYEIVRDDALLTPRLHKRHRDWNALEQLDSFKESAPIVSRRRPAKST
                     SARSRIKIIKQEIDHNTPIKNGRMYYNPKTMKWEGNEQVLDKFSKLDSIDKKPLLIKT
                     KSQTTNTTRQESFGKLSTAKPKASKRIRNPRIVGKMMFDDENLRWININGNDDEQDLF
                     AGIKDVKPAFSGSPVSSLKGTSHVSPFLRSHSQLLPSTGDEYISDRLNSTRYHSLGAT
                     NRDSSSDPVFQMSSKLLEKFCHEENRWNRKVGAWFLLGNKEVKSGEVTKEQNSNSYMF
                     EIRNMVINSTRA"
     gene            <783176..>784459
                     /locus_tag="HG536_0G04390"
                     /db_xref="GeneID:59327818"
     mRNA            <783176..>784459
                     /locus_tag="HG536_0G04390"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285355.1"
                     /db_xref="GeneID:59327818"
     CDS             783176..784459
                     /locus_tag="HG536_0G04390"
                     /inference="similar to AA sequence:RefSeq:NP_012588.1"
                     /note="ancestral locus Anc_1.495"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141251.1"
                     /db_xref="GeneID:59327818"
                     /translation="MKDDLEYSINAQTFDNVDPTLFRNFKIGALFNYVVLVWGLTLLK
                     IALFVSDIYTCIKLLAFNSWSNNIIQPYIPFRISKWLFSGCILASIALLVWETVCGIR
                     VYRTRNIALTYVNNFSRTAYSIKDYNTFCVLDKINPSGAYQKISFYTFFELKDCIRLL
                     LADTPRQVINGLTLWSVLVTVKPNARLGDLESFDGLISKIRTIAQTNHEEAVILSFML
                     FSFVIWAFFISKLVLALIFAVFVYYRLLNEQKYAGLRSFVCATISRNVDALVEERKKK
                     YNDLYNTSVVSLGTFDEFKGQSTNGSSAELLKQQTNFSRTSSQNDDLEAQKEKMGCDF
                     NETTMSLAATSMVDHTDEPTIMDSTAHILSTVSLVRETSPQSITKDHSFERNRICTPV
                     QARTRLPYPQRSDSLWERREKIANEDYGHYIHGNR"
     gene            784618..784716
                     /locus_tag="HG536_0Gtrna13R"
                     /db_xref="GeneID:59327883"
     tRNA            join(784618..784655,784680..784716)
                     /locus_tag="HG536_0Gtrna13R"
                     /product="tRNA-Arg"
                     /note="codon recognized: AGG"
                     /db_xref="GeneID:59327883"
     gene            complement(<784899..>786056)
                     /locus_tag="HG536_0G04400"
                     /db_xref="GeneID:59327819"
     mRNA            complement(<784899..>786056)
                     /locus_tag="HG536_0G04400"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285356.1"
                     /db_xref="GeneID:59327819"
     CDS             complement(784899..786056)
                     /locus_tag="HG536_0G04400"
                     /inference="similar to AA sequence:RefSeq:NP_013664.1"
                     /note="ancestral locus Anc_1.496"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141252.1"
                     /db_xref="GeneID:59327819"
                     /translation="MEIYVRLNNDVERDFAFQIDTNDTINTKIAKSFRQGGDGVSDFI
                     VLRPTIFHEKQPIGYYKSLHPGYLTEGGCLIFDYDADLQEYKQRLDPDKKLIDQLWPG
                     QLILPEWKKSTKNIVTYVIFMLIWLYTDLPDVISPTPGICLTNQLSRIAIPIFEHFGK
                     HSIADKLREEIQVNFSGVIAQWGFFVIHILKIAFITMFFTTGMVNPISFNPAVLYKIR
                     NLQLTGPKIKNLLRSLGWVGAKRGTYDEYQSNFYEYIIKKYGDPGKAFKAGMIRVAAA
                     PGLRLGDGEGFQTPLDQRFSGYTFKTIKEEGKFVLSEEYYLQLENDLKKNLESCQGDI
                     GQMNNEIRRFRRFGLYEPGEELKEMVRLRKEVKAREEAEKAKKAEESKKEK"
     gene            <786512..>790384
                     /locus_tag="HG536_0G04410"
                     /db_xref="GeneID:59327820"
     mRNA            <786512..>790384
                     /locus_tag="HG536_0G04410"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285357.1"
                     /db_xref="GeneID:59327820"
     CDS             786512..790384
                     /locus_tag="HG536_0G04410"
                     /inference="similar to AA sequence:RefSeq:NP_013663.1"
                     /note="ancestral locus Anc_1.497"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141253.1"
                     /db_xref="GeneID:59327820"
                     /translation="MLVQESELYLYHLTLKRQSNYVHSCIGHFVEEKSSDKTKRPKDL
                     QLCIATETHIELYDVADGALLKLAEVPIFATITAMESFRVENVRESFLAMVSDSGNLT
                     IAKFNRRSNVDISLETLINHPMTRSQIRRTSPASFLKVDTFGRCILVSAVEKNKLCFV
                     VNEGGDGSVMIQSPLEVIRPEVLTLDLVSCDVQYDNPCFASIEIDTLQNKNDHHLVFY
                     VLDLGLNFVVKKADYTINGEANFLMGLPVLSKYNINCANEKDAHDEINPFVLIGFQDY
                     LLVKDMSGLFSLKVQIPKRAEESSQKVSIISSAIQMLKNSFFILLQSNLGDLYRLTIE
                     ANEEDRNRPVVSISYFDTIFQAEKLHIFRNGYLYANSELNDNYLFQFDSLGDDNTEIL
                     SSRDPKEQLFFKPSKTLKNISIVSHRKNLNPLLTTQVLKAHPLMIAAGTTSKSRLLSN
                     GVNFEEQISSPLPPGAQDLWTIKPSGQSFHKLLFLGFSKSTMVLKIDEGSIEELSIPQ
                     NPFKLNGDRTVLVATLGYRSTIQVCENELRQVVPSGDEMNQFSLKLEWFPPAGIRIVT
                     ATSSETQLCLGLSNNELVYFEISEQTDALHESQNRIEIEEPISIVAMSASRRSDFLAV
                     GTKDSTVEIVSLKMSDTEEFMEVVSIQTLLAPVNSLRVIENKDLELHIGLQNGVYYRS
                     KINRHDGQIYDVRTKFIGPKPIVLSSLKSTSLSLTSDKEDDEEENAEGNEDSTDDKCH
                     CVVLHCTKTWISYTKNKLLNIRPVLFSRLSGLSTLCEFVAEETSINVCCAISSSGSLV
                     IGRLTDFVCRQKWFQVTDTPLERILGKEADKESDSTKGGDEVEGDEEDENEEEEEEES
                     LTLQWHTYDRTKFLAFPEDRGLFLQLESSSTQNGARISISKNQQRYQSAQGCEIFKTL
                     PNINVLAASLVKFASNVDHLVISSRDGVLHTFEISLDKGKCQFNLRAIHETVIEGQVR
                     AMIPFADKLLVPAFGSLILFGLGKKQLLKQSISETTLSMTKVTALANWRNERIAVGDG
                     HESVTLFVFDKTKKSFVPIADDTIKRHTISLAFLDPSTILGGDRFGNIWTLRLSKEYE
                     GMISTSLPPVVERMQQLPSLKRKAPNIMECPFKLTQTNMFYINDIAMDFHVLQSVQMS
                     DRPAIIYSGLQGTIGCLTPLLSKAEITKLKTIETVMSEADDKFYMKHEIERRGNEAPT
                     AVEDAEIGALRASHNGIPEGSNSIVGREQSRYRGYYAPVRNVIDGDLCERFLDLLPAE
                     QSFLCAELKTLQPDAVVRSLNDIRTNYM"
     gene            complement(<790414..>791418)
                     /locus_tag="HG536_0G04420"
                     /db_xref="GeneID:59327821"
     mRNA            complement(<790414..>791418)
                     /locus_tag="HG536_0G04420"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285358.1"
                     /db_xref="GeneID:59327821"
     CDS             complement(790414..791418)
                     /locus_tag="HG536_0G04420"
                     /inference="similar to AA sequence:RefSeq:NP_013662.1"
                     /note="ancestral locus Anc_1.498"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141254.1"
                     /db_xref="GeneID:59327821"
                     /translation="MSVNKLQQGMFRRYGFAIWSKACYHRQYRFVDGVLAPNANFRSQ
                     CECYYEDMNASLPQDKQLDSSIELPKQVPLYQKHLLVISPQDRNPERLEWKTAWQSRL
                     ELNNQWPYSVISKLKEHLKDSQSGSGILVNAVAMVSGDIKPLETNSDRIAHIFVLPDS
                     KLYAIHERQIEDFAHFIGGGRVNQSVDHKPSFNDYLRGADNVQILPEAGSLRGSDPHE
                     DLFDYKTSRKDWILVCGHYQRDQRCGLIGQDLIKVIEDRGLGRNKNVGLISHIGGHKY
                     AGNVILYNSYPSKDKLGKYLLNCLWFGKVVPPNVLLLFEHLENGMIPKELYRGGMSMD
                     "
     gene            <791511..>791957
                     /locus_tag="HG536_0G04430"
                     /db_xref="GeneID:59327822"
     mRNA            <791511..>791957
                     /locus_tag="HG536_0G04430"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285359.1"
                     /db_xref="GeneID:59327822"
     CDS             791511..791957
                     /locus_tag="HG536_0G04430"
                     /inference="similar to AA sequence:RefSeq:NP_012589.1"
                     /note="ancestral locus Anc_1.499"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141255.1"
                     /db_xref="GeneID:59327822"
                     /translation="MNSGPCGICQEKPAKYRCPKCSVKYCSLACYKDTERHKDDEPKA
                     TEPTVDATCKDVTKAEDGDSLQLTPELKELLRYNTVKFHLGKVYRILKTDIGDTNDPS
                     FAMTSDMKRQLAIDYLNTLRYGGIHHNEAIEEFCEHSLKLVNGQQD"
     gene            complement(<792168..>793079)
                     /locus_tag="HG536_0G04440"
                     /db_xref="GeneID:59327823"
     mRNA            complement(<792168..>793079)
                     /locus_tag="HG536_0G04440"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285360.1"
                     /db_xref="GeneID:59327823"
     CDS             complement(792168..793079)
                     /locus_tag="HG536_0G04440"
                     /inference="similar to AA sequence:RefSeq:NP_013660.1"
                     /note="ancestral locus Anc_1.501"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141256.1"
                     /db_xref="GeneID:59327823"
                     /translation="MSALFRSLFRLISLLFYAGNTLLLILIIISGGTNTNPINNFYWV
                     QADTSGIPNAPSLTRWTFWGACSTQNGSTNCGDHLSPAYPISPVDNFGTKTNVPNKFI
                     TDRDAFYYLTRFSFCFFWIALAFIGVSFLLYVGTWCSYGFSKVVWILTSVGALFNVTA
                     VVLQTAASVMARNAFSDADRAASLGSDLFGIAWASVVLSLLESAASFYEYFRRFKSNL
                     IRTHQKEMEAAESHPLGTKSWFYSSKGDQPAEDPAVTIADPYAQSNANVTSAAAAGTV
                     SQDNQHKGINFFTIRKTQKVTHDDDSV"
     gene            complement(<793467..>794135)
                     /locus_tag="HG536_0G04450"
                     /db_xref="GeneID:59327824"
     mRNA            complement(<793467..>794135)
                     /locus_tag="HG536_0G04450"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285361.1"
                     /db_xref="GeneID:59327824"
     CDS             complement(793467..794135)
                     /locus_tag="HG536_0G04450"
                     /inference="similar to AA sequence:RefSeq:NP_012590.3"
                     /note="ancestral locus Anc_1.502"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141257.1"
                     /db_xref="GeneID:59327824"
                     /translation="MEKLNSLHSSLPPERSPTDQAIESLNGELSQEFKIAANAVTKLY
                     RVANERNSLLKHRGYLQCVENLLAMLEQEPGLSAEDIHLWCIKQRNEILSHQSAGGNA
                     EQGKSTGAKYNFDFANPGGSCGDGGATSKVPTFRLSTPPLSVEYSKPEKTMWSVQKQQ
                     TWKGVPCNHQEKTGNDVTAGEMDQTGPEGSREDQPPAHVKKQKVISTVVTPCRRKAKT
                     DRRD"
     gene            <794431..>794928
                     /locus_tag="HG536_0G04460"
                     /db_xref="GeneID:59327825"
     mRNA            <794431..>794928
                     /locus_tag="HG536_0G04460"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285362.1"
                     /db_xref="GeneID:59327825"
     CDS             794431..794928
                     /locus_tag="HG536_0G04460"
                     /inference="similar to AA sequence:RefSeq:NP_013659.1"
                     /note="ancestral locus Anc_1.503"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141258.1"
                     /db_xref="GeneID:59327825"
                     /translation="MLRDYGNASVSSSVAGGAAKRSGRNCDLERLGRPQAKRLKTEAA
                     AGRCRTLAAEQSSVSNAAGVELLTPAATPAYAGVAETISSPYSETEEYMLRGYYEDDL
                     VDSRASIESVQYNLYDMTPEELEGASEGNTHDNDHQIGYTAWSGAPAAATNATVYEDS
                     YDIDM"
     gene            complement(795039..795124)
                     /locus_tag="HG536_0Gtrna6Y"
                     /db_xref="GeneID:59327895"
     tRNA            complement(join(795039..795075,795085..795124))
                     /locus_tag="HG536_0Gtrna6Y"
                     /product="tRNA-Tyr"
                     /note="codon recognized: UAC"
                     /db_xref="GeneID:59327895"
     gene            <795366..>796022
                     /locus_tag="HG536_0G04470"
                     /db_xref="GeneID:59327826"
     mRNA            <795366..>796022
                     /locus_tag="HG536_0G04470"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285363.1"
                     /db_xref="GeneID:59327826"
     CDS             795366..796022
                     /locus_tag="HG536_0G04470"
                     /inference="similar to AA sequence:RefSeq:NP_012591.1"
                     /note="ancestral locus Anc_1.504"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141259.1"
                     /db_xref="GeneID:59327826"
                     /translation="MNRGRLVLFEGLDRTGKTTQSNILLERLKPNATLIKFPERSTEI
                     GAVIDRYLKDKTFELPDQAVHLLFSANRWEMAERIKQLLLQGTHVVLDRYVYSGVAYS
                     AAKHTDRMDRTWCLQPDRGLPRPDLTIFLTSDDAENELRAGFGEERYEKSEFQQEVKR
                     QFVEVFKALEDSSHEEKLVHVVNVTGKSVEEVAKVVWDLVEPVVTLPTDSTYSELLYF
                     "
     gene            complement(<796037..>796480)
                     /locus_tag="HG536_0G04480"
                     /db_xref="GeneID:59327827"
     mRNA            complement(<796037..>796480)
                     /locus_tag="HG536_0G04480"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285364.1"
                     /db_xref="GeneID:59327827"
     CDS             complement(796037..796480)
                     /locus_tag="HG536_0G04480"
                     /inference="similar to AA sequence:RefSeq:NP_012592.1"
                     /note="ancestral locus Anc_1.505"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141260.1"
                     /db_xref="GeneID:59327827"
                     /translation="MAIQFILCFNKQGVVRLVRYFERYQMDSQKTQDMIVQIYRLISS
                     RDHRHQSNFVELSESTKLVYKRYAGLYFVMGIDLQDEESIYLSQIHLFVEVLDAFYGN
                     VCELDIVFHFYRAYMVMDEMFLGGEIQEISKDLLLERFSILDRLD"
     gene            <796645..>799785
                     /locus_tag="HG536_0G04490"
                     /db_xref="GeneID:59327828"
     mRNA            <796645..>799785
                     /locus_tag="HG536_0G04490"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285365.1"
                     /db_xref="GeneID:59327828"
     CDS             796645..799785
                     /locus_tag="HG536_0G04490"
                     /inference="similar to AA sequence:RefSeq:NP_012724.1"
                     /note="ancestral locus Anc_1.506"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141261.1"
                     /db_xref="GeneID:59327828"
                     /translation="MTSDSDNQLRFRSLHIRTSNEIKGNFIRLPSHIVQTLENTGVII
                     QEFGISILQNGKNVLHVGWDGYESQSYMSGQATVEINPVLAQSVGIPIGSAIDITVGR
                     YGSSRMAEEVYVEPETSDDWEIIETHSQFFQEEMLHQTRIVAIDETLFCYVDNVTCRF
                     KIKKIIPESLRSARINNGSLIAVAPRVAASRVQKAPAHSRTLSTTTSVDQLNRPDVAI
                     KRSMYNFTGMNDQNMRISVNSSEIKSQFSFVSILQNALDIKHQGKYGKQETNLKITRK
                     IAVAVEGRDDIPKGHVAMTPIVWDALWFQAQNGYKVVIEFLKEEKSDTAASQIMVVLR
                     PFAKSDKAKPIARTNKQKESRASQEEKTMPQAVLDIIQKFKDGPLTDKMALQKEQLFL
                     EIVDENTGRHIPYVRCVKPKDLKWSFRAAHEANVSILSVPHQHGGLDITRIDDFLPNE
                     VTKQIMEHLLMPVTASSAVVLTAGTGMGKTTVLKELALELSNHARYVNYTDCNTLSDI
                     ENLGKMKQFIQELCSQCYWHRPSIILLDNAETLFPSNKTDDPQQQALQQSGGITAAKL
                     ALYFINLVESISKKSSEAIRVVLTAPDKSQLNNLLYNKHFICQSFKKSSPSVDERGKM
                     IQFFIKNLDDKLQLSNQVQYRDIALETDCYSPLDLRILVDKLFHQSITKMDPKGGSIV
                     LDKETYMDTLRTFSPTSLRGVKLTRSTGVNWNNIGALKGPKRVLLETLEWPTKYAPIF
                     QNCPLQLRSGILLYGFPGCGKTMLASAVAQQCGLNFITVNGPEILNKYIGASEQNVRE
                     LFERAQSVKPCILFFDEFDSIAPKRGHDSTGVTDRIVNQLLTQMDGVEGRDGVYVLAA
                     TSRPDLIDSALLRPGRIDKSVLCNIPDHNDRLDILQMITSSGQMTLKPGTDLGPIASQ
                     TAGYSGADLHGLCYNAYLKSVHRELQSQDTVQDSKSKMSQVEYSVINAKNDDILPNLS
                     DEKQDQRSKTSRTAKNIAISLQDLIEACQETKPSISTSEYKKLHAVYVKFQSDREGDM
                     IGNESSSEVGTRTSLM"
     gene            <800231..>802327
                     /locus_tag="HG536_0G04500"
                     /db_xref="GeneID:59327829"
     mRNA            <800231..>802327
                     /locus_tag="HG536_0G04500"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285366.1"
                     /db_xref="GeneID:59327829"
     CDS             800231..802327
                     /locus_tag="HG536_0G04500"
                     /inference="similar to AA sequence:RefSeq:NP_012593.3"
                     /note="ancestral locus Anc_1.507"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141262.1"
                     /db_xref="GeneID:59327829"
                     /translation="MTNQPGHQQNPHRTGSLLSFKKLGKKLLTGKGHVEDSEAENVGK
                     KPNTHHLSGSRPKSSSPSGHLRSSLPFHRNKSTANVNSGHAVLASPRSSASISNMVAH
                     SHNPFTALHASDVLGTGTGIASPRGNGTHHSIHRKGSNNFPNHLLSNENIIYNPYGLN
                     SPKNMGPGGSRPGTANASSENVDFSFYLHDGNTKIRMLPLPIADPNDYLPEEMKQVSI
                     HLSDNFVFDSENKALGSGGSSEVRKVRSAYRQKDVYALKKLNMIYDETAEKFYKRCSK
                     EFIIAKHLSRSIHITNTYYLVKVPTTTYTTRGWGFIMEICVKDLFQLMERSGWRSVPL
                     AEKFCLFKQVAQGVKFCHDNGIAHRDLKPENVLMSRDGVCKLTDFGISDWYHVEPHNF
                     DSPVKECEGMIGSPPYTPPEVMVYDSKKHYPESAQKPYNPLKMDSYALGMILIALVNN
                     TLPFFESCNTDARFREYELSYDNYMNHQNPHFRDKGYYKPGPGAEYTLARNFKSTDAS
                     RVAWRLADPNPDTRYTIQDLYADPWFQSLETCVDPCDDHLFKAPEIRKTSSDSGSGFY
                     ISEQPSKEELDQPADPTLQHTSNPFSAAKPKPRSMVDIAQSPAIPKPDVAAKVPSRVA
                     EDSDENDSHHDADPPRRELQNLSLDNTGSSAASLRSQTSGASHPRPKTKRKRLIHNHM
                     DAPTTLNSSSSTRSFS"
     gene            <802568..>803458
                     /locus_tag="HG536_0G04510"
                     /db_xref="GeneID:59327830"
     mRNA            <802568..>803458
                     /locus_tag="HG536_0G04510"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285367.1"
                     /db_xref="GeneID:59327830"
     CDS             802568..803458
                     /locus_tag="HG536_0G04510"
                     /inference="similar to AA sequence:RefSeq:NP_012594.1"
                     /note="ancestral locus Anc_1.508"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141263.1"
                     /db_xref="GeneID:59327830"
                     /translation="METSSSSRVMGSGVGKRRHGDVEAAEELKRQKQDEGNIDAALLN
                     EVGDEEPEEQHRGPEEHDSHYDATAVAVASAAYSDLMQHPGEEKHRRALKSRRGDEDE
                     EFEEEEEEEEELDDQIKDPDHIPEPESERKALLAGDEEDEDEEEGKKLFGAAAAGRRG
                     RKLAPMTGSEEWKRQRKDSHKEVERRRRENINTAINKLSELLPVKESSKAAILARAAE
                     YIQKLKETESANIDKWTLQKLLSEQNQSRLTSANERLQDELGKAYKEIEQLKHALKQA
                     GLSYDLHQDHQKQPQDALDN"
     gene            <803672..>806350
                     /locus_tag="HG536_0G04520"
                     /db_xref="GeneID:59327831"
     mRNA            <803672..>806350
                     /locus_tag="HG536_0G04520"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285368.1"
                     /db_xref="GeneID:59327831"
     CDS             803672..806350
                     /locus_tag="HG536_0G04520"
                     /inference="similar to AA sequence:RefSeq:NP_012721.1"
                     /note="ancestral locus Anc_1.509"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141264.1"
                     /db_xref="GeneID:59327831"
                     /translation="MSLFKLGTRRLSRSSLRKFGRLLVVAAVALVVYRHVAGGAGGRD
                     PQLAHPALMEALETYRRYRFETESSWIDSYSLQRNLLQVRKGPHRGSKVGSIEELSFY
                     DSDPRLAWTVYLDYFMRPDLLSNEEIEFSWYDWADFGDWNKLVSLENTPLNCSVVFGK
                     HFDVDFLHEAEAEVGDVLFLSERACYDDERWYRKQQLLRNRPDGPPSDLAGLCEPRSR
                     GRFQLPFEVAQLHDGVRPEVFTLQARSHLLSHVAQPLSLVVLERDIGCYRLGVGQRGR
                     GNLVQSGLLARYLEEHESEMDARGDIEFDHLAAYERFLNSSVSAGLRVEIPGLDREIA
                     EQETVLLSPDDFEVDVREIIEELRRSKAENLLSTHESRYLESLEHSITVSPWLAKKYF
                     PEAERIKGLIGMGSHRDLRFFKEALIWDPEEYNARLNSLIRNWLKFTRANGLITWIAH
                     GSAYGHLYNGQRFPWDNDYDVQMPIKHLHLLSRYFNQSLILEDPREGNGKFLLDVGDS
                     ITVRTPGNGRNRIDARFIDIDSGLYVDITGLSVSSSPIHSNFKSFYDARAPSVDLKSM
                     QKGFELPERGQELNALDVNQLADYVASHRQLFQNDQIKDVNNGKRAEKQIQTMETILQ
                     HGLTPEERYIMNRELKIYNCRNNHFMTLDLLSPLQRSLFHGAPAFFPKQNLVVLRNEY
                     NVPAMYGFHVFEGKAFLPALHSWFTYSVLQDFTKINNKYPDLEKLKGTVSDVQIEDTD
                     IIFKNMLQLGLVELFAIHYTSFDVTAYRVKELEIQYDETIDRSERGRLLHALWTQVSP
                     KVSSPAKDPVIFSYERNLWREMVALLGKQKSQEIQTAVEQAVLQQLSLKAQQMHRREL
                     PLFKIHNPSDELTDDLNTSVKPIPNANVIFKEEPDI"
     gene            complement(<806473..>807735)
                     /locus_tag="HG536_0G04530"
                     /db_xref="GeneID:59327832"
     mRNA            complement(<806473..>807735)
                     /locus_tag="HG536_0G04530"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285369.1"
                     /db_xref="GeneID:59327832"
     CDS             complement(806473..807735)
                     /locus_tag="HG536_0G04530"
                     /inference="similar to AA sequence:RefSeq:NP_012596.3"
                     /note="ancestral locus Anc_1.510"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141265.1"
                     /db_xref="GeneID:59327832"
                     /translation="MLSMSNSARTLSVSLRIAIVQLNPQIGQVKQNIERAWELVHKLK
                     DSISKERAPDLVLFPELALTGYNFLSREHILPYTSAKNDGPSIDLAKEVSRLFKCYTV
                     IGYPERVDQGPEPILYNSAAVTDPTGKQIFNYRKSFLYYTDDDWGCQENPLGFQSFPL
                     HFKNRARNVSEDSSELEDVTLRTSIGICMDLSPYKFEAPFYDFEFATYNVDQRNELII
                     CPMAWLHSASVTKNSGPATAASVKLEAIQKAIKKEGIPACGSQGNYQLSFNNSDVTPR
                     IARESVSPDDNYEELDKPDMSNVNYWILRFMPFLALRQRASWPARSLEPLVAGSRKRR
                     SYMGASLTSQWEFRNRNAIVLMGNRCGIEDANTVYAGSSGIYKFNGKFADAATDIDSL
                     NESVELLGNLGKGLEGVLLRDVTFEVTR"
     gene            <807888..>808235
                     /locus_tag="HG536_0G04540"
                     /db_xref="GeneID:59327833"
     mRNA            <807888..>808235
                     /locus_tag="HG536_0G04540"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285370.1"
                     /db_xref="GeneID:59327833"
     CDS             807888..808235
                     /locus_tag="HG536_0G04540"
                     /note="ancestral locus Anc_1.511"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141266.1"
                     /db_xref="GeneID:59327833"
                     /translation="MSDKNSSIFAPGHNRLETAIPETSYKATRVDPRELSVTPRPTEP
                     AANPIPTPTHTLQADEPPSDRLEPAPITAVFDAKNQLASLIKNAKLNEEAIRARNDRI
                     RHSKQQSKGRYGW"
     gene            <808373..>808750
                     /locus_tag="HG536_0G04550"
                     /db_xref="GeneID:59327834"
     mRNA            <808373..>808750
                     /locus_tag="HG536_0G04550"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285371.1"
                     /db_xref="GeneID:59327834"
     CDS             808373..808750
                     /locus_tag="HG536_0G04550"
                     /inference="similar to AA sequence:RefSeq:NP_012597.1"
                     /note="ancestral locus Anc_1.512"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141267.1"
                     /db_xref="GeneID:59327834"
                     /translation="MSVVGSLIFCLDCGNLLNNPNTVAGSEIECDMCQASYPKSQFSK
                     LKVVTATSDDAFPSALRSKRSVVKTSLKKDELEAGATIKEKCPKCGNEEMHYHTLQLR
                     SADEGATVFYTCTACGYKFRTNN"
     gene            <808957..>810639
                     /locus_tag="HG536_0G04560"
                     /db_xref="GeneID:59327835"
     mRNA            <808957..>810639
                     /locus_tag="HG536_0G04560"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285372.1"
                     /db_xref="GeneID:59327835"
     CDS             808957..810639
                     /locus_tag="HG536_0G04560"
                     /inference="similar to AA sequence:RefSeq:NP_012598.1"
                     /note="ancestral locus Anc_1.513"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141268.1"
                     /db_xref="GeneID:59327835"
                     /translation="MAQVPGQAMEMPDMSNAIVAQDEMGRPFIIVRDQGNKKRQHGLE
                     AKKSHILAARSVASIIKTSLGPRGLDKILISPDGEITITNDGATILSQMELDNEIAKL
                     LVQLSKSQDDEIGDGTTGVVVLASALLDQALELIEKGIHPIKIANGFDEAAKVAIQKL
                     EEQADDVASDSASFKEYLFRAAKTSLGSKIVSKDHDKFAQMAVDAVLRVLDEERKDVD
                     FELIKLEGRVGGSLKDSKLIDGVILDKDFSHPQMPKEVVPAEGQNDLRLAILTCPFEP
                     PKPKTKHKLDISSVEEYQKLQNYEQDKFKEMIDNIKRVGADVVICQWGFDDEANHLLL
                     QNNLPAVRWVGGQELELIAIATHGRIVPRFQDLSTEKLGKCGRIYEMEFGTTKDRMLV
                     IEQCSDAKTVTCFIRGSNKMIVDEAKRALHDALCVVRNLVKDSRVVYGGGAAEVAMSI
                     AVSEEADRQRGIDQYAFRAFAQALDTVPMTLAENSGLDPIDTLTLLKSKQIKENSSLV
                     GVDCLSKGSNDMKELFVVDPFIGKKQQIMLATQLCRMILKIDNVIISGKDEY"
     gene            complement(<810761..>812143)
                     /locus_tag="HG536_0G04570"
                     /db_xref="GeneID:59327836"
     mRNA            complement(<810761..>812143)
                     /locus_tag="HG536_0G04570"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285373.1"
                     /db_xref="GeneID:59327836"
     CDS             complement(810761..812143)
                     /locus_tag="HG536_0G04570"
                     /inference="similar to AA sequence:RefSeq:NP_012599.3"
                     /note="ancestral locus Anc_1.514"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141269.1"
                     /db_xref="GeneID:59327836"
                     /translation="MSFMNNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSST
                     KKSTSSALSGASGLSNTGNASSSGNPYFGNATSATAFNNLNAGSLLMSNNLAGKRGTE
                     DLDFYIGNEALIAAQGPSYGLSYPIKHGQVENWDHMERFWENSIFKYLRTEPEDHYFL
                     LTEPPLNPPENREQIAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVID
                     SGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEEDTSLRTAERIKQE
                     YCYVCPDIVKEFNKFDRDPEKFAQFVVENQEKTRRKVVDVGCERFMAPEIFFNPEIAS
                     SDFLTPLPTIVDQTIQACPIDVRKSLYSNIVLSGGSTMFKDFGRRLQRDLKSIVNNRI
                     AQSEYLSGTKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCHTKKDYEEIGPEI
                     VRNFSLFNMV"
     gene            complement(<813732..>814229)
                     /locus_tag="HG536_0G04580"
                     /db_xref="GeneID:59327837"
     mRNA            complement(<813732..>814229)
                     /locus_tag="HG536_0G04580"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285374.1"
                     /db_xref="GeneID:59327837"
     CDS             complement(813732..814229)
                     /locus_tag="HG536_0G04580"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141270.1"
                     /db_xref="GeneID:59327837"
                     /translation="MGEREARAISILERLQSVELSQREGAIDDLLSKWSEVFMEDLVS
                     EARFWREVRKYGALAIKYETLIREELDISPSEDYTSPSALSPSGLDYNYPFLVERKTT
                     KGERVLFPSFSIFVKANPELTEKERNQALGLVSRLEQAIINAGDFSQMPRTTSQDKEY
                     DSLDI"
     gene            <814833..>822221
                     /locus_tag="HG536_0G04590"
                     /db_xref="GeneID:59327838"
     mRNA            <814833..>822221
                     /locus_tag="HG536_0G04590"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285375.1"
                     /db_xref="GeneID:59327838"
     CDS             814833..822221
                     /locus_tag="HG536_0G04590"
                     /inference="similar to AA sequence:RefSeq:NP_012600.1"
                     /note="ancestral locus Anc_1.515"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141271.1"
                     /db_xref="GeneID:59327838"
                     /translation="MLSLRRKLESHHQSKLTSKSHLSSSDDISSVSGQDGTNIVTSDG
                     SRLTAHNEGDAKGYVETDPTIAAMDSTFTTFNLIFDKLGSSVAQERIAASFELKSSLI
                     SLVREVSIEQFQRFSNRINNKIFELIHGASSNEKIGGILAVDTMIGFYAHTEELPNQT
                     SRLANYLRVLIPSNDIEVMRLAANTLGKLAVPGGTLTSDFVEFEAKTCVEWLTTSPEN
                     ASSSSKQEYRKHASLLIITALANNSPYLLYPYVNSILDNIWRALRDTNLTIRMDAAIT
                     AGKCLSIIQDRDTSLTKQWVQRLFKECVYGLTLNTNESIHATLLIYRELLRLNAFYLN
                     GKYDEIFQSTMRYKDHKYDVIRKEVYAILPLLAYFDSSLFTAKYLEQTMVHYLTVLRN
                     MNVNSANALDKTAIFISIGDIAIEVGSSIMPYMDPILDNIRNELQTKFKNRKFFEREV
                     FYCIGKLAAAVGPALTKNLNKGLLDLMLSCPLSDYMQQTLLIINEKIPALEPTINARM
                     LDLLCTSLSGEKYKLPGSPTSLKPLSIEKARHWRNQNILRQTGEPNDDAHDAQILTQA
                     LRMLQTINDKYSMTEFVRLVVISYIEHDNPHVRKLAALTSCALFVKDNICKQTSLHAL
                     NCVSEVLSKLLTVAITDPVAEIRFEILQHLDPSFDPQLAQPDNMRLLFMALNDEIFAI
                     QLESIKIIGRLTSVNPAYVVPSLRKTLLELLTKLKYSTMPRKKEESATLLCSLISSSR
                     EVTKPYIEPILDVLLPKSQDSSSAVASTALKAIGELSVIGGEDMKSYLNELMPLIIST
                     FQDQSNSFKRDAALKTLGQLAASSGYVIEPLLDYPELLGVLINILKSESAQNIRRETV
                     RLIGILGALDPYKHREVEVTSNANSTVEQNAPSIDIALLMQGMSPSNEEYYPTVVINT
                     LMRILKDPSLSSHHTAVIQAIMHIFQTMGLRCVPFLAQIIPGFILVMHSCPPSLLEFY
                     FQQLGLLVSIVKHHIRPHVDEMYEVIEEFFLIPKLQITILLVIESISKSLEGEFKRFV
                     PRTLTTFLTILENDKSSKKAVSIRILRSLVVFDSSLEDYAHLIIPTVVKIAEYSTGTL
                     RTMAIVTLGKLAKCINLSEMSSRIVQALVRILYLEDKELIKVTMNTLSLLLLQLGTDF
                     TVFVPIINKTLVRNHIQHSIYDQLVNKLLNGEGLPKNIVFDKEFDTHTKEVGEAASSS
                     KKLPVNQLVLKNTWDCSQQRTKEDWQEWIRRLSVQLLKESPSHALRACSGLAGIYFPL
                     ARELFNASFASCWTELYTQYQEDLVQSLCSALSSLQNPPEIHQTLLNLVEFMEHDNKP
                     LPIPIQTLGQYAQRCHAYAKALHYKEVEFIQEPTTSTIESLISINNQLHQTDAAIGIL
                     KHAQQHHDLQLKETWYEKLQRWEDALNAYDQREKAGEDSFEVTMGKMRSLHALGEWEK
                     LSELASEKWSVSKPEARIAMAPLAAGAAWGLGQWDEIEKYIGVMKSQSPDKEFFDAIL
                     CLHRNNFGEAEKHIFNARDLLVTEISALINESYNRAYSVVVRTQIIAELEEIIKYKKL
                     PQNSERRQLMRNTWNKRLLGCQKNVDVWQRVLRVRSLVVKPKQDMQVWIKFANLCRKS
                     GRMGLAQKALNSLLEESGDPDHPNTARAPPPVVYAQLKYLWATGSQKDALRHLIGFTS
                     RMAHDLGLDPSNMIAQSVPRNSSIAPRHVEDHTRLLARCFLKQGEWRVSLQPNWRTEN
                     PDAILGSYLLATHFDDKWYKAWHNWALANFEVISMITSGSKQEMNGVNKKSGNGVYRI
                     ENGMMGSDSFNGDPGNYSAELIQRHVVPAIKGFFYSISLSESSFLQDALRLLTLWFTF
                     GGVPEAAQAMHEGFSLIKIGSWLEVLPQLIARIHQPDKVVSRSLLSLLSDFGKAHPQA
                     LVYPLTVAIKSESVSRQKAALSIIEKMRMHSPVLVDQAELVSHELIRAAVLWHELWYE
                     GLEDASRQFFGEHNTEKMFAILEPLHEMLKRGPETLREISFQNSFGRDLNDAYEWVTN
                     YKKRKDLSNLNQAWDIYYNVFRRISRQLPQLQTLELQHVSPKLLAAHDLELAVPGTYI
                     TGKPIIRITRFEPVFSVISSKQRPRKVTIKGSDGKDYQYLLKGHEDIRQDSLVMQLFG
                     LVNTLLQNDSECFQRHLDIQQYPAIPLSPKSGLLGWVPNSDTFHVLIREHREAKKIPL
                     NIEHWVMLQMAPDYDSLTLLQKVEVFTYALDNTRGQDLYKVLWLKSRSSESWLERRTT
                     YTRSLAVMSMVGYILGLGDRHPSNLMLDRITGKVIHIDFGDCFEAAILREKFPEKVPF
                     RLTRMLTYAMEVSGIEGSFRITCENVMRVLRDNKESLMAILEAFAFDPLIHWGFDLPT
                     QTIMEQTDIQLPLTNPSELLRKGAITVEEAAKMEVEQKNEIRNARAMLVLKRITNKLT
                     GNDFRRFTELDVPEQVDKLIQQATSVENLCQHYIGWCPFW"
     gene            complement(<822248..>822682)
                     /locus_tag="HG536_0G04600"
                     /db_xref="GeneID:59327839"
     mRNA            complement(<822248..>822682)
                     /locus_tag="HG536_0G04600"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285376.1"
                     /db_xref="GeneID:59327839"
     CDS             complement(822248..822682)
                     /locus_tag="HG536_0G04600"
                     /inference="similar to AA sequence:RefSeq:NP_012601.1"
                     /note="ancestral locus Anc_1.516"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141272.1"
                     /db_xref="GeneID:59327839"
                     /translation="MASNSILDDVWESDSDSQRNQISYDLKKLRENHVKSGFLDGITH
                     AKETNLQEGFDEGFPSGALLGKRVGMLVGLLQCLAQRYGDQDESLAQDFNAIQKELRI
                     NKVLTKGIFDQDLNLTGEHPLLAKWKPIVRSHCDKYSVHTSF"
     gene            <822833..>823897
                     /locus_tag="HG536_0G04610"
                     /db_xref="GeneID:59327840"
     mRNA            <822833..>823897
                     /locus_tag="HG536_0G04610"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285377.1"
                     /db_xref="GeneID:59327840"
     CDS             822833..823897
                     /locus_tag="HG536_0G04610"
                     /inference="similar to AA sequence:RefSeq:NP_012602.3"
                     /note="ancestral locus Anc_1.517"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141273.1"
                     /db_xref="GeneID:59327840"
                     /translation="MLEAFGPNKRRKVIAEEEGEHSKPWVEKYRPKKLDEVTAQDHAV
                     NVLKKTLGSTNLPHMLFYGPPGTGKTSTILALTKELFGPELMKTRVLELNASDERGIS
                     VVREKVKNFARLTVSKPTAEDRKNYPCPPYKIIILDEADSMTADAQSALRRTMETYSA
                     VTRFCLICNYVTRIIDPLASRCSKFRFKSLDTGSALDRLTFIAQKESVGYEDGVLEDI
                     LKISRGDLRRAITLLQSAYKRNDLQGSKKITFSEIQEISGLVPNSLITELATKIAGND
                     VDDIAAYVNDFMKKGWAVTSVADQLHSYYLTSDDFSTDFKNKVSWILFNTDAKLTNGT
                     NEHIQLLNLVVQISEVQKTS"
     gene            complement(<824010..>825791)
                     /locus_tag="HG536_0G04620"
                     /db_xref="GeneID:59327841"
     mRNA            complement(<824010..>825791)
                     /locus_tag="HG536_0G04620"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285378.1"
                     /db_xref="GeneID:59327841"
     CDS             complement(824010..825791)
                     /locus_tag="HG536_0G04620"
                     /inference="similar to AA sequence:RefSeq:NP_012718.1"
                     /note="ancestral locus Anc_1.518"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141274.1"
                     /db_xref="GeneID:59327841"
                     /translation="MNTDSLTRNTLNDPMVLSVEQSNEALPPLSSAKADSITNFFERL
                     NQSMKSVDLGGTPQVRDNNAPQLPQYTADYKPKDCINKKHVYSINELLSISKQIPEGA
                     CEEIVNSLPKKKFWRLNRRYSDHGNHSKGLGHRNGRNAGVNSRPISNEEGVFERRNSK
                     SKATRPKRGNKHGKNDKNGFLLEEKDIAVNNEDLLALEGEFEPTGNSMADFETWKAKM
                     KEMELKKKGLIGNDTVRTDPVPEVSMTSSSISDFLKLNTKKAESTTSTSNGPNDANPG
                     SDQVGIQKREGAMESLAGTSSRFSSFFNNSASSVSLPSKPAEVSKEHSVDNSESTSSV
                     SSGSRLMSFFNKDQERREQTPVYPNEQSKFMPPPPGLARQDEVKGQHTLPAQFPMAPM
                     QGARPQQSQTNNAFFQGLLNKGKISESLVSAPPGVPVSNNAPHLLSQGQRLGQAPPRN
                     VGVPPGFCIGMPPPGFGPPIQGGSIHGPSRLPMMTNVPKESGSPDSTIKKKNPQQQPL
                     AQRQVPMQPGMYHQFVPGMAPPGFPLMQGMPQGFNPNMFPPSNGIMPSNGQQFFPQPP
                     LPPPQAAVPSYSSFPNQPNAAQEGKTK"
     gene            complement(<826198..>829374)
                     /locus_tag="HG536_0G04630"
                     /db_xref="GeneID:59327842"
     mRNA            complement(<826198..>829374)
                     /locus_tag="HG536_0G04630"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285379.1"
                     /db_xref="GeneID:59327842"
     CDS             complement(826198..829374)
                     /locus_tag="HG536_0G04630"
                     /inference="similar to AA sequence:RefSeq:NP_012717.1"
                     /note="ancestral locus Anc_1.519"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141275.1"
                     /db_xref="GeneID:59327842"
                     /translation="MLDRIKEVVAVANSPVADVVTKKQALEYLDQVKSEAGAPQLFFN
                     LLSDTNSDEITKFFALQALTEVLNAPATAPQQLEFIKSAVMELLRDKVTNDARDPEYV
                     RNKIAEMTTGLFYRMYGETNNNMWGSFFQDIIAILCIECLKKGPAQEFSPIGLDYFNR
                     ICGTINSEIADQTFARSREAQLKNNSLKDSMRVQDVEIMTTIWLNSLKSIEPQQQREL
                     AVLTLSCIGSYISWIDVNLVVNDVYISVIYGYLDFTATKIACAQCLCEIISKKMKPFD
                     KLTLLRMLNLTDKVTSIEHDDLEVYEQMARLTNAIALELAKIFETCIASEPTAETEEV
                     AKTADMQIINQEAPLLLKFMEHEYDTVSQQCFPFISQYLAVLKKQFALGGKPGSAVHM
                     NSKRLPLDAAHQDFLASLLAVGFKKMRIDDSSNEDSEDEIDEFNDTVRSKLKVFQDSI
                     AVISPALYLESISNHIQTELAGPDWRDLELAIYQMHNLSESIRNNLFGMSKSEINGSQ
                     ATMIMSKFMSLLLGSSTVFQMDVPFVQILFFELVVRHYQFLNSDDKNEIALLNIFCSS
                     FGMFNKREKVRLRTWYLFTRLIKITKPKLTVEILSQIIGKISALLSVKVMVNNQEGIE
                     EDATFDSQLYLFEGIGLLIGANSDCNYDIIDEVLTPLFTDLEACISAQTQNPATVLQA
                     HHLLMAIGTLARGVHGGLVPENQVNNSLVNKKLIQRSLVEKFSNIAEVVLVSFSFFSK
                     HESVRDASRFTFARLTPVLNNEIVPYASKLIVLFLDSDLTTVEMNDFLGFLGQMIHMF
                     HTEEGCYQLFDNLLVPVINKVHASMTQIDSEEALETPGWHANGGSNSMTRPGKNVVVT
                     NSFRDKILLKKAYYAFLQSFVHNSVTSLLLSERNRGILSMILEDLLTYMPQEVQETST
                     IKLALNVLANLVRSFGSGKCTDEKDTHAAEIEKLEGLNEFLITKIVPLVFEIPFKPEN
                     KFNIKDGSCRVVACDLSRLLREIYLQSGAAGTAATDNPCLKYMIEVYFPQIQFPSDMG
                     LQFAQALATSDAKSFEKYYVDLIGSLSN"
     gene            complement(<829674..>830270)
                     /locus_tag="HG536_0G04640"
                     /db_xref="GeneID:59327843"
     mRNA            complement(<829674..>830270)
                     /locus_tag="HG536_0G04640"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285380.1"
                     /db_xref="GeneID:59327843"
     CDS             complement(829674..830270)
                     /locus_tag="HG536_0G04640"
                     /inference="similar to AA sequence:RefSeq:NP_012603.1"
                     /note="ancestral locus Anc_1.520"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141276.1"
                     /db_xref="GeneID:59327843"
                     /translation="MATNEIIFITGNENKLKEVQMILAPDASQTNASFVLVNRALDLD
                     EVQGVDLEEIALHKCKQAAAIVGPGRPVFVEDTALCFDEFNGLPGAYIKWFVKSMGLA
                     KIVKMLEPFENKDAQAVTTIAYADGEGTYHTFQGITRGRIVDSRGPTTFGWDSIFEPL
                     EAQGATYAEMHKKAKNLISQRGRAFAKFKQHLLDQANR"
     gene            complement(<830385..>831353)
                     /locus_tag="HG536_0G04650"
                     /db_xref="GeneID:59327844"
     mRNA            complement(<830385..>831353)
                     /locus_tag="HG536_0G04650"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285381.1"
                     /db_xref="GeneID:59327844"
     CDS             complement(830385..831353)
                     /locus_tag="HG536_0G04650"
                     /inference="similar to AA sequence:RefSeq:NP_012604.1"
                     /note="ancestral locus Anc_1.521"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141277.1"
                     /db_xref="GeneID:59327844"
                     /translation="MSTDFERHFQESVDGCSLESLRDILVNKSGNAELANRFRALFNL
                     KCVAEEFEKRPEEARKAVDYISEAFGDSSELLKHEVAYVLGQTKNMHSVTALRKATLD
                     QNQQCMVRHEAAEALGALGDKDSLDVLEEGYKNDPSLAVRETCELAINRIRWQHSDAR
                     ERENLQQSLYSSIDPAPPLALDKDYKVDELKSILNDTEKPLFERYRAMFRLRDVGTDE
                     AALALATGFDDESALFKHEIAYVFGQMGNKVVVPKLIEVLGRKKEAPMVRHEAAEALG
                     AIASDDVLPVLKSYLNDEVDVVRESAIVALDMYEYENSNELEYAPA"
     gene            <831663..>832700
                     /locus_tag="HG536_0G04660"
                     /db_xref="GeneID:59327845"
     mRNA            <831663..>832700
                     /locus_tag="HG536_0G04660"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285382.1"
                     /db_xref="GeneID:59327845"
     CDS             831663..832700
                     /locus_tag="HG536_0G04660"
                     /inference="similar to AA sequence:RefSeq:NP_012716.1"
                     /note="ancestral locus Anc_1.522"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141278.1"
                     /db_xref="GeneID:59327845"
                     /translation="MLEKMREGYKSQRIVAALDQASVCCTVCKLTCARIDSVDLKVLQ
                     KSSRLHHLLSLSLSWKRWILFCIMAPTLVVPLVSTGNVPQLTVDLLLHSLSSEFSFVR
                     SVDSTHLHPFVGPLDYVLDQPEPVLFKKSAPEKTYSTALELFYNQSKDVYVLQQRTPV
                     IRGYLNNYVKDVIIPLIEAHDIEDVVLLDSFGSLDQDVAEATTLSSRTSSNFISDGTC
                     EVGSVTDIIRNFQQSLNLNERSASSLPCSLFTFSAGSIQQEITTKQQVFNFAYHILNA
                     SLPTLKRIRYCSAYVHEGDNSEDAHLLCDHLPHIIASLGKIVNHTPPVSWKGVYGSRP
                     IPSSYDEGVFV"
     gene            complement(<832713..>833870)
                     /locus_tag="HG536_0G04670"
                     /db_xref="GeneID:59327846"
     mRNA            complement(<832713..>833870)
                     /locus_tag="HG536_0G04670"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285383.1"
                     /db_xref="GeneID:59327846"
     CDS             complement(832713..833870)
                     /locus_tag="HG536_0G04670"
                     /inference="similar to AA sequence:RefSeq:NP_012606.3"
                     /note="ancestral locus Anc_1.523"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141279.1"
                     /db_xref="GeneID:59327846"
                     /translation="MPLSTVICIGMAGSGKTTFMQRLNSHLRSKKNAPYVINLDPAVL
                     KIPYGANIDIRDSIKYKKVMENYQLGPNGAIVTSLNLFSTKIDQVIKLVESKKEKFQH
                     CIIDTPGQIECFVWSASGSIITESFASTFPTVIAYIVDTPRNTSPTTFMSNMLYACSI
                     LYKTKLPMIVVFNKTDVCKADFARDWMTDFEAFQTALRDDEDSNGTSGMGSGYMNSLV
                     NSMSLMLEEFYSQLDMVGVSSHTGEGFDDFLKAVDDKVGEYEEYYKAERERILKAKEE
                     EAKRRKEKSLDGLMKDLSLNQKTQPHKDTDDGADVLSDFEEGDDDGLVERDEDEGAER
                     EYTFPGEERTQGEVNERSAPDLQRRYQEAFENMAKDAGSKTAENIANYIRN"
     gene            complement(<834091..>834894)
                     /locus_tag="HG536_0G04680"
                     /db_xref="GeneID:59327847"
     mRNA            complement(<834091..>834894)
                     /locus_tag="HG536_0G04680"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285384.1"
                     /db_xref="GeneID:59327847"
     CDS             complement(834091..834894)
                     /locus_tag="HG536_0G04680"
                     /inference="similar to AA sequence:RefSeq:NP_012715.3"
                     /note="ancestral locus Anc_1.524"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141280.1"
                     /db_xref="GeneID:59327847"
                     /translation="MLADYWSWLLTGSAGAVAELTLDPKLKYWVLLPISIVMVLAGVL
                     RQYIMDLIGPKTSGMPRVKITETQYLNKAQAFLGNGSNLSEESFRARQEYLTLTLSEG
                     KFLVKTAAENGQVQNPFNDPNISDAMMNMAKGNLASFIPQTIIMWWVNHFFAGFVLMK
                     LPFPLTPRFKEMLQSGVMTSDLDVRWVSSISWYFISVLGLNPVYNLILSNPNEDQLGI
                     MQQQDPMGGMPGQPQPEAIAKSLASDLTIAQHESCFENIEQRVLDKYSK"
     gene            complement(<835107..>835820)
                     /locus_tag="HG536_0G04690"
                     /db_xref="GeneID:59327848"
     mRNA            complement(<835107..>835820)
                     /locus_tag="HG536_0G04690"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285385.1"
                     /db_xref="GeneID:59327848"
     CDS             complement(835107..835820)
                     /locus_tag="HG536_0G04690"
                     /inference="similar to AA sequence:RefSeq:NP_012714.1"
                     /note="ancestral locus Anc_1.525"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141281.1"
                     /db_xref="GeneID:59327848"
                     /translation="MGPVTRASTLRGQRKIFDSLGAPSFAYRYQLYDRDTVGTLEQKL
                     AERIAAAKYDWFFQNHSSMLLFEWPSDRTVDRDYYWREFANCVNRTFDGDSATTFLSD
                     KLSNEALDSCLGTPIASGRAEHRCMFQKGLEARSLAKLVDSVAQNASGLRLKALAFRL
                     ESEGEKHSNNFVASLQPVLEESMNMYRDIHYEKLLKIARQAKSDNSAKDVLAKLAEND
                     LTSPRLVRDGSWLMFASLK"
     gene            complement(<836023..>836889)
                     /locus_tag="HG536_0G04700"
                     /db_xref="GeneID:59327849"
     mRNA            complement(<836023..>836889)
                     /locus_tag="HG536_0G04700"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285386.1"
                     /db_xref="GeneID:59327849"
     CDS             complement(836023..836889)
                     /locus_tag="HG536_0G04700"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141282.1"
                     /db_xref="GeneID:59327849"
                     /translation="MAEPDHSTYKQGYSTHTVANHQRRTAEDDAAFVLPHINRRSVLL
                     DVGCGPGTITSGFAKYAPEGAVIGVDISADVLEKARGLAADAGIPASGPGSVTFELGN
                     VLDTLPYPDNTFDVVFCSQVLGHFPSADQVVRALTEMRRVLKPGGLLAAREAAFQHFS
                     PQGLDLDRLWTQNLGRALRGPQGGSTESIGAGLPALFRRAGFTDDGGKMVVGAGTSVI
                     AGREARGWIARRAAGQLQPGDPFRQSWLRAGITQQEIQETLRAVETWAETEDAWFVAL
                     QCEMRAWKVALD"
     gene            838419..838490
                     /locus_tag="HG536_0Gtrna10T"
                     /db_xref="GeneID:59327877"
     tRNA            838419..838490
                     /locus_tag="HG536_0Gtrna10T"
                     /product="tRNA-Thr"
                     /note="codon recognized: ACG"
                     /db_xref="GeneID:59327877"
     gene            complement(<838572..>839219)
                     /locus_tag="HG536_0G04710"
                     /db_xref="GeneID:59327850"
     mRNA            complement(<838572..>839219)
                     /locus_tag="HG536_0G04710"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285387.1"
                     /db_xref="GeneID:59327850"
     CDS             complement(838572..839219)
                     /locus_tag="HG536_0G04710"
                     /inference="similar to AA sequence:RefSeq:NP_012607.1"
                     /note="ancestral locus Anc_1.526"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141283.1"
                     /db_xref="GeneID:59327850"
                     /translation="MSCKWNSIEPACLKGSLASVLQSIEFDQKWFKIALFFVGFNPVF
                     WNVVARLEYRTHFLTRLAGGAKRGCYLLAFTIFSLGVARDLCFEWALRSQPVSAVLDQ
                     ELVRNAGRVCIGVGQVLVVTSMYQLGVTGTYLGDYFGILMDHIVTAFPFNVSNNPMYQ
                     GSTLSFLGYSLLQGKPAGLVITLFVHTMYSVALKFEEPFTAKIYAQRDAQRAKKE"
     gene            <839599..>843375
                     /locus_tag="HG536_0G04720"
                     /db_xref="GeneID:59327851"
     mRNA            <839599..>843375
                     /locus_tag="HG536_0G04720"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285388.1"
                     /db_xref="GeneID:59327851"
     CDS             839599..843375
                     /locus_tag="HG536_0G04720"
                     /inference="similar to AA sequence:RefSeq:NP_012713.1"
                     /note="ancestral locus Anc_1.527"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141284.1"
                     /db_xref="GeneID:59327851"
                     /translation="MIGIYRFVNFRKSWLLVVSMVISTGAAGVLPPVMAVLTGRVFNL
                     LANFAEGDDVGGEIVRRSMAIMALGAASLPVVWASIYCWMALGERQGFSVRRRLLDSY
                     LANAFEWYDAREDLAGKFTQLNRSVEELRASSAEASAVLIRSLVTIAALIGTCFHASW
                     SLTLVTLCSAPLIIACTYFFSRLVQKYADRENEQISKASQLVDWSVNAAQFIRLSGTE
                     LREVQKFKGCIQRSAESFIRMCLYASLNTGVLRFLTLAMFVQAFWFGSTMIRKGRLTV
                     GDVITCFHSCILLGSTINGALHQLVYWQKGTVAANQISKFLETSQVLPAQQSGPQFAP
                     AGRLRGDICFKDVDFTYPSRPQEQVLRKLSLNFTAGKTTFILGKSGSGKSSLANLLLK
                     FYAFQNGSICVDGTDIGYLDQESLIKSITVVEQRCTIFNGTLRDNIAIGLDESKRKDE
                     AELVKLVCRISLLERFIHDLDDGLSTVVGNGGLSLSGGQQQKVAIARALIKDPPVLIL
                     DEAVSALDVLQRSLIIKAIRAHREDKTTIILTHELDQVGPDDYCYIIDQGACIEQGYG
                     GQLNIDSSTNFYTWKHLHHDEENDTDISSQLTSVETPTDVKHKVFESVIDFEAETPRT
                     EKEVSYFSQDPESCMAYTSYSRSRKTRQRVLVGEQSEKIPSISLKDNQTLVPIHLILK
                     RMFMLRRRRILLLLGVLCSLIAGAANPIFSYTFSYLLNGIAPQENGVGSDGYLLKWSL
                     IVIGMAAADAIFNFAKDFLLGYCSECWIQQLRNEVMQGINMAQLKWFARETNKASEVS
                     ALLLNDLRDARALASDFVSTVSTFMVVSSVGLVWALVSGWKLSLVCISTFPLIIFFSA
                     FYGMLLQKQETQYKTAVADLENLLYEITNGIKTIRRLHLEASFLERYSKLEEKMAKIA
                     SRRALSTGLGIAVLEALTMCIQAILFYYALTLVFKGQYTTNKMFETLTLLLFTIMTSN
                     TLVNQIPDISRGQRAADFVFRMIRETKRVSSAQDSLPATGEIEDLPTVISIKNLTFAY
                     HTSPSINIFDNLSLELPAGTTVGIVGESGSGKSTLITLLTKLHEAESGTIQIENKNIN
                     DWNTRDLRSQIAVVEQRPTLFPGSVRENLVYGLMREVLEVEIYDLLKYVGIHDFIKNL
                     PLGLDAPIDQDLLSGGQAQRLCIARALLRKPRILILDECTSALDPESSHIINHIVREG
                     PPARLTISITHNVDMMKACSELVFLKNRKVAGKGSFENLYMQNKAFQTLVSSHY"
     gene            complement(<843511..>846570)
                     /locus_tag="HG536_0G04730"
                     /db_xref="GeneID:59327852"
     mRNA            complement(<843511..>846570)
                     /locus_tag="HG536_0G04730"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285389.1"
                     /db_xref="GeneID:59327852"
     CDS             complement(843511..846570)
                     /locus_tag="HG536_0G04730"
                     /inference="similar to AA sequence:RefSeq:NP_012712.1"
                     /note="ancestral locus Anc_1.528"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141285.1"
                     /db_xref="GeneID:59327852"
                     /translation="MSAIPVNGEIDEALYSRQLYVLGKEAMLKMQHSNVLVVGMRGLG
                     VEIAKNVVLAGVKSLAVYDPEPATLQDLSTQFFLTEADLGKPRDRVSRDKLAELNSYV
                     PVKVLESLQDDRQLLEYEVVVATDTVSLKEKILLNNICHAAGIKFICTETRGLFGSAF
                     VDLGEDFTVIDSTGEEPRTGIVSDIESDGTVTMLDENRHGLEDGNFVKFSEVEGLEKL
                     NDGTLFKVEVLGPFAFKIGSVEKYGKYKKGGSFTEVKVPQKMSFKSLQESLAAPEMLY
                     SDFAKVDRAGQLHLGFQALQRFSDRHNGRLPRPMNDEDAAELVSLTAGLAAEQPDVLG
                     GADAEINENVIKELAYQARGDIPGMVAFFGGFIAQEVLKACSGKFTPLKQYMYFDCLE
                     SLPSPEQYPRTEQTTAAINTRYDNQIAVFGLEFQKKITNLTVFLVGSGAIGCEMLKNW
                     ALMGLGSGVEGKIIVTDNDSIEKSNLNRQFLFRPKDVGRNKSEVAAEAVSVMNPALKG
                     KIEAKIDKVGPETENIFDDSFWQGLDFVTNALDNVDARTYVDRRCVFYRKALLESGTL
                     GTKGNSQVIIPRLTESYSSSRDPPEKSIPLCTLRSFPNKIDHTIAWAKSLFQGYFADA
                     PENVNLYLTQPNFVEQTMKQSGDVKSVLETIYEALNEKPATFDDCIKWARLEFEKKFN
                     HDVKQLLYNFPRDAKTSSGEPFWSGPKRAPTPLEFDINNDDHFDFIVGGANLRAFNYG
                     LVGDSGTPDKAAYATVLENVKISDFTPRSDIKIQVNDDDPDPNADGLDGIDSLKAFAS
                     TLPDPITLTDFRMIPVEFEKDDDTNHHIEFITACSNCRAQNYFIETVDRQRTKFIAGR
                     IIPAIATTTSLVTGLVNLELYKVADGKTDIEQYKNGFVNLALPFFGFSEPIASPKGSY
                     NGKSYDKIWDRFDVQGNVKLSDLIKHFQDKEGLEITMLSYGVSLLYASFFPPKKLKER
                     LNLSITDLVKFITKADVPPHVRTMILEICADDKEGEDIEVPFITIHL"
     gene            <846799..>847353
                     /locus_tag="HG536_0G04740"
                     /db_xref="GeneID:59327853"
     mRNA            <846799..>847353
                     /locus_tag="HG536_0G04740"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285390.1"
                     /db_xref="GeneID:59327853"
     CDS             846799..847353
                     /locus_tag="HG536_0G04740"
                     /inference="similar to AA sequence:RefSeq:NP_012608.1"
                     /note="ancestral locus Anc_1.529"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141286.1"
                     /db_xref="GeneID:59327853"
                     /translation="MGANAGLYGGAITTYLPDGFLDASLLREVPDTQEVYVNSRQDDE
                     SYDDGLGKNESVVIDLLERVDAGDDFEALKEHVMEIASFDSSSDVKFARLEQLADNQQ
                     ACVVVESVNKWGKRELNETVVLCVGLIRLADVATDVVITVHVPWSQNEPFAGQELPAP
                     IAAAYRLLLRMVSEFKVVDKSLFV"
     gene            <847489..>848676
                     /locus_tag="HG536_0G04750"
                     /db_xref="GeneID:59327854"
     mRNA            <847489..>848676
                     /locus_tag="HG536_0G04750"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285391.1"
                     /db_xref="GeneID:59327854"
     CDS             847489..848676
                     /locus_tag="HG536_0G04750"
                     /inference="similar to AA sequence:RefSeq:NP_012609.3"
                     /note="ancestral locus Anc_1.530"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141287.1"
                     /db_xref="GeneID:59327854"
                     /translation="MAKAKKGVFFKRWLLLVVPAVVALALVVRFLNNSKASDLQNLLQ
                     NLPKEISQSINSAASSQKSDADLMQQFEALANEIRRKQEDQSKQYEKQRLKLEKQIQE
                     LQQIPEKATLREKLVYAFRYDTKSKFPAYIWQVKPNFESDLEDILDRERNWDDKNPGF
                     VHEITNEDMAETLVRHFYSGIPEVIEAYLALPSTVLKVDFFKYLVLLARGGVFADMDT
                     NPLQPVPNWIPEEIEPHKIGIIVGVEHDANSPDWRSRYVRRLQFGTWIIQAKPGHPII
                     REVVAKITEATLQRKKEGALNVNLRNDLNIMSWTGSGLWTDVIFTYFNDYMRSGILRK
                     ITWKEFHELKEPKLLSDVLVFPQFSFNAPIEVKNDDPNKPLYFTTHKGRKSWKTAPKV
                     EGN"
     gene            complement(<849124..>850332)
                     /locus_tag="HG536_0G04760"
                     /db_xref="GeneID:59327855"
     mRNA            complement(<849124..>850332)
                     /locus_tag="HG536_0G04760"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285392.1"
                     /db_xref="GeneID:59327855"
     CDS             complement(849124..850332)
                     /locus_tag="HG536_0G04760"
                     /inference="similar to AA sequence:RefSeq:NP_012610.1"
                     /note="ancestral locus Anc_1.531"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141288.1"
                     /db_xref="GeneID:59327855"
                     /translation="MSSIIEASSTLRRRKHLKRGITFTLMVVGQSGSGRSTFINTLCG
                     QQVVDVSTTVMLPTDKSTEIELQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPS
                     FEVISDYVRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKEMDVEFIRKL
                     GSLVNVIPVISKSDSLTPDELKLNKKLIMEDVDRFNLPIYNFPFDEEDISEEDYQTNT
                     YLRSLLPFSIIGSNDVEDFGDGVTIRGRRYPWGTLDVEDSSISDFVVLRNTLLISHLH
                     DLKDYTHEILYERYRTEALSGESVPFARSTANAAADMNYVASPAISTPNKSVASNAEQ
                     PPANVPHDTYLAREEQIRLEEERLKAFEERVQQELLFKRKELLEREKELREIEERLER
                     EAQLKQESEA"
     gene            <850621..>852084
                     /locus_tag="HG536_0G04770"
                     /db_xref="GeneID:59327856"
     mRNA            <850621..>852084
                     /locus_tag="HG536_0G04770"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285393.1"
                     /db_xref="GeneID:59327856"
     CDS             850621..852084
                     /locus_tag="HG536_0G04770"
                     /inference="similar to AA sequence:RefSeq:NP_012711.1"
                     /note="ancestral locus Anc_1.532"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141289.1"
                     /db_xref="GeneID:59327856"
                     /translation="MSAKKVVLIDNYDSFTWNLYEYLCQEGADVEVYRNDKITVEEVI
                     QLKPDVILISPGPGHPRTDSGVSRDCIRHFAGKIPVFGICMGQQCMFDVFGGEVAYAG
                     EIVHGKTTEIFHDNKGIFRNVPQGVAVTRYHSLAGTQQSLPAELEITARTANGIIMGV
                     RHKEYTVEGVQFHPESILTEEGHLMMRNILSVEGGTWKQNDMKSVPNGVGKTKISTLE
                     RIYEQRKKDVEILMKTPGFTLQDLQTNYSLGLAPKCQNFYDRLIACQGRAAVLAEVKR
                     ASPSKGDIQPNAVAAEQALKYARAGASAISVLTEPHWFKGSLQDLINVRRALDLEYAD
                     NPSARPCVLRKEFIFSKYQILEAKLAGADTVLLIVKMLDQGLLQDLYDYATKEMGLEP
                     LVEVNSKEELERALAINARVIGVNNRDLHSFTVDLNTTSSLVGSVPAGKLLIALSGIT
                     SSKDAEEYKKEGVKGLLVGEALMKSSNVESFIKDLSF"
     gene            complement(<852199..>854070)
                     /locus_tag="HG536_0G04780"
                     /db_xref="GeneID:59327857"
     mRNA            complement(<852199..>854070)
                     /locus_tag="HG536_0G04780"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285394.1"
                     /db_xref="GeneID:59327857"
     CDS             complement(852199..854070)
                     /locus_tag="HG536_0G04780"
                     /inference="similar to AA sequence:RefSeq:NP_012710.1"
                     /note="ancestral locus Anc_1.533"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141290.1"
                     /db_xref="GeneID:59327857"
                     /translation="MAGPLLYSRTSEGLVFKSASTSEKADTVIQLSCQDQNVSLVGLE
                     EFPLQGKIKKIAALLGFIKLKLNRYAIIANRVEETGRLNRHVIYKIVDYSIIPVKKNA
                     RVDSDESEYLKLLEMHLNDSSLHFSYTYDLTNSLQRNEKIGPASWKTADTRFFWNHYL
                     TEDLRNLASTESHVSDFIQPVIYGYAKTVDKVLNSVPISVGLITRRSRFRAGTRYFRR
                     GIDEDGNVGNFNETEQILTVQGLRKENIQQFSFLQTRGSVPVYWAEINNLKYKPSLVI
                     GEQSSLDAAKKHFDEQKELYGDNYLVNLVNQSGHELPVKDAYESAVHALNDPKLHYIY
                     FDFHHECRKMRWYRVKLLIDHLKEMGLKKTDFFHVVRSPSGETIKIVSEQKSVVRTNC
                     MDCLDRTNVVQSVLAHWVLQEELERAGVITNSAAWEEDVQLLSTFQSFWADNADAVSC
                     SYSGTCALKTDFTRTGKRTRSGAVKDFVNSASRYYQNNLSDGPRQDSYDLILGNFRPY
                     MTSIQSPFPDRRPLYIQFMPTVIYAALTVLGATIVFPKDHFTSSKNLTFFLSAAIILI
                     VAARFLIQNGLQYVNWPKLVDVGFVVAQQTHNKEKEFKGLKYVPSSKFVKPNVGKKD"
     gene            <854318..>856447
                     /locus_tag="HG536_0G04790"
                     /db_xref="GeneID:59327858"
     mRNA            <854318..>856447
                     /locus_tag="HG536_0G04790"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285395.1"
                     /db_xref="GeneID:59327858"
     CDS             854318..856447
                     /locus_tag="HG536_0G04790"
                     /inference="similar to AA sequence:RefSeq:NP_012709.1"
                     /note="ancestral locus Anc_1.534"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141291.1"
                     /db_xref="GeneID:59327858"
                     /translation="MYQLSSTLEGHSQDVRDVAAISDDRIASVSRDGTLRVWSKQGDG
                     RSWQSVIAHQSDGFLNSVCYSKSNSLLFYGGKDSLINGSPVDAIQGEDPVYTLIGHNS
                     NVCSLDCLGGLVISGSWDKTAIVWENGTMKWQLRGHEASVWDAKILPGRTDEFLTASA
                     DMTVRLWKQDRLVKTFTGLHKDVIRHLEILPSGDRFATCSNDGTIKICDFDGKVLQTL
                     EGHESFVYSFKMCSNGELVSCGEDRTVRIWLRNGQLKQVIQLPAISVWTIDVLPNDDI
                     AVGSSDNSIRVFTENELRRAPPKEIDALQKEIESSTINSQTMGVDESKIEPYESLLVP
                     GKKEGQVVVVRAPTGVVEAHQFTQGVWSKIGDVVGSAQSGSGKKTEFEGKKYDYVFDV
                     DIEDGKPPLKLPVNTNDNPYTLADEFLARNDLPISYRDQVVNFILKNTSGVSLDQPNT
                     SRQVSNFSVLPVKEFLFMSEYNPETIFNGIVKLNSNQKTFDDESLAEIGAALHNADES
                     WELLYSYATTIRSQWQVKVPAYDLMRIIVAKLPYSRDIGDFIEEGLGNKNPAIAMLTA
                     RILTNCFQNENWGIGLMSSENVYSSVFVTIDDEFPQATEKQIQNFAIAVSTLLFNYSA
                     LVVKESKYHGIVPAISDAINTKFGIKTSFQNCEEAAYRLLIAFGNLATVEPSLKHFAG
                     SLSWTKKLKLMYGSSPRFQHVFRDLNI"
     gene            <856588..>857349
                     /locus_tag="HG536_0G04800"
                     /db_xref="GeneID:59327859"
     mRNA            join(<856588..856629,856700..856732,856849..>857349)
                     /locus_tag="HG536_0G04800"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285396.1"
                     /db_xref="GeneID:59327859"
     CDS             join(856588..856629,856700..856732,856849..857349)
                     /locus_tag="HG536_0G04800"
                     /inference="similar to AA sequence:RefSeq:NP_012708.1"
                     /note="ancestral locus Anc_1.535"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141292.1"
                     /db_xref="GeneID:59327859"
                     /translation="MSIEQSLSNIIDEDQASTDAKHKVTRYRRRDLRNSLASRIGTIE
                     NLPREGSEERGRESSLPPKRRVKLTNIPLDVSDYTLEDMMKEYGNPIYSNIYDSKDSR
                     TAVFEFEDEAVIEKILEKYNDTDLNGARLRVEVFNLNDKKNRRRNRRANQFSSRGSHY
                     GVRKERGTQRERVKMPTVQDLDAELEEYMNS"
     gene            complement(<857722..>859704)
                     /locus_tag="HG536_0G04810"
                     /db_xref="GeneID:59327860"
     mRNA            complement(<857722..>859704)
                     /locus_tag="HG536_0G04810"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285397.1"
                     /db_xref="GeneID:59327860"
     CDS             complement(857722..859704)
                     /locus_tag="HG536_0G04810"
                     /inference="similar to AA sequence:RefSeq:NP_009679.2"
                     /note="ancestral locus Anc_3.381"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141293.1"
                     /db_xref="GeneID:59327860"
                     /translation="MNVDDIKKARSAAEFNRENLESVLRGRFFYAPAFELYGGVSGLY
                     DYGPPGCAFQANVVDLWRKHFILEEDMLEVDCSMLTPYEVLKTSGHVDKFSDWMCRDL
                     KTGEIFRADHLVEEVLEARLKGDKAARGISEEEVEEDAEKKKRKKKVKQIKAVKLSDH
                     IVKEYQDILAKIDGYSGPELGELMVKYNIGNPATGEPLEAPREFNLMFETAIGPSGHM
                     KGYLRPETAQGQFLNFNKLLEFNNGKTPFASASIGKSFRNEISPRAGLLRVREFLMAE
                     IEHFLDPEDKSHPKFHEVKDVKLSFLPREAQEAGSTEPVVKTIGEAVESRMVDNETLG
                     YFIARIAQFLLKIGVDPNRMRFRQHLANEMAHYAADCWDGELLTSYGWIECVGCADRS
                     AYDLSVHSNKTKQKLVVRQKLDKPVEVTRWEIDLTKKLFGPKFRKDAPKVEAHLLDLS
                     QEELASKAEELKNTGKIVLKVNGIEGEVEMDDKFVTIEQRTKTEHVREYTPNVIEPSF
                     GIGRIIYSVFEHCFWSRPEDTARAVLSFPPLVAPSKVLLVPLSNHKDLAPVTAEVSKL
                     LRREKIPFKVDDSGVSIGKRYARNDELGTPFGVTIDFDSVKDGSVTLRERDSTKQVRG
                     SADEIIKAIREITYNGASWEEGTKNLAPFVSQSETD"
     gene            complement(<860080..>860508)
                     /locus_tag="HG536_0G04820"
                     /db_xref="GeneID:59327861"
     mRNA            complement(<860080..>860508)
                     /locus_tag="HG536_0G04820"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285398.1"
                     /db_xref="GeneID:59327861"
     CDS             complement(860080..860508)
                     /locus_tag="HG536_0G04820"
                     /inference="similar to AA sequence:RefSeq:NP_015407.1"
                     /note="ancestral locus Anc_3.382"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141294.1"
                     /db_xref="GeneID:59327861"
                     /translation="MGSVFLPHLHTGWHVDQAIVTETERLVVVRFGRAGDTECMMMDE
                     LLYSIAEKVKNFAAIYLCDIDEVPDFNEMYELHDPLTVMFFYRNKHMMCDFGTGNNNK
                     MNFLVDDKQEMIDILETIFRGARKNKGLVISPYDYNYKRV"
     gene            complement(<860715..>861224)
                     /locus_tag="HG536_0G04830"
                     /db_xref="GeneID:59327862"
     mRNA            complement(<860715..>861224)
                     /locus_tag="HG536_0G04830"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285399.1"
                     /db_xref="GeneID:59327862"
     CDS             complement(860715..861224)
                     /locus_tag="HG536_0G04830"
                     /inference="similar to AA sequence:RefSeq:NP_009680.2"
                     /note="ancestral locus Anc_3.383"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141295.1"
                     /db_xref="GeneID:59327862"
                     /translation="MFRSLIIKRLASTGAHQNSGQVTIPRRPLKKIRLGKARPAIYHE
                     FTVQVELSDGSVITRRSQFPKAQLRLIQDQRNNPLWNPSRDDLVVVDANASGRVDKFE
                     QRYGSMFSMKSEKPNAEVKAKEQAGEGQKADVGYEDPFEIDDYLSLLNEDSSQIKTGK
                     LATKKKSKK"
     gene            complement(<861529..>863427)
                     /locus_tag="HG536_0G04840"
                     /db_xref="GeneID:59327863"
     mRNA            complement(<861529..>863427)
                     /locus_tag="HG536_0G04840"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285400.1"
                     /db_xref="GeneID:59327863"
     CDS             complement(861529..863427)
                     /locus_tag="HG536_0G04840"
                     /inference="similar to AA sequence:RefSeq:NP_009681.3"
                     /note="ancestral locus Anc_3.384"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141296.1"
                     /db_xref="GeneID:59327863"
                     /translation="MTDDKSDLARLSPTPERCAALAKEYTLDIPHIPSLELPLCVSGS
                     QESVTKAIAMCGGLSKVKEIFSEHGENVDSQRGLELYLNEGRDDDGCERFFNEHPIIG
                     KKVPFRDESIILKIEMPKGTLAKHGQNIQKSLESLRSRDVRVTPVAIVNNTIKFREMS
                     DFQLRLDNVPSAEEFKTSFDALDWSKLKSFVESVPDQDARPFENISSLVIDRTSKIPG
                     GDFQLPPPPRLSMVSLPYQYNYKANPFATKKSNGVSEVKGTYIKNYQQFVHDMNDNTT
                     VPEKPHASLQKDYEAATATGVYPGTKKESGFYESLEECLKILKELFARRPIWVKRHID
                     GIVRKEIHHTLKIALALLSFRFTMGPWRNTYIRFGVDPRSSAQYARYQTEYFKIERRL
                     LRSPALRKHIPRPPPLIYESDTPGDIDSRFKFNGKQIPWYLMLQVDLLVEEPNIAEVY
                     SKVDFLPVANELTGWFPELDLAKIRRIVKYELGCMVQGNYDFNQYKLKYFKNMVYVKE
                     SMIKEQSTDPEGDVNMDEEDNIDSSKPIDDGVPNQEEDEDYDNGVATGEADEAALEAD
                     EADEDDYVPVTAINDGDDAEDFEDDQAFDVRSASFQEIIERIAKVNPNVAQRLQKELN
                     GLVNEADL"
     gene            complement(<863868..>864791)
                     /locus_tag="HG536_0G04850"
                     /db_xref="GeneID:59327864"
     mRNA            complement(<863868..>864791)
                     /locus_tag="HG536_0G04850"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285401.1"
                     /db_xref="GeneID:59327864"
     CDS             complement(863868..864791)
                     /locus_tag="HG536_0G04850"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141297.1"
                     /db_xref="GeneID:59327864"
                     /translation="MSAPVPQYSLSDYAKFALAGAIGCGSTHSAMVPIDVVKTRIQLE
                     PTVYNQGMVSSFKKIIGEEGAGALLTGFGPTLLGYSLQGAFKFGGYEVFKKLFIDTLG
                     YDTAVNYKNSIYMGSAAIAEFFADIALCPLEATRIRLVSQPNFANGLVGGFSRILKEE
                     GVGSFYNGFTPILFKQIPYNISKFLVFERAAEAYFGLAGPKEKLSATSVTGINLLAGL
                     TAGLAAAVVSQPADTLLSKVNKTKKAPGQSTIGLLAQLAKQLGFVGSFAGLPTRLVMV
                     GTLTSLQFGIYGSLKRSLGCAPTVEIGSSGH"
     gene            <865792..>867204
                     /locus_tag="HG536_0G04860"
                     /db_xref="GeneID:59327865"
     mRNA            <865792..>867204
                     /locus_tag="HG536_0G04860"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285402.1"
                     /db_xref="GeneID:59327865"
     CDS             865792..867204
                     /locus_tag="HG536_0G04860"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141298.1"
                     /db_xref="GeneID:59327865"
                     /translation="MAMGSALVAILASVAALGQAAVVGRQYAVAVDKIGTQEDIFRFL
                     GGAGPYFSFPFDNGIPEQTPDCCKLMQVQLFARHGERFPTKKKGNKILETYYKLANYT
                     GTFNESLSFLNDDYEFFVRDPEYYEEETTLKNSLNPLNPYTGERDAQRHSQNFLALYK
                     NLLNETSSFAVFTSNSKRCHDTAQFFIDGLGNDYNVSLQVIDEAPSSGANSLTPRYGC
                     ANFSESENDGYVRTYSREYLSNLAKRLNIENKGLNLTNSDAENLFFWCAYELNVRGYS
                     DICSIFTEEELIHFSYQDDLESYYENGNGNSLGAVAGSILFNASVELLKQSDDLEQKA
                     WLSFTHDSDLINYIAAVGLFDNGVKLNTSYVPFRDHVYRKSWIAPQGARIYTQKFSCY
                     NQSYVRYVVNDAVIPIESCSSGPGFSCPLEQFYDYAESRLSDINFSDKCGKIIATNAT
                     SLTFYWDYKTRNYNASLVKK"
     gene            <869898..>871388
                     /locus_tag="HG536_0G04870"
                     /db_xref="GeneID:59327866"
     mRNA            <869898..>871388
                     /locus_tag="HG536_0G04870"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285403.1"
                     /db_xref="GeneID:59327866"
     CDS             869898..871388
                     /locus_tag="HG536_0G04870"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141299.1"
                     /db_xref="GeneID:59327866"
                     /translation="MTVQAPLAQLTAEAYPKVKRNSKFKVLDAADIDFFRSILSSDEL
                     VESRSPEELASFNQDWMKKYRGQSNLVLLPNSTEKVSKIMKYCNDNKLAVVPQGGNTD
                     LVGASVPVFDEIILSLKNMNRIRDFDSVSGTFKCDAGVVMRDAHKFLHDHDHIFPLDL
                     PSRNNCHVGGVVSTNAGGLNLLRYGSLHGNVLGLEVVLPNGEIISSINALRKDNTGYD
                     LKQLFIGAEGTIGIITGVSILAAAKPKALNAIFCGIDNFDTVQDLFVKAKGELSEILS
                     AFEFMDRGSIECTIDYLKGLPFPLENHHNFYVLIETSGSNKRHDDEKLSAFLSSALDA
                     KLLSEGVMAKDKADYDRIWTWRKSVPPACNSYGGMYKYDMSLQLKDLYSVSEAVTKRL
                     NEAGLIGDAPKPIVKSVGYGHVGDGNIHLNIAVREFTKEIENLLEPFVYEYIASKKGS
                     ISAEHGVGFHKRGHLHYSRSDIEIRFMKDVKRHYDPNGILNPYKYI"
     gene            <872340..>873317
                     /locus_tag="HG536_0G04880"
                     /db_xref="GeneID:59327867"
     mRNA            <872340..>873317
                     /locus_tag="HG536_0G04880"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285404.1"
                     /db_xref="GeneID:59327867"
     CDS             872340..873317
                     /locus_tag="HG536_0G04880"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141300.1"
                     /db_xref="GeneID:59327867"
                     /translation="MARLALKQLLQENPRKVLVLDGGQGTELERRGINVANPVWSTIP
                     FIDDAFWSESSAERKIVEEMYRDFMKAGAEILMTVTYQASFKSVSENTPITTLSEYNS
                     LLTRIVDFARGCVGEDKYLIGSIGSWGAHVCCEFTGDYGPNPETIDYYEYFKPQLENF
                     NKSPQIDVIAFETIPNIHEIKAILSWDETILSKPFYIGLSVDDNGLLRDGTTMAEIAE
                     FIKSVGDKINPNFTLLGINCVSFNTSSDILASIHKVLPDMPLLVYPNSGEVYDAERKV
                     WHPNGDKSNTWDLVVKRYIEAGARVIGGCCRTTPEDITEVSEAVKKYSE"
     gene            <873848..>875032
                     /locus_tag="HG536_0G04890"
                     /db_xref="GeneID:59327868"
     mRNA            <873848..>875032
                     /locus_tag="HG536_0G04890"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285405.1"
                     /db_xref="GeneID:59327868"
     CDS             873848..875032
                     /locus_tag="HG536_0G04890"
                     /inference="similar to AA sequence:RefSeq:NP_116714.1"
                     /note="similar to Saccharomyces cerevisiae YFR055W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141301.1"
                     /db_xref="GeneID:59327868"
                     /translation="MTKSEETFPLGVDSLLCAVGRHTEEQFGFLNPPLYKGSTIIHKT
                     VKSLENHEGRFFYGIAGSPTIANLEDAWTKLTEAAGTVISPSGHGSIALAILSVISAG
                     CHILVPESVFPPTAVFCNTFLSRLAVEVEYYDPLIGVGIEKLIKDNTVAIYMESPGSN
                     TMEVQDVPAIVQIAKRNGLKTIIDNTWATPLFFKPHSFGVDLSIEAGTKYVGGHSDIL
                     LGLVTANEENWPALKSTYSCLGMLPGAEDCHMALRSLRTFRLRVREAERKALKIAKWL
                     QRRDEVERVLHPAFEECPGHEYWARDFRGSTGLFSIILRPRYSRASLEHMLENMVIFS
                     LGYSWGGYESLIVPLSEEVSERLKARNHYGYGLRLQIGLEDIEDLQKDLVLGFERLKS
                     VI"
     gene            <876022..>876741
                     /locus_tag="HG536_0G04900"
                     /db_xref="GeneID:59327869"
     mRNA            <876022..>876741
                     /locus_tag="HG536_0G04900"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285406.1"
                     /db_xref="GeneID:59327869"
     CDS             876022..876741
                     /locus_tag="HG536_0G04900"
                     /inference="similar to AA sequence:RefSeq:NP_012853.1"
                     /note="similar to Saccharomyces cerevisiae YKL070W"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141302.1"
                     /db_xref="GeneID:59327869"
                     /translation="MYIPKQYEVTDLAKQIEVIQKNPLGILFTARKSNSGLLSYVLGG
                     SSDAVDSELCATHLPFLFVEGKGGQKHKLIAHMAAKNGQIAHLEESGRVLIVFQGPHS
                     YMSPSWCPTKKKTHKVVPGWYYATLHVYGTPKIIRDKKWLLDQVSQLSDQEEGKRPEG
                     AEFEEKWKVTDAPERVIDAKLNGVVGVEIEISDMQCKFRFGQEMSKEDIEGVIHGFEH
                     ELGGEHGADLANIARECYSSR"
     gene            complement(<878170..>879366)
                     /locus_tag="HG536_0G04910"
                     /db_xref="GeneID:59327870"
     mRNA            complement(<878170..>879366)
                     /locus_tag="HG536_0G04910"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285407.1"
                     /db_xref="GeneID:59327870"
     CDS             complement(878170..879366)
                     /locus_tag="HG536_0G04910"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141303.1"
                     /db_xref="GeneID:59327870"
                     /translation="MLSEQTRAIIKQTVPVLEQHGTVITKTFYRNMLGDNKELLNYFN
                     RANQAKGAQSSALATTVLAAAKHIDDLSAILPHVEQIGHKHRALQIMPEHYPIVGKNL
                     LRAIKEVLGDAATPEIINAWAEAYGAIADVFISIEKKMYDEAAWPGWKSFEVVDKDQV
                     SSDIVEFTVKPDASSDVDLAKVPIVAGQYITVKSHPTRHNNEYDALRHYSICSVTSDR
                     GLRFAVKLEQPRDKPIGLVSEYLHKDVSVGDKLFLSAPAGDFTLDEELMNQTEVPLVL
                     LSAGVGVTPLLAMLEAQLLRNPERPIFWIQSSYDEATQAFKPHVEELLEKCESYEKII
                     VHTSKSSRIDDKFLKERVPGHADVYICGSLEFMRSMVDHFSTLNHKSDFIHYEPFGPK
                     MATVKV"
     gene            <880698..>881867
                     /locus_tag="HG536_0G04920"
                     /db_xref="GeneID:59327871"
     mRNA            <880698..>881867
                     /locus_tag="HG536_0G04920"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285408.1"
                     /db_xref="GeneID:59327871"
     CDS             880698..881867
                     /locus_tag="HG536_0G04920"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141304.1"
                     /db_xref="GeneID:59327871"
                     /translation="MSKELLKMGSIAYQNFLESLKITRPIIQAPMAGVTSPKMVAEVC
                     NNGALGSLPVSHINLKSSSGIAELRNLINEVKSYTRGTSLCRNVNLNFFCQEAILDIS
                     SAQKENWCSLYEKVSNIAIDRKEFVFEERSISFKEYEDGKAFQDLLAFFKDEYKPKVV
                     SFHFGHPTKRSIRALQDLGIQVYVTATCEEEYQLLLELQVDGVICQGYEAGGHRGNFL
                     QLSERFDEKLSTACLVKRIMRLPKTEHKKVPFIIPAGGLNTPTDVKYMLEIGASAVQI
                     GTAFLGTTECKVSKKLHEILHEGKRPEPTLMISTVSGKSARAISSPFLRNLHSTYANE
                     DLPDYGYMYNSFKKLRNLYPDKLNFMLAGQNYSSIETNLSIAELLTYLSESVECK"
     gene            <884403..>885383
                     /locus_tag="HG536_0G04930"
                     /db_xref="GeneID:59327872"
     mRNA            <884403..>885383
                     /locus_tag="HG536_0G04930"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285409.1"
                     /db_xref="GeneID:59327872"
     CDS             884403..885383
                     /locus_tag="HG536_0G04930"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141305.1"
                     /db_xref="GeneID:59327872"
                     /translation="MSLGADFSGLMDRNCPSELPDGYREVANRYQNEESEAWIGEWME
                     SRKIRDQLVIATKFTSDYKAYEVGKGRSANFGGNNRRSLHVSVRDSLKKLKTDWIDIL
                     YVHWWDHMTSIEELMDSLHVLVQQGKVLYLGASDTPAWVVSAANYYAVSHGKTPFSVY
                     QGRWNVMLRDFEREILPMARHFGMALVPWDVLGGGRFQTKESIEKRKDRGEKLRSFVQ
                     PPEQTEQEVKISSALEKVAKEHGTHSITAIVLAYVRSKGTNVFPLVGGRKVEHLKDNI
                     AALSIKLAPEQVSHLESVVPFDIVYPVFCLQFISLEKSSLSCWLFVYAEL"
     gene            complement(<887569..>891444)
                     /locus_tag="HG536_0G04940"
                     /db_xref="GeneID:59327873"
     mRNA            complement(<887569..>891444)
                     /locus_tag="HG536_0G04940"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285410.1"
                     /db_xref="GeneID:59327873"
     CDS             complement(887569..891444)
                     /locus_tag="HG536_0G04940"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141306.1"
                     /db_xref="GeneID:59327873"
                     /translation="MWFSFSLLVLGSFAPFLNAANVNTGAILGCAPQNMSPGFTVEFY
                     DYPLPYPGGNPHGGACYNPAYQQNSFLFDGRYQHLGNGLIGTSTGVVDLSFATTFNHA
                     CRVNEGTMPPNYNFDKQFATTNFSMLISGYLKAPKTGQYLFNLDYVDDLVYVNLGSGN
                     AFDCCQRESTVAYPGAFVLRAQWSGSNPTAQTVSIDLVGGVYYPIRIFYVNRDNLGAL
                     KLTITDADGVHHNDWSGFVFSGGDLPSAQKCDVLPITSTMGWPQTFTSTYTTVSTYSN
                     SVGSLTTGDVIVIETPIPPISTTTTTAWGGSYTTTYSTTTTQTIGKDGSTTPVVIYYV
                     ETPQSHGISTTYTPWTGTFSSTYATATTTVRGSDGVDTVSTIYYVETPQSHGISTTYT
                     PWSGTFASTYATATTTVRGSDGVDTVSTIYYVETPQSHSISTTYTPWTGTFSSTYATV
                     TTTVRGSDGVDTVSTIYYVETPQSHGISTTYTRWNGTFASTYATASSGPSSTPSGASN
                     VPSGSTTAQGASEVIRTGASSAPSSKPSGASSVPSSAPSGASNVHSGSTSGQGASDVT
                     RTGASSGATSGASSKPSGPSSGAVSGTSSKPSGPSAGASSAPTSKPSGASSGATSGAS
                     SKPSGPSAGASSAPTSKPSGASSGATSGASSKPSGPSAGASSAPTSKPSGASSGATSG
                     ASSKPSGPSAGASSAPTSKPSGASSGATSGASSKPSGPSAGASSAPTSKPSGASSGAT
                     SGASSKPSGPSSGAVSGTSSKPSGPSAGASSAPTSKPSGPSSGASSAPTFKPSGASSG
                     ATSGASSKPSGPSSGAVSGTSSKPSGASSGAASSVSSAPSGRSNVPSGSTSDQGASDV
                     TRTGASSTLTAKVSYGVSTTYTPWNGPFTSTYATAMTTVKGSDGIDTVSTIYYVETPQ
                     ANGVTTTYTPWTGTFSSTYATATTTVKGSDGLDTVSTIYYVETPQANGVSTIYTPWNG
                     PFTSTYATATTTVRGSDGVDTVSTIYYVETPQSHGISTTYTPWTGAFTSTFSTQITQT
                     VGTDGSTTQETIYHVETPSFWHYGNTTSEVTSFPASPITETTYYSTRGHDTSSGIQLL
                     STITMTSNGVTTIYTTTCPESEMSSRSQSWTTVTTTSNGVTAIYSTTCPESQLSRPSQ
                     TFSTKTPTFNTVTAISSTAVPGNDKTDDINTQTSDKHASTSIPREETTGTTKTETQAT
                     SLTTVAQEDSSEAVASSTEVVPSTLTFVPLITTSMIEQEVSSSASYGSISITTTQESS
                     VFISPFVGGAPARVVNSILLFVAALPLAL"
     gene            <897099..>898541
                     /locus_tag="HG536_0G04960"
                     /db_xref="GeneID:59327874"
     mRNA            <897099..>898541
                     /locus_tag="HG536_0G04960"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285411.1"
                     /db_xref="GeneID:59327874"
     CDS             897099..898541
                     /locus_tag="HG536_0G04960"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141307.1"
                     /db_xref="GeneID:59327874"
                     /translation="MSEFREYVRLKPQELKDQILGLLEGDLDDAKCKRFGALMTMVLL
                     KYTTLKRRKRNGEIKLHTFERYKRIVASSVVIKSREPETVVAFNYFTGGQPELEGEVN
                     DYFSKVKFQINSAKKSSMKDVFERSDMVWDDPKTLKAAGEATSIDESFKNLLSTVSSL
                     RDDILKPVMLRIPSYTRTPATRAEFPLMFLATVFNCCRQSDLTNADPSTFAVVEHEYL
                     GQYVQCLVTETKTRTARFIDFYPVAGEYDPIVALDRLLRDTEPQKKVFTSSFTTSQEY
                     QLLRSNLVGTYDKFLTKTCPFPIFQIKHGPKSHFGRHLMASYLSKCSLGQYVTPLGNW
                     SDRDDTIGSFIAKYGHRRRELPSYLYATAKRKYGHRRRELPSYLYAFLSGYYELIKVE
                     SNNGKEDYSCRLVHPDFKPIVVKQSGDCEGLSIECYREWKQIIDSDVLSFILKYSEAK
                     RRRGPLEAGMRSIITGPSPPSAPLQTENWP"
     gene            complement(<898887..>899360)
                     /locus_tag="HG536_0G04970"
                     /db_xref="GeneID:59327875"
     mRNA            complement(<898887..>899360)
                     /locus_tag="HG536_0G04970"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285412.1"
                     /db_xref="GeneID:59327875"
     CDS             complement(898887..899360)
                     /locus_tag="HG536_0G04970"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141308.1"
                     /db_xref="GeneID:59327875"
                     /translation="MTVIQDSIVIDREAEIVRKVFLDFAAYPTWKSSCIQKITVTTPS
                     KTSNDSIVPGDTLQVRIVLPNSKKENVFDPEVVENSEERFSWKGKLVLDSIFSGKHTF
                     EFCPIENGSKTKFVQTEEFNGLLAWPILKFIGKDTVKGFSEFNQRFKEHVEKCEF"
     gene            <905619..>906761
                     /locus_tag="HG536_0G04980"
                     /db_xref="GeneID:59327876"
     mRNA            <905619..>906761
                     /locus_tag="HG536_0G04980"
                     /product="uncharacterized protein"
                     /transcript_id="XM_037285413.1"
                     /db_xref="GeneID:59327876"
     CDS             905619..906761
                     /locus_tag="HG536_0G04980"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_037141309.1"
                     /db_xref="GeneID:59327876"
                     /translation="MSVEPFSIHISDSELNELGRRTTDVRFPKNIENEKWDRGISGAY
                     LSDVVEYWKTKYNWRKAEEGLNMFHHFKTTISNTSIHFIYEKGRASNSIPIILSHGWP
                     DSFLRYIKMIPLLTDPEKLGIDSKFSFDVVIPSLPGFGFSDYPKSGLINNETISDLWL
                     ELMTKKLGYHRFVASGGDIGSGVTRYLASKYPENLIGIHLTDVGIIRQLIGNSVEQSL
                     SSEEQNYVESISAWLKSEAGYMSIQATKPQTLAFGLSDSPVGLAAWILEKFHSWGGLK
                     TDLSLDDILTNIMIYWFNNNISTATRIYYENSHSLNPIGTIGVPTAVCLFSEDILLPP
                     REWVERNFNIVRWKVVRKGGHFTSMENPIAYAQDLFQFVEGLGKTL"
CONTIG      join(CP059252.1:1..917212)
//
DBGET integrated database retrieval system