KEGG   Raphanus sativus (radish): 108846403
Entry
108846403         CDS       T06014                                 

Name
(RefSeq) tricyclene synthase, chloroplastic-like
  KO
K12467  myrcene/ocimene synthase [EC:4.2.3.15]
Organism
rsz  Raphanus sativus (radish)
Pathway
rsz00902  Monoterpenoid biosynthesis
rsz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rsz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    108846403
Enzymes [BR:rsz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     108846403
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth Sterile
Other DBs
NCBI-GeneID: 108846403
NCBI-ProteinID: XP_018475132
UniProt: A0A6J0MRQ6
Position
Unknown
AA seq 594 aa
MASLLQMCSPLIHSNVIVKTIQRPQSFTCTILAKTTPSDESPVVPRRSAKYQPSLWDHHN
LLSVENKYTNHKSVRERDLLKENVRKMLNDESTTHTEQLKLIDDLQKLGVSYHFEREIDN
ILTISYQKDRRNFTEYTMEKDLYATALEFRLLRQHGFNVSEDVFNVFMENFGRFESDDIN
GLISLYEASYLSTKSDIKLQKFIRFFAAQQLRDFVDTNGNKDLASCHTVQMVVQALDMPY
YWRMRRLATRWYIDIYGKRPNKNPVLIELVKLDFNIVQAVHQEELKYVSSWWRETGLASQ
LHFARDRIVENYFWTIGQIQEPQFGYVRRTMAKINALLTSIDDIYDIYGTLEELQLFTTA
FENWDVNRLDELPEYMRLCFLVVYNEVNSIGCDILRKKNINVIPFLKKSWADVCNAYLVE
AIWYKRGHKPNMEEYMQNAWKSISAPTIFVHFYCVFSDQLSIQVLETLSEHQQKIVRCSA
SVFRLANDLVTSPDELARGDVPKSIQCYMTDTGASEVKARVHVRQMINEMWDEMNYEKMQ
SRSSVIPQEFVEAVMNLARMSQCMYQYGDGHGSPEKAKITDRIVSLLFNSIPLD
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggctagtctactgcagatgtgttcacctcttatacatagtaatgtcattgtgaagact
atccaacgtcctcagtcattcacatgcaccatactagctaaaacgacaccgagtgatgag
tctccagttgttcctcgtcgttccgcaaagtatcagccttctctttgggaccatcacaat
ctcctctcggtcgagaataaatatacgaatcataaaagtgtgcgcgagagagatttattg
aaagaaaatgtgagaaagatgctcaatgatgagagtacaactcacaccgagcaattgaag
ctcattgacgatttacaaaaactaggagtttcttaccattttgaacgggaaattgacaat
atattaacaatttcttatcaaaaagatagaagaaacttcactgagtatacaatggaaaaa
gatctatatgccacagctctggaattccgactactcagacaacatggtttcaatgtttca
gaagatgtatttaatgttttcatggagaactttgggaggtttgagagcgatgatataaat
ggtctgatatctctgtacgaggcgtcatatctttcaacaaaatcggatattaagctgcaa
aaattcatcagattttttgcagcgcaacaacttagagactttgttgacactaatggtaat
aaagatttagcatcatgtcacaccgtacagatggtggtccaagcgttagatatgccctac
tattggcgaatgagaaggctagccactagatggtacatagatatatatggaaagagacct
aacaagaaccctgtcttaattgaactcgtcaagctcgatttcaatatcgtgcaagctgtt
caccaagaagaactcaaatacgtctccagctggtggagggagacaggtttagctagtcaa
cttcactttgcaagagatagaatagtggagaactacttttggactattggacaaatccaa
gagcctcaatttggttacgttcgacgaacaatggcaaaaataaatgcacttcttacaagt
atcgatgacatctacgatatatatggcactcttgaagaacttcaactcttcactaccgcg
tttgaaaattgggatgtaaatcgtcttgatgaactccccgagtacatgaggttgtgtttt
ctcgttgtttacaatgaagtcaatagcattggatgtgatatcctcagaaaaaaaaatatc
aatgtgattcctttccttaaaaagtcttgggcagatgtatgcaatgcatatttagtagaa
gcaatatggtacaaaagaggacacaaaccaaatatggaagagtatatgcaaaatgcttgg
aaatcaatatcagccccaacgatatttgttcacttctactgcgtattctccgaccaactc
tctattcaagttctggagactttgtccgaacaccaacaaaagatcgttcgatgctctgcg
tctgtgttccgtctagcgaacgaccttgtaacctcgccggatgaattggcgagaggagat
gtgcctaaatcgatccagtgttacatgaccgataccggagcttcagaagtgaaagcacgt
gtgcacgtgcggcagatgatcaacgaaatgtgggacgaaatgaattacgaaaaaatgcaa
agtcgctcttccgtaatccctcaagaatttgtggaagcggtaatgaatttggcacgtatg
tcccaatgcatgtatcaatatggagatggccatggctctccagagaaagccaaaatcact
gatcgtatcgtctccttactctttaactccattccactagattga

DBGET integrated database retrieval system