KEGG   Staphylococcus aureus subsp. aureus COL (MRSA): SACOL1764
Entry
SACOL1764         CDS       T00225                                 

Gene name
thiI
Definition
(GenBank) thiamine biosynthesis protein ThiI
  KO
K03151  tRNA uracil 4-sulfurtransferase [EC:2.8.1.4]
Organism
sac  Staphylococcus aureus subsp. aureus COL (MRSA)
Pathway
sac00730  Thiamine metabolism
sac01100  Metabolic pathways
sac01240  Biosynthesis of cofactors
sac04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sac00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SACOL1764 (thiI)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SACOL1764 (thiI)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sac03016]
    SACOL1764 (thiI)
Enzymes [BR:sac01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.4  tRNA uracil 4-sulfurtransferase
     SACOL1764 (thiI)
Transfer RNA biogenesis [BR:sac03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    SACOL1764 (thiI)
SSDB
Motif
Pfam: ThiI THUMP QueC ATP_bind_3 PilN_bio_d
Other DBs
NCBI-ProteinID: AAW38293
UniProt: Q5HF59
Position
complement(1803263..1804486)
AA seq 407 aa
MKYDHLLVRYGELTLKGSNRKKFVNQLRNNVNKSLKGLDGFVVKGKRDRMYIELEDHADI
NEITYRLSKIFGIKSISPVLKVEKTIEAISAAAIKFAQQFEENSTFKIDVKRADKNFPMD
TYELQRELGGAVLKHFDNISVNVKRPDHEIRVEVRLDAIYMYEEVVPGSGGLPVGTGGKT
LLMLSGGIDSPVAGMEVMRRGVTIEAIHFHSPPFTSDQAKEKVIELTRILAERVGPIKLH
IVPFTELQKQVNKVVHPRYTMTSTRRMMMRVADKLVHQIGALAIVNGENLGQVASQTLHS
MYAINNVTSTPVLRPLLTYDKEEIIIKSKEIGTFETSIQPFEDCCTIFTPKNPVTEPNFD
KVVQYESVFDFEEMINRAVENIETLEITSDYKTIKEQQTNQLINDFL
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgaagtatgatcacttgcttgttagatacggggagttaacattaaagggttcaaataga
aagaaatttgtaaatcaattaagaaataatgtaaataagtcattaaaaggacttgatggg
tttgtcgttaaaggcaaacgagatcgtatgtatattgaacttgaagaccatgcagatata
aatgaaataacatatcgattatcaaaaattttcggtattaaatctattagtccagtatta
aaagtagaaaaaacaatagaggcaataagtgcagcggcaattaaatttgcgcagcaattt
gaagaaaacagcacatttaaaattgatgtgaagcgtgccgataaaaatttcccaatggat
acgtatgaattacagcgtgaattgggtggtgcagtattgaagcacttcgacaatatttca
gtgaatgtcaaacgtccagatcatgaaattcgagtggaagttagattagatgcaatttat
atgtatgaagaagttgttccgggttcaggtggattaccagttggtactggtggtaagacg
ttactaatgctttcaggcggtatagactcaccagttgctgggatggaagtgatgagacgt
ggcgtaacaattgaagcgattcatttccatagtccaccatttacaagtgatcaagcaaaa
gaaaaagttattgaattgacacgtattttagctgaacgtgttggaccaattaaattgcat
attgtaccatttacagaattgcaaaaacaggtaaataaagttgtacatccaagatataca
atgacttcaacgagacgtatgatgatgcgtgttgctgataaattagtacatcaaataggg
gctttagctattgtaaatggtgaaaacctagggcaggtagccagtcaaacacttcatagc
atgtatgcaattaataatgtaacttctactcctgtattacgtcctttattaacttacgat
aaagaagaaattattattaaatcgaaagaaattggtacatttgaaacatctattcaacca
tttgaagattgttgtacaattttcacccctaaaaatccagtaaccgaaccaaactttgat
aaggtagtccaatatgaaagtgtctttgattttgaagagatgattaatcgtgctgttgaa
aatattgaaacacttgaaataactagtgattataaaactattaaagaacagcaaacaaac
caattaataaacgactttttataa

DBGET integrated database retrieval system