KEGG   Rhodobacter sphaeroides ATCC 17029: Rsph17029_1378
Entry
Rsph17029_1378    CDS       T00484                                 

Name
(GenBank) Lysine exporter protein (LYSE/YGGA)
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
rsh  Rhodobacter sphaeroides ATCC 17029
Brite
KEGG Orthology (KO) [BR:rsh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsh02000]
    Rsph17029_1378
Transporters [BR:rsh02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Rsph17029_1378
SSDB
Motif
Pfam: LysE TerC
Other DBs
NCBI-ProteinID: ABN76488
UniProt: A3PJH2
Position
1:1433115..1433723
AA seq 202 aa
MLFLKALLMGLAIAAPLGPIGALCIQRTLAHGFRAGMAGGLGTALADACYAAAAAAGFAA
FAAALDRIQLPLGLGGGLFLIWLGLKGLRPEPPAAAAAAAAPRGLWSTLAATFLLTLANP
ATILSFAAIFAGLGLAREADLASGATVVAGVFAGSMLWWILLAGGVALAQRHLPRAFATW
VARASGALMLAFGLWALAAAFG
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctctttctcaaggcgcttctcatggggctcgccatcgcggcgcccctcggtccgatc
ggcgcgctctgcatccagaggacgcttgcgcatggtttccgggcggggatggccggcggc
ctcggcacggcgctggccgatgcctgctatgccgccgcggctgccgcgggctttgcggcc
ttcgccgcggccctcgaccggatccagctgccgctgggcctcggcggcgggctgttcctg
atctggctgggcctgaaggggctgaggcccgagccgcccgcggcggcggcggcggcggct
gcgccccgcgggctttggtcgacgctggccgccaccttcctgctcacgctcgccaacccc
gcgacgatcctctccttcgccgcaatcttcgcggggctgggccttgcgcgcgaggcggat
ctcgcctccggggcgacggtggtggcgggtgtcttcgcgggctcgatgctctggtggatc
ctgctcgccggcggcgtggccctggcgcagcgccatctgccgcgcgccttcgcgacctgg
gtcgcccgcgcctcgggtgcgctcatgctggccttcggcctctgggcgcttgcggcggcc
ttcggctag

DBGET integrated database retrieval system