KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1677
Entry
SACOL1677         CDS       T00225                                 

Definition
(GenBank) aminotransferase, class V
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00730  Thiamine metabolism
sac01100  Metabolic pathways
sac01240  Biosynthesis of cofactors
sac04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SACOL1677
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACOL1677
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sac03016]
    SACOL1677
   03029 Mitochondrial biogenesis [BR:sac03029]
    SACOL1677
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sac02048]
    SACOL1677
Enzymes [BR:sac01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SACOL1677
Transfer RNA biogenesis [BR:sac03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    SACOL1677
 Prokaryotic type
    SACOL1677
Mitochondrial biogenesis [BR:sac03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SACOL1677
Prokaryotic defense system [BR:sac02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SACOL1677
SSDB
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Pyridoxal_deC Beta_elim_lyase
Other DBs
NCBI-ProteinID: AAW36784
UniProt: A0A0H2WWH6
Position
complement(1706920..1708062)
AA seq 380 aa
MEIYADYAATTPVKPEVVDAMMTIYNSHYGNPSSIHAKGRDARKYLDESRRQIAQLLGAD
THEIIFTSGATESNNTAIKGIVKANEQLGNHIITSKIEHHSVLHVFEQLEREGFDVTYLD
VDDTGAIDLDQLEETITDKTILVSIMFVNNEVGTVQQIYDIQDIIAETNAYFHVDAVQAI
GHLDVKFDEFEIDAMSITAHKFGGPKGVGALLVKDHVTLDYPQLGGEQELKRRAGTENLA
QIVGMAKALQLAEKNRDDNNIHLMNLKEQFLVKLQERAIPFELNGSMTDATGHIVNLYFP
FVEVETMLTLLDMAQIYVSSGSACTAGSTQPSHVLDAMFEDEERSNHSIRFSFNELTTEN
EINAIVAEIHKIYFKFKEES
NT seq 1143 nt   +upstreamnt  +downstreamnt
atggaaatttatgcagattatgctgcgaccacaccagtaaaacctgaagtagtagatgcg
atgatgacgatttacaattcgcattatggtaatccatcatcaatacatgctaagggaaga
gatgcgcgtaaatatttagatgagtcaagacgtcaaattgcacaattacttggtgcagat
acacatgaaattatatttacgagtggcgcaacagaatcgaataatacggcaattaaaggc
atagtaaaagcaaatgaacaattgggtaatcacattatcacatcgaagattgaacatcat
tctgtgttacatgtttttgaacaattagagcgagaaggttttgatgtaacatatctagat
gttgatgatacaggtgctattgatttagatcaacttgaagaaacaattacagataagacg
attttagtatctattatgtttgtaaataatgaagttggcacagtgcaacaaatttatgat
attcaagatattattgctgagacaaatgcatatttccatgttgatgcggttcaagcaatt
ggacatcttgatgttaagtttgacgaatttgagatcgacgcaatgagtattactgctcat
aagtttggcggaccaaaaggtgtcggtgcattactagttaaagaccatgttacactagat
tatcctcaacttggcggtgaacaagaattgaaacgccgtgcaggcactgaaaatcttgcg
caaattgttgggatggctaaagcattacaattagcagaaaagaatcgagacgataacaat
attcatttaatgaatttaaaagaacaatttttagttaaattacaagaaagagcgattcca
tttgaattaaatggttcaatgacggatgctacaggccatattgtaaatctatattttccg
tttgttgaagttgaaacgatgttaacattgttggatatggcacaaatctatgtgtcgtct
ggatctgcatgtacagcaggctctacacaaccgtcgcatgttttagatgcaatgttcgaa
gatgaggagcgatcaaatcattcgattcgatttagttttaacgaattgactactgaaaat
gaaattaatgcaattgtagctgaaattcataaaatatattttaaatttaaggaggagtca
taa

KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1765
Entry
SACOL1765         CDS       T00225                                 

Definition
(GenBank) aminotransferase, class V
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00730  Thiamine metabolism
sac01100  Metabolic pathways
sac01240  Biosynthesis of cofactors
sac04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SACOL1765
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACOL1765
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sac03016]
    SACOL1765
   03029 Mitochondrial biogenesis [BR:sac03029]
    SACOL1765
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sac02048]
    SACOL1765
Enzymes [BR:sac01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SACOL1765
Transfer RNA biogenesis [BR:sac03016]
 Eukaryotic type
  tRNA modification factors
   Thiolation factors
    SACOL1765
 Prokaryotic type
    SACOL1765
Mitochondrial biogenesis [BR:sac03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SACOL1765
Prokaryotic defense system [BR:sac02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SACOL1765
SSDB
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 EF-hand_1 AcaB
Other DBs
NCBI-ProteinID: AAW38294
UniProt: A0A0H2WZA8
Position
complement(1804486..1805625)
AA seq 379 aa
MIYLDNAATTKAFEEVLDTYLKVNQSMYYNPNSPHKAGLQANQLLQQAKTQINAMINSKT
NYDVVFTSGATESNNLALKGIAYRKFDTAKEIITSVLEHPSVLEVVRYLEAHEGFKVKYV
DVKKDGSINLEHFKELMSDKVGLVTCMYVNNVTGQIQPIPQMAKVIKNYPKAHFHVDAVQ
AFGKISMDLNNIDSISLSGHKFNGLKGQGVLLVNHIQNVEPTVHGGGQEYGVRSGTVNLP
NDIAMVKAMKIANENFEALNAFVTELNNDVRQFLNKYHGVYINSSTSGSPFVLNISFPGV
KGEVLVNAFSKYDIMISTTSACSSKRNKLNEVLAAMGLSDKSIEGSIRLSFGATTTKEDI
ARFKEIFIIIYEEIKELLK
NT seq 1140 nt   +upstreamnt  +downstreamnt
ttgatatatctagataatgcggcaacgacgaaagcatttgaagaagtgttagatacttat
ttaaaagtaaatcaatcaatgtattataatccgaatagtccgcataaagctggtttgcag
gcaaatcaattactacaacaagcaaaaacccaaattaatgcaatgattaattcaaaaaca
aattatgatgttgtattcactagtggtgcaactgaatccaataatcttgctttaaaaggt
attgcctatcgtaaatttgatacagcgaaggaaataattacatccgtgttagagcatccg
tccgtattagaggttgtaagatatttggaagcacacgaaggatttaaagttaaatatgtt
gatgtaaagaaagatggcagtattaacttagaacacttcaaagaattaatgtcagacaaa
gtcggtttagtaacatgtatgtatgtaaataatgtaactggacaaatacagcctattcca
caaatggctaaagttataaaaaattatcctaaggcacattttcatgtagatgcggttcaa
gcattcggcaaaatttcaatggatctcaataacatagatagtattagtttaagtggacac
aagtttaatggtttaaaaggacaaggcgtcttacttgtaaatcacattcaaaatgttgaa
ccaactgtccatggtggtggtcaagaatatggcgttagaagtggaacagttaatttgcca
aatgatattgcaatggttaaagcgatgaagatagctaatgaaaactttgaagcattgaat
gcatttgttactgagttaaataatgacgtccgtcaatttttaaataaatatcatggagtt
tatattaattcttcaacttcaggttcaccattcgttttaaatattagttttcctggcgta
aaaggtgaagtattagttaatgctttttcaaaatatgacattatgatatctacgacaagt
gcttgttcatctaaacgtaataaattaaatgaagtattggctgcaatgggattatcagac
aaatctattgaaggtagtataagattatcatttggggctactacaactaaagaagatata
gcgaggtttaaagaaatatttatcatcatttatgaggaaattaaggagttgctaaaataa

DBGET integrated database retrieval system