KEGG   Cereibacter sphaeroides KD131: RSKD131_1038
Entry
RSKD131_1038      CDS       T00844                                 

Name
(GenBank) Lysine exporter protein (LYSE/YGGA) precursor
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
rsk  Cereibacter sphaeroides KD131
Brite
KEGG Orthology (KO) [BR:rsk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsk02000]
    RSKD131_1038
Transporters [BR:rsk02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   RSKD131_1038
SSDB
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: ACM00898
UniProt: B9KRV6
Position
1:1047879..1048493
AA seq 204 aa
MLMLFLKALLMGLAIAAPLGPIGALCIQRTLAHGFRAGMAGGLGTALADACYAAAAAAGF
AAFAAVLDRIQLPLGLGGGLFLIWLGLKGLRPEPPAAAAAAAAPRGLWSTLAATFLLTLA
NPATILSFAAIFAGLGLAREADLASGATVVAGVFAGSMLWWILLAGGVALAQRHLPRAFA
TWVARASGALMLAFGLWALAAAFG
NT seq 615 nt   +upstreamnt  +downstreamnt
gtgctgatgctctttctcaaggcgcttctcatggggctcgccatcgcggcgcccctcggc
ccgatcggcgcgctctgcatccagaggacgcttgcgcatggtttccgggcggggatggcg
ggcggcctcggcacggcgctggccgatgcctgctatgccgccgcggctgccgcgggcttt
gccgccttcgctgcggtgctcgaccggatccagctgccgctgggcctcggcggggggctg
ttcctgatctggctgggcctgaaggggctgaggcccgagccgcccgcggcggcggcggcc
gcggctgcgccccgcgggctctggtcgacgctggccgccaccttcctgctcaccctcgcc
aatcccgcgacgatcctctccttcgccgcgatcttcgcggggctgggccttgcgcgcgag
gcggatcttgcctccggggcgacggtggtggcgggtgtcttcgcgggctcgatgctctgg
tggatcctgctcgccggcggcgtggccctggcgcagcgccatctgccgcgcgccttcgcg
acctgggtcgcccgcgcctcgggtgcgctcatgctggccttcggcctctgggcgcttgcg
gcggccttcggctag

DBGET integrated database retrieval system