KEGG   Cereibacter sphaeroides 2.4.1: RSP_2720
Entry
RSP_2720          CDS       T00284                                 

Name
(GenBank) Putative LysE/RhtB family amino acid efflux pump
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
rsp  Cereibacter sphaeroides 2.4.1
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_2720
Transporters [BR:rsp02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   RSP_2720
SSDB
Motif
Pfam: LysE TerC
Other DBs
NCBI-ProteinID: ABA78875
UniProt: Q3J2V9
Position
1:1370472..1371080
AA seq 202 aa
MLFLKALLMGLAIAAPLGPIGALCIQRTLAHGFRAGMAGGLGTALADACYAAAAAAGFAA
FAAALDRIQLPLGLGGGLFLIWLGLKGLRPEPPAAAAAAAAPRGLWSTLAATFLLTLANP
ATILSFAAIFAGLGLAREADLASGATVVAGVFAGSMLWWILLAGGVALAQRHLPRAFATW
VARASGALMLAFGLWALAAAFG
NT seq 609 nt   +upstreamnt  +downstreamnt
atgctctttctcaaggcgcttctcatggggctcgccatcgcggcgcccctcggtccgatc
ggcgcgctctgcatccagaggacgcttgcgcatggtttccgggcggggatggccggcggc
ctcggcacggcgctggccgatgcctgctatgccgccgcggctgccgcgggttttgcggcc
ttcgccgcggccctcgaccggatccagctgccgctgggcctcggcggcgggctgttcctg
atctggctgggcctgaaggggctgaggcccgagccgcccgcggcggcggcggcggcggct
gcgccccgcgggctttggtcgacgctggccgccaccttcctgctcacgctcgccaacccc
gcgacgatcctctccttcgccgcaatcttcgcggggctgggccttgcgcgcgaggcggat
ctcgcctccggggcgacggtggtggcgggtgtcttcgcgggctcgatgctctggtggatc
ctgctcgccggcggcgtggccctggcgcagcgccatctgccgcgcgccttcgcgacctgg
gtcgcccgcgcctcgggtgcgctcatgctggccttcggcctctgggcgcttgcggcggcc
ttcggctag

DBGET integrated database retrieval system