Streptomyces albidocamelliae: N8I86_05590 Help Entry N8I86_05590       CDS       T10602                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sabd  Streptomyces albidocamelliae Pathway sabd00261   Monobactam biosynthesis sabd01100   Metabolic pathways sabd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sabd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     N8I86_05590  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sabd01008]     N8I86_05590 Polyketide biosynthesis proteins [BR:sabd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     N8I86_05590 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF7012 Motif Other DBs NCBI-ProteinID:  UXY34247 Position 1174547..1174759 Genome browser AA seq 70 aa AA seqDB search MATNPFDDADGRFVVLVNDEGQHSLWPARIRRPEGWQQMREEGSKQECTEYIEANWTDLR PRSVVAAMGG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcaaccaacccgttcgacgacgccgacggccgtttcgtcgtcctggtcaacgacgag ggccagcactcgctgtggccggcccgcatccggcgcccggagggctggcagcagatgcgc gaggagggcagcaagcaggagtgcaccgagtacatcgaggccaactggacggacctgcgc cctcgttcggtggtggccgcgatgggcggctga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (2) Pfam (2) All databases (3) Download RDF

DBGET integrated database retrieval system