KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2137
Entry
Rsph17025_2137    CDS       T00512                                 

Name
(GenBank) Lysine exporter protein (LYSE/YGGA)
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsq02000]
    Rsph17025_2137
Transporters [BR:rsq02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Rsph17025_2137
SSDB
Motif
Pfam: LysE LptF_LptG
Other DBs
NCBI-ProteinID: ABP71027
UniProt: A4WUG3
Position
complement(2166588..2167196)
AA seq 202 aa
MMLFFKATLMGLAVAAPLGPIGALCIQRTLSHGFRAGVVGGLGTALADACYAAAAAAGFA
TFAAVLDRIALPLGLGGGAFLIWLGLRSLRARPQSGAAQAAAGGLGATLAATFLLTLANP
ATILTFAAIFAALGLAREADPVSAALVVAGVFTGSMLWWILLAGMVAAAQRRLPPAFGPW
VARISGIFMLGFGLWTIARAMS
NT seq 609 nt   +upstreamnt  +downstreamnt
atgatgctgttcttcaaggccacgctcatggggcttgccgtggccgcgccgctcgggccc
atcggcgccctctgcatccagcggacgctgtcacacgggttccgggcaggtgtggtgggc
ggtctcggcacggcgctggcggacgcctgctatgcagccgctgcggccgcgggatttgcg
accttcgcggccgtcctcgaccgcatcgccctgccgctcggcctggggggaggggcgttt
ctgatctggctgggccttcgcagcctgcgagcccgtccccagtcgggtgcggcgcaggcg
gcggccggcggtctcggggccacgctggccgcgaccttccttctcacgctcgccaatccg
gcaacgatcctgacgtttgcggccatctttgcggccctcggcctcgcgcgcgaggcggat
ccggtctcggcagccctcgtcgtggcgggcgtcttcaccggctcgatgctgtggtggatc
ttgctggcgggaatggttgcggccgcccagcgccgtttgccacccgcgttcgggccgtgg
gtggcgcgcatctcggggattttcatgctgggcttcggcctctggaccatcgcgcgcgcg
atgagttga

DBGET integrated database retrieval system